HHsearch alignment for GI: 254780921 and conserved domain: PRK09072

>PRK09072 short chain dehydrogenase; Provisional.
Probab=99.40  E-value=9.2e-13  Score=91.07  Aligned_cols=179  Identities=15%  Similarity=0.187  Sum_probs=109.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------------CCCCCHHHHHHHHHH----CCCCEEEEC
Q ss_conf             4999978897889999999-6498599961367-------------------087899999999975----599899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------------IDLLKPKDFASFFLS----FSPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------------~D~~~~~~~~~~l~~----~~pd~Vih~   57 (290)
T Consensus         7 ~vlITGassGIG~a~A~~la~~G~~vil~~R~~~~L~~~~~~l~~~~~~~~~~Dls~~~~~~~~~~~~~~~g~iDiLInN   86 (262)
T PRK09072          7 RVLLTGASGGIGEALAEALCAAGARLLLVGRNAEKLEALAARPYPGRVRWVVADLTSEAGREAVLARAREMGGINVLINN   86 (262)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             89994862399999999999879989999898999999999845897699997179999999999999984999899989


Q ss_pred             CCCCCCCCC----CCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             634454322----33221024201222110001122----333-333445532111357554421111222211101245
Q gi|254780921|r   58 AAYTAVDKA----EDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        58 Aa~~~~~~~----e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
T Consensus        87 AG~~~~~~~~~~~~~~~~~~~~vN~~g~~~lt~~~lp~m~~~~~G~IvnisS~a---g~~~~p~--------~~~Y~ASK  155 (262)
T PRK09072         87 AGVNHFALLDQQDPEAIDRLLALNLTAPMQLTRALLPLLRAQPSAAVVNVGSTF---GSIGYPG--------YASYCASK  155 (262)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHH---HHCCCCC--------CHHHHHHH
T ss_conf             977889863549999999999995689999999999999876994899966866---6257899--------81799999


Q ss_pred             HHHHHHHCCCCCCC--CCCCCCCCE-ECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             66665310122232--235554200-036863200020112466521530455454452236899999999844
Q gi|254780921|r  129 LAGEEKVASYTNNY--VILRTAWVY-SIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNL  199 (290)
Q Consensus       129 ~~~E~~v~~~~~~~--~IlR~~~vy-G~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~  199 (290)
T Consensus       156 aal~~~s~sL~~El~~~gI~V~~v~Pg~v~T~~~~~~~~~~--~~~~---~~~~---~~pe~vA~~i~~~i~~~  221 (262)
T PRK09072        156 FALRGFSEALRRELADTGVRVLYLAPRATRTAMNSAAVTAL--NAAL---GNAM---DSPEDVAAAVLQAIEQE  221 (262)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHH--HHHH---CCCC---CCHHHHHHHHHHHHHCC
T ss_conf             99999999999984622908999972899988885023454--5541---6678---99999999999999469