HHsearch alignment for GI: 254780921 and conserved domain: TIGR02415

>TIGR02415 23BDH acetoin reductases; InterPro: IPR014007 One member of this family, as characterised in Klebsiella terrigena , is able to interconvert acetoin + NADH with meso-2,3-butanediol + NAD(+). It is also capable of irreversible reduction of diacetyl with NADH to acetoin. There has been a reuctance to classify the enzyme as either 1.1.1.4 from EC, which is (R,R)-butanediol dehydrogenase, or 1.1.1.5 from EC, which is acetoin dehydrogenase without a specified stereochemistry . Another member of this family, from Corynebacterium glutamicum (Brevibacterium flavum), is called L-2,3-butanediol dehydrogenase . This enzyme is a homotetramer in the family of short chain dehydrogenases (IPR002198 from INTERPRO). .
Probab=98.64  E-value=5e-08  Score=64.42  Aligned_cols=130  Identities=20%  Similarity=0.231  Sum_probs=94.3

Q ss_pred             EEEECCCCHHHHHHHHHHH-CCCEEEEECHH--H---------------------CCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             9999788978899999996-49859996136--7---------------------0878999999999755-----9989
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMCV-QDVEIIRVGRP--D---------------------IDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~--~---------------------~D~~~~~~~~~~l~~~-----~pd~   53 (290)
T Consensus         3 AlvTGgAqGIG~gIa~RLa~DGF~vav~D~n~Qe~~A~~t~~~i~~~G~~Ava~~~DV~~k~~~~~~i~~A~~~fG~fdV   82 (258)
T TIGR02415         3 ALVTGGAQGIGKGIAERLAKDGFNVAVADLNNQEETAKETAKEINQKGGKAVAYKLDVSDKSQVFEAIDQAVEKFGGFDV   82 (258)
T ss_pred             EEEECCCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             67856854323899999983461378725666368999999999866973799864734567899999999997089327


Q ss_pred             EEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC------CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9978634454----32233221024201222110001122------333-333445532111357554421111222211
Q gi|254780921|r   54 IINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD------SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLN  122 (290)
Q Consensus        54 Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~------~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~  122 (290)
T Consensus        83 ~VNNAGva~~~pi~~iteE~l~k~y~vNV~GvlfGIQAA~~~Fkk~~~~tGkIINAaSiA---g~------~G~p--~ls  151 (258)
T TIGR02415        83 MVNNAGVAPVTPILEITEEELEKLYNVNVKGVLFGIQAAARQFKKQGHGTGKIINAASIA---GV------EGNP--VLS  151 (258)
T ss_pred             EEECCCCCCCCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHH---HH------HCCH--HHH
T ss_conf             865241000277454670034234301014566788999987787168987115776575---54------0441--467


Q ss_pred             CCHHHHHHHHHH----HCCCCCCCC
Q ss_conf             101245666653----101222322
Q gi|254780921|r  123 IYGKSKLAGEEK----VASYTNNYV  143 (290)
Q Consensus       123 ~Yg~sK~~~E~~----v~~~~~~~~  143 (290)
T Consensus       152 ~YsstKFAVRgLTQtAA~eLA~~GI  176 (258)
T TIGR02415       152 AYSSTKFAVRGLTQTAAQELAPKGI  176 (258)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             7776788887657999999752487