HHsearch alignment for GI: 254780921 and conserved domain: PRK08063

>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional.
Probab=99.26  E-value=1.1e-11  Score=85.05  Aligned_cols=179  Identities=18%  Similarity=0.141  Sum_probs=111.0

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEE-CHH---------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             4999978897889999999-649859996-136---------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRV-GRP---------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~-~r~---------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
T Consensus         6 valVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~G~iDi   85 (250)
T PRK08063          6 VALVTGSSRGIGKAIALRLAKEGYDIAINYARSRKAAEETANEIEQLGRKALVVKANVGDVEKIKEMFSQIDEHFGRLDV   85 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             89995876699999999999889989997599989999999999954995899984799999999999999998099889


Q ss_pred             EEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9978634454----32233221024201222110001122----333-33344553211135755442111122221110
Q gi|254780921|r   54 IINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        54 Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
T Consensus        86 LVnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IVnisS~~~~---~~~--~------~~~~Y  154 (250)
T PRK08063         86 FVNNAASGVLRPAMELEESHWDWTMNINAKALLFCAQEAAKLMEKNGGGKIISLSSLGSI---RYL--E------NYTTV  154 (250)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEHHHC---CCC--C------CCCHH
T ss_conf             998785678899266999999999987403799999999999986389861588733105---678--9------96045


Q ss_pred             HHHHHHHHHHHCCCCCCC---CC----CCCCCCEECCCCCCC--CEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHH
Q ss_conf             124566665310122232---23----555420003686320--002011246652153045545445223689999999
Q gi|254780921|r  125 GKSKLAGEEKVASYTNNY---VI----LRTAWVYSIFGSNFL--LSMLRLAKERREISVVCDQFGTPTSALQIARAIIQI  195 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~~~---~I----lR~~~vyG~~~~~~v--~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~  195 (290)
T Consensus       155 ~asKaal~~ltk~lA~ela~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~P~-------~R~g~pedia~~v~fL  227 (250)
T PRK08063        155 GVSKAALEALTRYLAVELAPKGIAVNAVSGGAVDTDALKHFPNREELLEDAQANTPA-------GRMVEPEDLVNAVLFL  227 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCHHHHCCCCCHHHHHHHHHCCCC-------CCCCCHHHHHHHHHHH
T ss_conf             878999999999999997253928999860879876776179849999999867999-------9986999999999999


Q ss_pred             HHH
Q ss_conf             984
Q gi|254780921|r  196 AHN  198 (290)
Q Consensus       196 ~~~  198 (290)
T Consensus       228 ~S~  230 (250)
T PRK08063        228 CSP  230 (250)
T ss_pred             HCC
T ss_conf             374