HHsearch alignment for GI: 254780921 and conserved domain: PRK06940

>PRK06940 short chain dehydrogenase; Provisional.
Probab=98.69  E-value=2.2e-08  Score=66.44  Aligned_cols=136  Identities=13%  Similarity=0.160  Sum_probs=80.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEECHHH---------------------CCCCCHHHHHHHHHH----CCCCEEEE
Q ss_conf             49999788978899999996498599961367---------------------087899999999975----59989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPD---------------------IDLLKPKDFASFFLS----FSPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~----~~pd~Vih   56 (290)
T Consensus         6 kV~v~tGa~GIG~aiA~~la~Ga~vvi~~~~~~~l~~~~~~l~~~g~~~~~~~~Dvs~~~~v~~l~~~~~~~G~idiLVn   85 (277)
T PRK06940          6 EVVVVIGAGGMGQAIARRVGSGKTVLLADYNEENLQAVARTLREAGFDVITQQVDVSSRESVKALAQTAATLGAVTGLVH   85 (277)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             29999781699999999998199899998988999999999872288299998257998999999999998699879998


Q ss_pred             CCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCC---CCCCCCCCCCCCCCC---C--C--------C-----CCCCCC-C
Q ss_conf             863445432233221024201222110001122---333333445532111---3--5--------7-----554421-1
Q gi|254780921|r   57 PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAAD---SIGIPCIYISTDYVF---D--G--------L-----SRTPID-E  114 (290)
Q Consensus        57 ~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~---~~~~~~I~iSS~~Vy---~--g--------~-----~~~p~~-E  114 (290)
T Consensus        86 nAG~~~~---~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~  162 (277)
T PRK06940         86 TAGVSPS---QASPEAILKVDLYGTALVLEEFGKVIAPGGAGVVIASMSGHRLPALTAEQEQALATTPTEELLSLPFLQP  162 (277)
T ss_pred             CCCCCCC---CCCHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCC
T ss_conf             8867866---5789999988668899999999999984982899860444311144566654540267652664100023


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             11222211101245666653101222
Q gi|254780921|r  115 FSPTNPLNIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       115 ~d~~~P~~~Yg~sK~~~E~~v~~~~~  140 (290)
T Consensus       163 ~~~~~~~~aY~~sK~a~~~ltk~lA~  188 (277)
T PRK06940        163 DSIEDPLHAYQFAKRANVLRVRAAAV  188 (277)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             33563239999999999999999999