HHsearch alignment for GI: 254780921 and conserved domain: PRK13197

>PRK13197 pyrrolidone-carboxylate peptidase; Provisional.
Probab=94.86  E-value=0.042  Score=31.05  Aligned_cols=57  Identities=19%  Similarity=0.128  Sum_probs=37.1

Q ss_pred             CEEEEECCCCHHH------HHHHHHHHC----CCEEEEECHHHCCCC-CHHHHHHHHHHCCCCEEEECC
Q ss_conf             9499997889788------999999964----985999613670878-999999999755998999786
Q gi|254780921|r    1 MKCLVIGNNGQIA------QSLSSMCVQ----DVEIIRVGRPDIDLL-KPKDFASFFLSFSPDVIINPA   58 (290)
Q Consensus         1 MkiLVtG~~G~iG------~~l~~~l~~----~~~v~~~~r~~~D~~-~~~~~~~~l~~~~pd~Vih~A   58 (290)
T Consensus         2 ~rVLvTGF~PF~g~~~NPS~~~v~~L~~~~~~~~~i~~~~LP-V~~~~~~~~l~~~l~~~~Pd~Vl~lG   69 (215)
T PRK13197          2 MKILVTGFDPFGGESINPSWEAVKQLPGKTIGGAEIVKRQLP-TVFGKSLDVLKEAIEEVQPDAVIAIG   69 (215)
T ss_pred             CEEEEEECCCCCCCCCCHHHHHHHHCCCCCCCCEEEEEEEEC-CCHHHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             879997327899898786999998546577698289999939-76888899999999987998899924