HHsearch alignment for GI: 254780921 and conserved domain: PRK13193

>PRK13193 pyrrolidone-carboxylate peptidase; Provisional.
Probab=95.34  E-value=0.024  Score=32.41  Aligned_cols=58  Identities=12%  Similarity=0.106  Sum_probs=38.2

Q ss_pred             CEEEEECCCCHHHH------HHHHHHH----CCCEEEEECHHHCCCC-CHHHHHHHHHHCCCCEEEECCC
Q ss_conf             94999978897889------9999996----4985999613670878-9999999997559989997863
Q gi|254780921|r    1 MKCLVIGNNGQIAQ------SLSSMCV----QDVEIIRVGRPDIDLL-KPKDFASFFLSFSPDVIINPAA   59 (290)
Q Consensus         1 MkiLVtG~~G~iG~------~l~~~l~----~~~~v~~~~r~~~D~~-~~~~~~~~l~~~~pd~Vih~Aa   59 (290)
T Consensus         1 m~ILvTGFePF~g~~~NPS~~~v~~L~~~~~~~~~v~~~~LP-v~~~~~~~~l~~~i~~~~Pd~vi~lG~   69 (201)
T PRK13193          1 MTVLLFGFEPFLEYKENPSQLIVEALNGSTILKEEVKGVILP-VEYDKIEDMIVTKIREYKPILTLGIGL   69 (201)
T ss_pred             CEEEEEEECCCCCCCCCHHHHHHHHCCCCCCCCCEEEEEEEC-CCHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             989997356899898786699998555566588458999968-708889999999998519968998056