HHsearch alignment for GI: 254780921 and conserved domain: PRK12935

>PRK12935 acetoacetyl-CoA reductase; Provisional.
Probab=99.17  E-value=4.9e-11  Score=81.33  Aligned_cols=127  Identities=15%  Similarity=0.073  Sum_probs=91.0

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEE-CHH---------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             999978897889999999-649859996-136---------------------70878999999999755-----99899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRV-GRP---------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~-~r~---------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
T Consensus         9 alVTG~s~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~~~~~v~~~~~~~G~iDiL   88 (247)
T PRK12935          9 AIVTGGAKGIGKAITVALAQEGAKVVINYNSSKEAAENLVNELGKEGHDVYAVQADVSKVEDANRLVEEAVNHFGKVDIL   88 (247)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99917276899999999998799899976999899999999998439958999857999999999999999983999899


Q ss_pred             EECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             9786344543----2233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
T Consensus        89 VNNAGi~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IVnisS~~g~---~g~~--------~~~~Y~  157 (247)
T PRK12935         89 VNNAGITRDRTFKKLNREDWERVIDVNLSSVFNTTSAVLPYITEAEEGRIISISSIIGQ---AGGF--------GQTNYS  157 (247)
T ss_pred             EECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC---CCCC--------CCHHHH
T ss_conf             98998899999044999999999999769999999997687422799528995554645---6899--------858999


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
T Consensus       158 asKaal~~ltk~lA~  172 (247)
T PRK12935        158 AAKAGMLGFTKSLAL  172 (247)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999