HHsearch alignment for GI: 254780921 and conserved domain: PRK07523

>PRK07523 gluconate 5-dehydrogenase; Provisional.
Probab=99.25  E-value=9.7e-12  Score=85.29  Aligned_cols=128  Identities=19%  Similarity=0.184  Sum_probs=94.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEEEC
Q ss_conf             4999978897889999999-6498599961367------------------0878999999999755-----99899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vih~   57 (290)
T Consensus        11 ~alVTG~s~GIG~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~~l~~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDiLVNN   90 (251)
T PRK07523         11 RALITGSSQGIGYALAKGLAQAGAEVILNGRDAAKLAAAAESLKGSAHTLAFDVTDHDAVRAAIDAFEAEIGPIDILVNN   90 (251)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             89995836699999999999879999999699899999999818872799995799999999999999975998699989


Q ss_pred             CCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             6344543----2233221024201222110001122----333-333445532111357554421111222211101245
Q gi|254780921|r   58 AAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        58 Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
T Consensus        91 AG~~~~~~~~~~~~e~~~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IInisS~~~~---~~~~--------~~~~Y~asK  159 (251)
T PRK07523         91 AGMQHRTPLEDFPADAFERLLQTNISSVFYVGQAVARHMIARGAGKIINIASVQSA---LARP--------GIAPYTATK  159 (251)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHC---CCCC--------CCHHHHHHH
T ss_conf             88799999055999999999999739999999999899886399679999415760---7689--------947899999


Q ss_pred             HHHHHHHCCCCC
Q ss_conf             666653101222
Q gi|254780921|r  129 LAGEEKVASYTN  140 (290)
Q Consensus       129 ~~~E~~v~~~~~  140 (290)
T Consensus       160 aav~~lTr~lA~  171 (251)
T PRK07523        160 GAVGNLTKGMAT  171 (251)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999