HHsearch alignment for GI: 254780921 and conserved domain: PRK07984

>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional.
Probab=98.75  E-value=1.4e-08  Score=67.50  Aligned_cols=128  Identities=22%  Similarity=0.236  Sum_probs=81.6

Q ss_pred             EEEEECCCC--HHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             499997889--7889999999-6498599961367--------------------0878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNG--QIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G--~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~~-----~pd~   53 (290)
T Consensus         8 ~alVTGaa~~~GiG~aiA~~la~~GA~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~g~iD~   87 (262)
T PRK07984          8 RILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDAMFAELGKVWPKFDG   87 (262)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             79998999972599999999998799999982777899999999975498289988899999999999999998387788


Q ss_pred             EEECCCCCCCCCCCC---------CCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             997863445432233---------2210242012221100011223---3333344553211135755442111122221
Q gi|254780921|r   54 IINPAAYTAVDKAED---------EPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPL  121 (290)
Q Consensus        54 Vih~Aa~~~~~~~e~---------~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~  121 (290)
T Consensus        88 lVnnag~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iv~iss~~~~---~~~p--------~~  156 (262)
T PRK07984         88 FVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAE---RAIP--------NY  156 (262)
T ss_pred             EEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHC---CCCC--------CC
T ss_conf             999502276322463178886099999999887899999999888751479759999504432---6678--------72


Q ss_pred             CCCHHHHHHHHHHHCCCCC
Q ss_conf             1101245666653101222
Q gi|254780921|r  122 NIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       122 ~~Yg~sK~~~E~~v~~~~~  140 (290)
T Consensus       157 ~~y~~sKaal~~ltr~lA~  175 (262)
T PRK07984        157 NVMGLAKASLEANVRYMAN  175 (262)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             0888888899999999999