HHsearch alignment for GI: 254780921 and conserved domain: PRK07097

>PRK07097 gluconate 5-dehydrogenase; Provisional.
Probab=99.21  E-value=1.8e-11  Score=83.73  Aligned_cols=129  Identities=13%  Similarity=0.124  Sum_probs=96.0

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
T Consensus        12 ~alVTG~s~GIG~aiA~~la~~Ga~Vii~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~g~iDiL   91 (265)
T PRK07097         12 IALITGASYGIGFAIAKAYAEAGATIVFNDIKQELVDKGLAAYRELGIEAHGYVCDVTDEDGIQAMVAQIEKEVGVIDIL   91 (265)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             89995857689999999999869999999599899999999999549917999932899999999999999982999899


Q ss_pred             EECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             978634454----32233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
T Consensus        92 VnNAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IVnisS~~~~~~---~~--------~~~~Y~  160 (265)
T PRK07097         92 VNNAGIIRRIPMLEMSAEDFRQVIDIDLNAPFIVSKAVLPSMIKKGHGKIINICSMMSELG---RE--------TVSAYA  160 (265)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCCC---CC--------CCHHHH
T ss_conf             9899899998826599999999999860728999999999899808975999905211567---88--------866899


Q ss_pred             HHHHHHHHHHCCCCCC
Q ss_conf             2456666531012223
Q gi|254780921|r  126 KSKLAGEEKVASYTNN  141 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~~  141 (290)
T Consensus       161 asKaav~~ltr~lA~e  176 (265)
T PRK07097        161 AAKGGLKMLTKNIASE  176 (265)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999