HHsearch alignment for GI: 254780921 and conserved domain: PRK06997

>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional.
Probab=98.82  E-value=1.1e-08  Score=68.20  Aligned_cols=128  Identities=21%  Similarity=0.223  Sum_probs=85.1

Q ss_pred             EEEEEC--CCCHHHHHHHHHH-HCCCEEEEECHH--------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             499997--8897889999999-649859996136--------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIG--NNGQIAQSLSSMC-VQDVEIIRVGRP--------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG--~~G~iG~~l~~~l-~~~~~v~~~~r~--------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
T Consensus         8 ~~lVTG~a~~~GIG~aiA~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~g~~~~~~~Dv~~~~~v~~~v~~~~~~~g~iD~   87 (260)
T PRK06997          8 RILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSDLVFPCDVADDAQIDALFASLGTRWDGLDG   87 (260)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89998998872899999999998599999980880669999999986298479983799999999999999998499898


Q ss_pred             EEECCCCCCCCC---------CCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             997863445432---------2332210242012221100011223---3333344553211135755442111122221
Q gi|254780921|r   54 IINPAAYTAVDK---------AEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPL  121 (290)
Q Consensus        54 Vih~Aa~~~~~~---------~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~  121 (290)
T Consensus        88 LVnNAG~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~k~~~~~~~~~g~iv~iss~~~~---~~~p--------~~  156 (260)
T PRK06997         88 LVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKAALPMLSDDASLLTLSYLGAE---RVVP--------NY  156 (260)
T ss_pred             EEECCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECE---ECCC--------CC
T ss_conf             964477677322353346655899999999988899999999998763167763230122010---0368--------74


Q ss_pred             CCCHHHHHHHHHHHCCCCC
Q ss_conf             1101245666653101222
Q gi|254780921|r  122 NIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       122 ~~Yg~sK~~~E~~v~~~~~  140 (290)
T Consensus       157 ~~y~asKaal~~ltr~lA~  175 (260)
T PRK06997        157 NTMGLAKASLEASVRYLAV  175 (260)
T ss_pred             CHHHHHHHHHHHHHHHHHH
T ss_conf             2237788999999999999