HHsearch alignment for GI: 254780921 and conserved domain: PRK07454

>PRK07454 short chain dehydrogenase; Provisional.
Probab=99.45  E-value=2.5e-13  Score=94.27  Aligned_cols=177  Identities=19%  Similarity=0.165  Sum_probs=113.5

Q ss_pred             CE-EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCC
Q ss_conf             94-999978897889999999-6498599961367---------------------0878999999999755-----998
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPD   52 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd   52 (290)
T Consensus         6 mKvalITGas~GIG~a~A~~la~~G~~V~l~~R~~~~l~~~~~e~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~G~iD   85 (241)
T PRK07454          6 MPTALITGASRGIGKATALAFAKAGWDLALVARSQDALEALAEELRSTGVKVAAYSIDLSNPEAIAPGIAELLEQFGCPS   85 (241)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCC
T ss_conf             98899917587899999999998799899998999999999999996599289999518999999999999999759988


Q ss_pred             EEEECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             999786344543----2233221024201222110001122----333-3334455321113575544211112222111
Q gi|254780921|r   53 VIINPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        53 ~Vih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
T Consensus        86 iLVnNAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IinisS~a---g~~~~~~--------~~~  154 (241)
T PRK07454         86 VLINNAGAAYTGPLLEMPLSDWQWVIQLNLTSVFQCCSAVLPGMRARGGGLIINVSSHA---ARNAFPQ--------WGA  154 (241)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHH---HCCCCCC--------CHH
T ss_conf             99988988999992669999999999998699999999999999973998999983565---4477899--------757


Q ss_pred             CHHHHHHHHHHHCCCCCC---CCCCCCCCCEECCCCCCCCE-EECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             012456666531012223---22355542000368632000-2011246652153045545445223689999999984
Q gi|254780921|r  124 YGKSKLAGEEKVASYTNN---YVILRTAWVYSIFGSNFLLS-MLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~~~---~~IlR~~~vyG~~~~~~v~~-~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
T Consensus       155 Y~aSK~al~~lt~~la~E~~~~g-IrVn~V~-PG---~v~T~m~~----~~~~~~~~~-~~~~l~PedVA~~v~flas~  223 (241)
T PRK07454        155 YCVSKAALAAFTKCLAEEERSHG-IRVCTLT-LG---AVNTPLWD----SETVQADFD-RSAMLSPEQVAQTILYLAQL  223 (241)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCC-CEEEEEE-EC---CCCCCCCC----CCCCCCCCC-CCCCCCHHHHHHHHHHHHCC
T ss_conf             99999999999999999838459-3899997-38---89889888----633335545-56899999999999999769