HHsearch alignment for GI: 254780921 and conserved domain: cd01492

>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1. Aos1 is part of the heterodimeric activating enzyme (E1), specific for the SUMO family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. The E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by SUMO family of ubiquitin-like proteins (Ublps) is involved in cell division, nuclear transport, the stress response and signal transduction. Aos1 contains part of the adenylation domain.
Probab=94.41  E-value=0.085  Score=29.35  Aligned_cols=100  Identities=13%  Similarity=0.170  Sum_probs=52.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHH-CCC-EEEEECHHH--------------CCC--CCHHHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             949999788978899999996-498-599961367--------------087--89999999997559989997863445
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV-QDV-EIIRVGRPD--------------IDL--LKPKDFASFFLSFSPDVIINPAAYTA   62 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~-~~~-~v~~~~r~~--------------~D~--~~~~~~~~~l~~~~pd~Vih~Aa~~~   62 (290)
T Consensus        22 s~VlvvG~-GGLG~~v~~~La~aGvg~i~ivD~d~v~~snL~RQ~l~~~~diG~~Ka~~a~~~l~~lNp~v~i~~~~~~-   99 (197)
T cd01492          22 ARILLIGL-KGLGAEIAKNLVLSGIGSLTILDDRTVTEEDLGAQFLIPAEDLGQNRAEASLERLRALNPRVKVSVDTDD-   99 (197)
T ss_pred             CCEEEECC-CHHHHHHHHHHHHHCCCEEEEEECCCCCHHHCCCCEECCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECC-
T ss_conf             95999887-8899999999998379869999899187777397860323347888599999999973899728987045-


Q ss_pred             CCCCCCC--CCEEEE------ECCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             4322332--210242------01222110001122333333445532111
Q gi|254780921|r   63 VDKAEDE--PEIAFS------INAEGAGAIAKAADSIGIPCIYISTDYVF  104 (290)
Q Consensus        63 ~~~~e~~--~~~~~~------~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy  104 (290)
T Consensus       100 --~~~~~~~~i~~~D~Vvd~~dn~~~r~~iN~~c~~~~iplI~g~~~g~~  147 (197)
T cd01492         100 --ISEKPEEFFSQFDVVVATELSRAELVKINELCRKLGVKFYATGVHGLF  147 (197)
T ss_pred             --CCHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCE
T ss_conf             --857689998289999999999999999999999819978999813755