HHsearch alignment for GI: 254780921 and conserved domain: PRK08277

>PRK08277 D-mannonate oxidoreductase; Provisional.
Probab=99.23  E-value=1.4e-11  Score=84.44  Aligned_cols=128  Identities=19%  Similarity=0.180  Sum_probs=91.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
T Consensus        12 valVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~~~~~~~~~G~iDiL   91 (278)
T PRK08277         12 VAVITGGGGVLGGAMAKELARAGAKVAILDRNQEKAEAVVEEIKANGGEAIALKADVLDKESLEQARQQILKDFGRCDIL   91 (278)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995867489999999999879989999798899999999998459909999824899999999999999984998889


Q ss_pred             EECCCCCCC-------------------CCCCCCCCEEEEECCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCC
Q ss_conf             978634454-------------------3223322102420122211000112----233-3333445532111357554
Q gi|254780921|r   55 INPAAYTAV-------------------DKAEDEPEIAFSINAEGAGAIAKAA----DSI-GIPCIYISTDYVFDGLSRT  110 (290)
Q Consensus        55 ih~Aa~~~~-------------------~~~e~~~~~~~~~Nv~~~~~l~~~~----~~~-~~~~I~iSS~~Vy~g~~~~  110 (290)
T Consensus        92 VNnAG~~~p~~~~~~~~~~~~~~~~~~~d~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IInisS~~~~~~---~  168 (278)
T PRK08277         92 INGAGGNHPGATTDNEFHELPPETKTFFDLDEDGFEFVFDLNLLGTLLPTQVFAKDMIEQKGGNIINISSMNAFTP---L  168 (278)
T ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---C
T ss_conf             9889876766632332122454557631199999999999975999999999999998769965999813664778---8


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             421111222211101245666653101222
Q gi|254780921|r  111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       111 p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~  140 (290)
T Consensus       169 --~------~~~~Y~asKaav~~lTk~lA~  190 (278)
T PRK08277        169 --T------KVPAYSAAKAAISNFTQWLAV  190 (278)
T ss_pred             --C------CCHHHHHHHHHHHHHHHHHHH
T ss_conf             --9------865579999999999999999