HHsearch alignment for GI: 254780921 and conserved domain: PRK08217

>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.
Probab=99.35  E-value=2.2e-12  Score=88.87  Aligned_cols=177  Identities=12%  Similarity=0.116  Sum_probs=106.9

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
T Consensus         7 ~~lITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~iD~l   86 (253)
T PRK08217          7 VIVITGGAQGLGRAMAEYLAQKGAKLALIDLNQEKLEEAVAQCAALGGEAEVYAANVTDEEDVEATFAQIAEDFGQLNGL   86 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89994887789999999999879989999799999999999999659948999824799999999999999983998599


Q ss_pred             EECCCCCCCC----C---------CCCCCCEEEEECCCCCCCCCCCC----CC--CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9786344543----2---------23322102420122211000112----23--3333344553211135755442111
Q gi|254780921|r   55 INPAAYTAVD----K---------AEDEPEIAFSINAEGAGAIAKAA----DS--IGIPCIYISTDYVFDGLSRTPIDEF  115 (290)
Q Consensus        55 ih~Aa~~~~~----~---------~e~~~~~~~~~Nv~~~~~l~~~~----~~--~~~~~I~iSS~~Vy~g~~~~p~~E~  115 (290)
T Consensus        87 VnNAGi~~~~~~~~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~~g~Ii~isS~~~~-~---~~----  158 (253)
T PRK08217         87 INNAGILRDGLLVKAKDGKVTSKMSLEQFQSVIDVNLTGVFLCGREAAAKMIESGSKGVIINISSIARA-G---NM----  158 (253)
T ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHCC-C---CC----
T ss_conf             985743677664446666520119999999999998178999999999999984897279996331113-8---88----


Q ss_pred             CCCCCCCCCHHHHHHHHHHHCCCCCC---CC----CCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHH
Q ss_conf             12222111012456666531012223---22----355542000368632000201124665215304554544522368
Q gi|254780921|r  116 SPTNPLNIYGKSKLAGEEKVASYTNN---YV----ILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQI  188 (290)
Q Consensus       116 d~~~P~~~Yg~sK~~~E~~v~~~~~~---~~----IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~  188 (290)
T Consensus       159 ----~~~~Y~asKaal~~ltk~lA~el~~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~pl-------~R~g~p~dv  227 (253)
T PRK08217        159 ----GQTNYSASKAGVAAMTVTWAKELARYGIRVAAIAPGVIETEMTAAMKPEALERLEKMIPV-------GRLGEPEEI  227 (253)
T ss_pred             ----CCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCC-------CCCCCHHHH
T ss_conf             ----861689999999999999999953219599999738898733111799999999857999-------998499999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999998
Q gi|254780921|r  189 ARAIIQIAH  197 (290)
Q Consensus       189 a~~i~~~~~  197 (290)
T Consensus       228 a~~v~fL~s  236 (253)
T PRK08217        228 AHTVRFIIE  236 (253)
T ss_pred             HHHHHHHHH
T ss_conf             999999995