HHsearch alignment for GI: 254780921 and conserved domain: PTZ00117

>PTZ00117 malate dehydrogenase; Provisional.
Probab=95.97  E-value=0.1  Score=28.87  Aligned_cols=222  Identities=15%  Similarity=0.056  Sum_probs=99.8

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHC--CCEEEEECHHH-------CCCCCHHHHH------------HHHHHCCCCEEEECC
Q ss_conf             94-99997889788999999964--98599961367-------0878999999------------999755998999786
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPD-------IDLLKPKDFA------------SFFLSFSPDVIINPA   58 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l~~--~~~v~~~~r~~-------~D~~~~~~~~------------~~l~~~~pd~Vih~A   58 (290)
T Consensus         1 M~KV~IIG-aG~VG~~~A~~l~~~~~~eivLiDi~~~~a~g~a~Dl~h~~~~~~~~~~i~~~~dy~~~~d--aDiVVitA   77 (313)
T PTZ00117          1 MKKISIIG-SGQIGAIVGLLLLQENLGDVYLYDVIEGVPQGKALDLKHFSTIIGVNANILGTNNYEDIKD--SDVIVITA   77 (313)
T ss_pred             CCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEECCCHHHHCC--CCEEEECC
T ss_conf             97899989-7989999999997089987999958898308899887724203689857983799999689--99999898


Q ss_pred             CCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC--CCCCCC-----CCCCCCCCCCCCCCCCCCC---CCCCCHHHH
Q ss_conf             344543223322102420122211000112233333--344553-----2111357554421111222---211101245
Q gi|254780921|r   59 AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIP--CIYIST-----DYVFDGLSRTPIDEFSPTN---PLNIYGKSK  128 (290)
Q Consensus        59 a~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~--~I~iSS-----~~Vy~g~~~~p~~E~d~~~---P~~~Yg~sK  128 (290)
T Consensus        78 G~~rk~--g~tR~dLl~~N~~I~~~i~~~i~~~~p~aiiivvtNPvDimt~v~~k~sg~p--~~rViG~gt~LD-saR~r  152 (313)
T PTZ00117         78 GVQRKE--GMTREDLIGVNGKIMKSVAESVKKHCPNAFVICVSNPLDIMVNVFKKKSGLP--HEKICGMAGILD-TSRFR  152 (313)
T ss_pred             CCCCCC--CCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHCCC--HHHEEECCCEEE-HHHHH
T ss_conf             998997--9988999987677788888776235898089978994899999999862898--677670044020-88999


Q ss_pred             H-HHHHHHCCCCCCCCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             6-666531012223223555420003686320002011246652153045545445223689999999984420244334
Q gi|254780921|r  129 L-AGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSL  207 (290)
Q Consensus       129 ~-~~E~~v~~~~~~~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~  207 (290)
T Consensus       153 ~~la~~l-~-v~~~~--V-~~~ViGeHGds~vp~wS~~~v~G~pl~~~~~~--~~~~~~~~~e----i~~~~~~~----g  217 (313)
T PTZ00117        153 CLLARKL-K-VKPSD--V-SAVVLGGHGDLMVPLTRYVSIGGIPLSEFVKK--NKISHSEINE----IIKKTRFM----G  217 (313)
T ss_pred             HHHHHHH-C-CCCCC--E-EEEEEECCCCCEEEEEEECCCCCCCHHHHHHC--CCCCHHHHHH----HHHHHHHC----C
T ss_conf             9999996-8-99221--3-77786056894786452026589618998542--6878899999----99998516----6


Q ss_pred             CCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCH
Q ss_conf             43137623866678899999999999972798000576285
Q gi|254780921|r  208 RGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFT  248 (290)
Q Consensus       208 ~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~  248 (290)
T Consensus       218 ~~ii~~~K--g~-t~~gia~a~~~iv~aIl~d~~~vlpvs~  255 (313)
T PTZ00117        218 GEIIKLAK--TS-AAFAPAAAIVKMIKSYLKNEKSLLTCAV  255 (313)
T ss_pred             CEEEEECC--CC-CCCHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             23888227--74-2404899999999999769995899898