HHsearch alignment for GI: 254780921 and conserved domain: PRK08159

>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional.
Probab=99.08  E-value=3e-10  Score=76.93  Aligned_cols=129  Identities=19%  Similarity=0.280  Sum_probs=90.0

Q ss_pred             EEEEECCCC--HHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             499997889--7889999999-6498599961367--------------------0878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNG--QIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G--~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~~-----~pd~   53 (290)
T Consensus        12 ~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~~~~~~~~l~~~~g~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDi   91 (272)
T PRK08159         12 RGLILGVANNRSIAWGIAKACRAAGAELAFTYQGDALKKRVEPLAAELGAFVVGHCDVTDEASIDAVFETLEKKWGKLDF   91 (272)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             99998899986899999999998699999974866899999999986498189983789999999999999998699788


Q ss_pred             EEECCCCCCC--------CCCCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9978634454--------322332210242012221100011223---33333445532111357554421111222211
Q gi|254780921|r   54 IINPAAYTAV--------DKAEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN  122 (290)
Q Consensus        54 Vih~Aa~~~~--------~~~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~  122 (290)
T Consensus        92 LVnnag~~~~~~~~~~~~d~~~~~~~~~~~vn~~~~~~~~~~~~~~m~~ggsIv~iss~~---~~~~~p--------~~~  160 (272)
T PRK08159         92 VVHAIGFSDKDELTGRYVDTSEDNFSMTMLISVYSLTAVAQRAEKLMTDGGSILTLTYYG---AEKVMP--------HYN  160 (272)
T ss_pred             EEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEC---CCCCCC--------CCC
T ss_conf             985354466644566543288999999998886899999988765404787034787541---233477--------520


Q ss_pred             CCHHHHHHHHHHHCCCCCC
Q ss_conf             1012456666531012223
Q gi|254780921|r  123 IYGKSKLAGEEKVASYTNN  141 (290)
Q Consensus       123 ~Yg~sK~~~E~~v~~~~~~  141 (290)
T Consensus       161 ~y~~sKaAl~~ltr~lA~e  179 (272)
T PRK08159        161 VMGVAKAALEASVRYLAVD  179 (272)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             2567899999999999997