HHsearch alignment for GI: 254780921 and conserved domain: PRK11880

>PRK11880 pyrroline-5-carboxylate reductase; Reviewed.
Probab=90.33  E-value=0.62  Score=24.48  Aligned_cols=31  Identities=23%  Similarity=0.248  Sum_probs=25.0

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HC---CCEEEEECHH
Q ss_conf             94999978897889999999-64---9859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQ---DVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~---~~~v~~~~r~   32 (290)
T Consensus         3 ~kI~~IG~-G~Mg~Aii~gl~~~~~~~~~i~v~~r~   37 (267)
T PRK11880          3 KKIGFIGG-GNMASAIIGGLLASGVPAKDIIVSDPS   37 (267)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             87999866-899999999999779894528997799