HHsearch alignment for GI: 254780921 and conserved domain: PRK08589

>PRK08589 short chain dehydrogenase; Validated.
Probab=99.13  E-value=7.7e-11  Score=80.22  Aligned_cols=127  Identities=16%  Similarity=0.096  Sum_probs=92.2

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHHC-----CCCEEEE
Q ss_conf             999978897889999999-6498599961367--------------------0878999999999755-----9989997
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLSF-----SPDVIIN   56 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~~-----~pd~Vih   56 (290)
T Consensus         9 alVTGas~GIG~aiA~~la~~Ga~Vv~~d~~~~~~~~~~~i~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G~iDiLVN   88 (272)
T PRK08589          9 AVITGASTGIGQASAIALAQEGAYVLAVDIAEAVSETVDKIKSNGGKAKAYHVDISDEQQVKDFASDIKEQFGHIDVLFN   88 (272)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             99978256999999999998699999983827899999999955994899996079999999999999998299878998


Q ss_pred             CCCCCCCC-----CCCCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             86344543-----2233221024201222110001122----33333344553211135755442111122221110124
Q gi|254780921|r   57 PAAYTAVD-----KAEDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKS  127 (290)
Q Consensus        57 ~Aa~~~~~-----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~s  127 (290)
T Consensus        89 NAGi~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~p~m~~~gG~IVnisS~~g~---~~~~--------~~~~Y~as  157 (272)
T PRK08589         89 NAGVDNAAGRIHEYPVDVFDKIMAVDMRGTFLMTKMLLPLMMEQGGSIINTSSFSGQ---AADL--------YRSGYNAA  157 (272)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHC---CCCC--------CCHHHHHH
T ss_conf             986678888710099999999999982999999999999999759907999123436---7789--------86689999


Q ss_pred             HHHHHHHHCCCCC
Q ss_conf             5666653101222
Q gi|254780921|r  128 KLAGEEKVASYTN  140 (290)
Q Consensus       128 K~~~E~~v~~~~~  140 (290)
T Consensus       158 Kaal~~lTr~lA~  170 (272)
T PRK08589        158 KGAVINFTKSIAI  170 (272)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999999