HHsearch alignment for GI: 254780921 and conserved domain: PRK06732

>PRK06732 phosphopantothenate--cysteine ligase; Validated.
Probab=97.35  E-value=0.0009  Score=40.45  Aligned_cols=63  Identities=21%  Similarity=0.318  Sum_probs=46.2

Q ss_pred             CEEEEECC----------------CCHHHHHHHHHH-HCCCEEEEECHHH------------CCCCCHHHHHHHHHHC--
Q ss_conf             94999978----------------897889999999-6498599961367------------0878999999999755--
Q gi|254780921|r    1 MKCLVIGN----------------NGQIAQSLSSMC-VQDVEIIRVGRPD------------IDLLKPKDFASFFLSF--   49 (290)
Q Consensus         1 MkiLVtG~----------------~G~iG~~l~~~l-~~~~~v~~~~r~~------------~D~~~~~~~~~~l~~~--   49 (290)
T Consensus         1 ~kvLITaG~T~E~ID~VR~IsN~SSGk~G~aiA~~~~~~Ga~Vtli~g~~~~~p~~~~~~~~i~v~ta~em~~~~~~~~~   80 (228)
T PRK06732          1 MKILITSGGTTEPIDAVRGITNHSTGQLGKIIAETFLQAGHEVTLVTTKTAVKPEPHPNLSIIEIENVDDLLATLKPLVP   80 (228)
T ss_pred             CEEEEECCCCCCCCCCCCEECCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCEEEEEECCHHHHHHHHHHHCC
T ss_conf             98999578876676884476767814999999999997899899995677568898898589994589999999997478


Q ss_pred             CCCEEEECCCCCCC
Q ss_conf             99899978634454
Q gi|254780921|r   50 SPDVIINPAAYTAV   63 (290)
Q Consensus        50 ~pd~Vih~Aa~~~~   63 (290)
T Consensus        81 ~~D~~I~aAAVsDy   94 (228)
T PRK06732         81 HHDVLIHSMAVSDY   94 (228)
T ss_pred             CCCEEEEEEEECCC
T ss_conf             99999993181015