HHsearch alignment for GI: 254780921 and conserved domain: PRK07024

>PRK07024 short chain dehydrogenase; Provisional.
Probab=99.35  E-value=2.2e-12  Score=88.98  Aligned_cols=171  Identities=18%  Similarity=0.155  Sum_probs=106.7

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------------CCCCCHHHHHHHHHH-----CCCCEEEE
Q ss_conf             4999978897889999999-6498599961367-------------------087899999999975-----59989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------------IDLLKPKDFASFFLS-----FSPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------------~D~~~~~~~~~~l~~-----~~pd~Vih   56 (290)
T Consensus         4 ~VlITGassGIG~a~A~~la~~G~~v~l~~R~~~~L~~~~~~~~~~~~~~~~~Dv~d~~~~~~~~~~~~~~~g~iDilin   83 (256)
T PRK07024          4 KVFITGASSGIGQALAREYARQGATLGLVARRTDALQAFAARLPKARVSVYAADVRDADALAAAAADFIAAHGCPDVVIA   83 (256)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             89998460299999999999889989999898899999999767997699981179999999999999998399879998


Q ss_pred             CCCCCCCCCC-C-CC---CCEEEEECCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             8634454322-3-32---2102420122211000112----2333-3334455321113575544211112222111012
Q gi|254780921|r   57 PAAYTAVDKA-E-DE---PEIAFSINAEGAGAIAKAA----DSIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        57 ~Aa~~~~~~~-e-~~---~~~~~~~Nv~~~~~l~~~~----~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
T Consensus        84 NAGi~~~~~~~~~~d~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~Iv~isS~ag~---~g~p~--------~~~Y~A  152 (256)
T PRK07024         84 NAGISVGTLTGEGEDLAVFREVMDTNYYGMVATFEPFIAPMRAARRGTLVGIASVAGV---RGLPG--------AGAYSA  152 (256)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHC---CCCCC--------CCHHHH
T ss_conf             8855678864453789999999999999999999987687502689349984354541---68999--------707999


Q ss_pred             HHHHHHHHHCCCCCC---CCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCC--CCHHHHHHHHHHHHHH
Q ss_conf             456666531012223---22355542000368632000201124665215304554544--5223689999999984
Q gi|254780921|r  127 SKLAGEEKVASYTNN---YVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP--TSALQIARAIIQIAHN  198 (290)
Q Consensus       127 sK~~~E~~v~~~~~~---~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p--~~v~D~a~~i~~~~~~  198 (290)
T Consensus       153 SKaal~~~~esL~~el~~~g-I~V~~i-~---PG~v~T~m~---~~~~-------~~~p~~~~pe~vA~~i~~ai~~  214 (256)
T PRK07024        153 SKAAAIKYLESLRVELRPAG-VRVVTI-A---PGYIRTPMT---AHNP-------YPMPFLMDADRFAARAARAIAR  214 (256)
T ss_pred             HHHHHHHHHHHHHHHHCCCC-EEEEEE-E---ECCCCCCCC---CCCC-------CCCCCCCCHHHHHHHHHHHHHC
T ss_conf             99999999999999865779-489999-7---189958877---7799-------9998768999999999999975