HHsearch alignment for GI: 254780921 and conserved domain: TIGR03466

>TIGR03466 HpnA hopanoid-associated sugar epimerase. The sequences in this family are members of the pfam01370 superfamily of NAD-dependent epimerases and dehydratases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene.
Probab=100.00  E-value=0  Score=293.20  Aligned_cols=271  Identities=16%  Similarity=0.152  Sum_probs=197.0

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------CCCCCHHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             94999978897889999999-6498599961367---------------0878999999999755998999786344543
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------IDLLKPKDFASFFLSFSPDVIINPAAYTAVD   64 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~   64 (290)
T Consensus         1 MriLVTGgtGfiG~~l~~~L~~~G~~V~~l~r~~~~~~~~~~~~~~~~~gDl~d~~~~~~~~~~~--d~ViH~Aa~~~~-   77 (328)
T TIGR03466         1 MKVLVTGATGFVGSAVVRLLLERGEEVRVLVRPTSDRRNLEGLDVEIVEGDLRDPASLRKALAGC--RALFHVAADYRL-   77 (328)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHCCCCCEEEEEECCCHHHHHHHHHCC--CEEEEECCCCCC-
T ss_conf             94999867779999999999978498999989998655652179779982079999999997178--589761342344-


Q ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCC-CCCCCCCCCCCC---CCCHHHHHHHHHHHCCCC
Q ss_conf             22332210242012221100011223333-3344553211135755-442111122221---110124566665310122
Q gi|254780921|r   65 KAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSR-TPIDEFSPTNPL---NIYGKSKLAGEEKVASYT  139 (290)
Q Consensus        65 ~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~-~p~~E~d~~~P~---~~Yg~sK~~~E~~v~~~~  139 (290)
T Consensus        78 -~~~~~~~~~~~Nv~gt~nll~aa~~~~v~r~V~~SS~~v~g~~~~~~~~~E~~p~~~~~~~~~Y~~sK~~aE~~~~~~~  156 (328)
T TIGR03466        78 -WAPDPEEMYRANVEGTRNLLRAALEAGVERVVYTSSVATLGVPGDGTPADETTPSSLEKMIGHYKRSKFLAEEAALRMI  156 (328)
T ss_pred             -CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             -6799899999999999999999997298743156335785578888740256765456665778899999999999999


Q ss_pred             C----CCCCCCCCCCEECCCCCCC--CEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEE
Q ss_conf             2----3223555420003686320--002011246652153045545445223689999999984420244334431376
Q gi|254780921|r  140 N----NYVILRTAWVYSIFGSNFL--LSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHM  213 (290)
Q Consensus       140 ~----~~~IlR~~~vyG~~~~~~v--~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~  213 (290)
T Consensus       157 ~~~gl~~~ilRp~~v~Gp~d~~~~~~~~~i~~~~~~~-~p~~~~~g~~~v~V~Dva~a~~~a~~~~~~------g~~y~~  229 (328)
T TIGR03466       157 AEKGLPVVIVNPSTPIGPRDIKPTPTGRIIVDFLRGK-MPAYVDTGLNLVHVDDVAEGHLLALERGRI------GERYIL  229 (328)
T ss_pred             HHCCCCEEEECCCCEECCCCCCCCCHHHHHHHHHCCC-CCEEECCCCEEEEEHHHHHHHHHHHHCCCC------CCEEEE
T ss_conf             9729975997778568899888876699999997599-976755871899838999999999757998------987997


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHH---------H-HCCCC-CCCC-----------CCCCCHHHHHHH
Q ss_conf             238666788999999999999727980005762858---------8-08768-9975-----------110086899996
Q gi|254780921|r  214 TADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTK---------Q-YPTKA-HRPA-----------YSCLDCSKLANT  271 (290)
Q Consensus       214 ~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~---------~-~~~~a-~RP~-----------~~~Ld~~K~~~~  271 (290)
T Consensus       230 ~~--~~~t~~e~~~~i~~~~g----~~~~~~~~p~~~~~~~~~~~e~~~~~~~~~p~~~~~~~~~~~~~~~~d~~kA~~~  303 (328)
T TIGR03466       230 GG--ENLTLAQILAKLAEITG----RKAPRVKLPRWLLLPVAWGAEALARLTGKEPRVTLDGVRMAKKKMYFSSDKAVRE  303 (328)
T ss_pred             CC--CCCCHHHHHHHHHHHHC----CCCCCEECCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCCCCHHHHHHH
T ss_conf             99--97109999999999858----9987110573788888999999887419998764677764156631177999998


Q ss_pred             HCCCCCCHHHHHHHHHH
Q ss_conf             17899998999999997
Q gi|254780921|r  272 HNIRISTWKEGVRNILV  288 (290)
Q Consensus       272 lg~~~~~~~e~i~~~i~  288 (290)
T Consensus       304 LG~~p~~~eegl~~tv~  320 (328)
T TIGR03466       304 LGYRQRPAREALRDAVE  320 (328)
T ss_pred             HCCCCCCHHHHHHHHHH
T ss_conf             29997889999999999