HHsearch alignment for GI: 254780921 and conserved domain: PRK06598

>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed.
Probab=96.57  E-value=0.0026  Score=37.87  Aligned_cols=84  Identities=14%  Similarity=0.102  Sum_probs=48.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHCC----CEEEEECHHH-----CCCCCHHH----H-HHHHHHCCCCEEEECCCCCCCCCCC
Q ss_conf             4999978897889999999649----8599961367-----08789999----9-9999755998999786344543223
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQD----VEIIRVGRPD-----IDLLKPKD----F-ASFFLSFSPDVIINPAAYTAVDKAE   67 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~~----~~v~~~~r~~-----~D~~~~~~----~-~~~l~~~~pd~Vih~Aa~~~~~~~e   67 (290)
T Consensus         4 kVaIvGATG~vG~eli~lL~~~~~p~~~i~~~aS~~s~G~~~~~~~~~~~~~~~~~~~~~--~~Di~f~a~~~-------   74 (348)
T PRK06598          4 NVGVVGATGMVGSVLLQMLEERDFPVIEPVFFASSRSGGKAPSFGGKTLLVDALDIEDLK--GLDIALFSAGG-------   74 (348)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCEECCCEEEEEECCHHHHH--CCCEEEECCCC-------
T ss_conf             799989845999999999986799962499998756689875068955478627855760--79999986882-------


Q ss_pred             CCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             32210242012221100011223333334455321113
Q gi|254780921|r   68 DEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFD  105 (290)
Q Consensus        68 ~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~  105 (290)
T Consensus        75 -----------~~s~~~~~~~~~~g~~VIDlSs~fR~~  101 (348)
T PRK06598         75 -----------DYSKEVAPKLRAAGGVVIDNASALRMD  101 (348)
T ss_pred             -----------HHHHHHHHHHHHCCCEEEECCHHHCCC
T ss_conf             -----------356888899975898999886431036