HHsearch alignment for GI: 254780921 and conserved domain: PRK12826

>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed.
Probab=99.40  E-value=6.1e-13  Score=92.07  Aligned_cols=129  Identities=16%  Similarity=0.175  Sum_probs=95.1

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             999978897889999999-6498599961367---------------------0878999999999755-----998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
T Consensus         9 alITGgs~GIG~aia~~la~~G~~V~~~~r~~~~~~~~~~~l~~~g~~~~~~~~Dl~~~~~~~~~~~~~~~~~g~iD~lv   88 (253)
T PRK12826          9 ALVTGAARGIGRAIAVRFAADGADVIVVDICGQAAAATAELVAAAGGKARAYQVDVRDRAALKALVAAGVERFGRLDILV   88 (253)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99948977899999999998799899998988999999999985099589999517999999999999999839987899


Q ss_pred             ECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             786344543----2233221024201222110001122----333-3334455321113575544211112222111012
Q gi|254780921|r   56 NPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        56 h~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
T Consensus        89 nnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~---g~-~~~~~------~~~~Y~a  158 (253)
T PRK12826         89 ANAGIFPLTPFAELDDEDWDRVIDVNLTGTFLLTQAALPALKRAGGGRIVLTSSVA---GP-RVGYP------GLAHYAA  158 (253)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHH---HH-CCCCC------CCHHHHH
T ss_conf             89988999981559999999999987566643378746999976997699995256---41-56899------7388999


Q ss_pred             HHHHHHHHHCCCCCC
Q ss_conf             456666531012223
Q gi|254780921|r  127 SKLAGEEKVASYTNN  141 (290)
Q Consensus       127 sK~~~E~~v~~~~~~  141 (290)
T Consensus       159 sKaal~~ltk~lA~e  173 (253)
T PRK12826        159 SKAGVVGFTRALALE  173 (253)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999998