HHsearch alignment for GI: 254780921 and conserved domain: PRK10754

>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional.
Probab=95.46  E-value=0.041  Score=31.13  Aligned_cols=30  Identities=10%  Similarity=0.090  Sum_probs=18.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CCEEEEECH
Q ss_conf             499997889788999999964-985999613
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGR   31 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r   31 (290)
T Consensus       143 ~vLi~gaaGgVG~~avQlAk~~Ga~Vi~t~~  173 (327)
T PRK10754        143 QFLFHAAAGGVGLIACQWAKALGAKLIGTVG  173 (327)
T ss_pred             EEEEECCCCCCCHHHHHHHHHCCCEEEEEEC
T ss_conf             9999817761126899999986999999989