HHsearch alignment for GI: 254780921 and conserved domain: PRK13194

>PRK13194 pyrrolidone-carboxylate peptidase; Provisional.
Probab=95.60  E-value=0.019  Score=32.98  Aligned_cols=57  Identities=19%  Similarity=0.195  Sum_probs=37.0

Q ss_pred             CEEEEECCCCHHH------HHHHHHHHC----CCEEEEECHHHCCCC-CHHHHHHHHHHCCCCEEEECC
Q ss_conf             9499997889788------999999964----985999613670878-999999999755998999786
Q gi|254780921|r    1 MKCLVIGNNGQIA------QSLSSMCVQ----DVEIIRVGRPDIDLL-KPKDFASFFLSFSPDVIINPA   58 (290)
Q Consensus         1 MkiLVtG~~G~iG------~~l~~~l~~----~~~v~~~~r~~~D~~-~~~~~~~~l~~~~pd~Vih~A   58 (290)
T Consensus         1 mrVLvTGFePF~g~~~NPS~~~v~~L~~~~~~~~~v~~~~LP-V~~~~~~~~l~~~i~~~~Pd~vi~lG   68 (204)
T PRK13194          1 MKVLVTGFEPFGGDDKNPTMRIVKDLDGIKIGDAQVFGRVLP-VSFKRAREVLEKTLDEIKPDITINLG   68 (204)
T ss_pred             CEEEEEEECCCCCCCCCHHHHHHHHCCCCCCCCCEEEEEEEC-CCHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             989996007989799787899999633577789679999817-86899999999999851998999824