HHsearch alignment for GI: 254780921 and conserved domain: PRK08303

>PRK08303 short chain dehydrogenase; Provisional.
Probab=98.63  E-value=3.9e-08  Score=64.98  Aligned_cols=129  Identities=12%  Similarity=0.108  Sum_probs=80.8

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH-------------------------------HCCCCCHHHHHHHHHHC-
Q ss_conf             999978897889999999-649859996136-------------------------------70878999999999755-
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-------------------------------DIDLLKPKDFASFFLSF-   49 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-------------------------------~~D~~~~~~~~~~l~~~-   49 (290)
T Consensus        11 AlVTGasrGIGraiA~~LA~~GA~V~i~~r~~~~~~~~~~~~e~l~e~a~~i~~~Gg~~~~v~~Dvsd~~~v~~~v~~~~   90 (305)
T PRK08303         11 ALVAGATRGAGRGIAVELGAAGATVYVTGRSTRARRSEYDRPETIEETAELVTAAGGRGIAVQVDHLVPEQVRALVERID   90 (305)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             99908875899999999998799899982761100000120679999999999759908999756899999999999999


Q ss_pred             ----CCCEEEECCCCCCC---------CCCCCCCCEEEEECCCCCCCCCCC----CCCCC-CCCCCCCCCC-CCCCCCCC
Q ss_conf             ----99899978634454---------322332210242012221100011----22333-3334455321-11357554
Q gi|254780921|r   50 ----SPDVIINPAAYTAV---------DKAEDEPEIAFSINAEGAGAIAKA----ADSIG-IPCIYISTDY-VFDGLSRT  110 (290)
Q Consensus        50 ----~pd~Vih~Aa~~~~---------~~~e~~~~~~~~~Nv~~~~~l~~~----~~~~~-~~~I~iSS~~-Vy~g~~~~  110 (290)
T Consensus        91 ~~~G~lDILVNNa~~~~~~~~~~~~~~~~~~e~~~~~~~vn~~~~~~~~~~a~p~m~~~~~G~IVnisS~~~~~~~---~  167 (305)
T PRK08303         91 REQGRLDILVNDIWGGEKLFEWGKPVWEHSLDKGLRMLRLAVDTHLITSHHALPLLIRRPGGLVVEVTDGTAEYNA---T  167 (305)
T ss_pred             HHCCCCCEEEECCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCC---C
T ss_conf             9529620898558666543446802766179999999999989999999999999987799589998855552277---8


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             421111222211101245666653101222
Q gi|254780921|r  111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       111 p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~  140 (290)
T Consensus       168 ~~~------~~~~Y~asKaAv~~ltr~lA~  191 (305)
T PRK08303        168 HYR------LSVFYDLAKTAVLRLAFSLAH  191 (305)
T ss_pred             CCC------CCHHHHHHHHHHHHHHHHHHH
T ss_conf             877------519899999999999999999