Query         gi|254780921|ref|YP_003065334.1| dTDP-4-dehydrorhamnose reductase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 290
No_of_seqs    122 out of 14661
Neff          8.3 
Searched_HMMs 39220
Date          Mon May 30 01:16:01 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780921.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR01214 rmlD dTDP-4-dehydror 100.0       0       0  547.6  16.6  288    2-290     1-317 (317)
  2 PRK09987 dTDP-4-dehydrorhamnos 100.0       0       0  506.7  17.6  287    1-290     1-293 (299)
  3 COG1091 RfbD dTDP-4-dehydrorha 100.0       0       0  488.6  15.4  280    1-290     1-280 (281)
  4 pfam04321 RmlD_sub_bind RmlD s 100.0       0       0  457.0  17.8  282    3-290     1-283 (284)
  5 TIGR01181 dTDP_gluc_dehyt dTDP 100.0       0       0  357.3  14.9  278    2-288     1-328 (340)
  6 TIGR01179 galE UDP-glucose 4-e 100.0       0       0  352.0  13.1  268    2-285     1-329 (341)
  7 PRK10675 UDP-galactose-4-epime 100.0       0       0  328.9  15.5  275    1-288     1-327 (338)
  8 PRK10084 dTDP-glucose 4,6 dehy 100.0       0       0  322.0  16.6  277    1-288     1-332 (352)
  9 PRK10217 dTDP-glucose 4,6-dehy 100.0       0       0  321.8  16.1  280    1-288     1-329 (355)
 10 PRK11908 NAD-dependent epimera 100.0       0       0  322.1  12.8  283    1-288     1-333 (347)
 11 COG1087 GalE UDP-glucose 4-epi 100.0       0       0  307.3  15.4  269    1-285     1-316 (329)
 12 COG1088 RfbB dTDP-D-glucose 4, 100.0       0       0  306.8  14.0  274    1-288     1-314 (340)
 13 PRK11150 rfaD ADP-L-glycero-D- 100.0       0       0  294.8  14.5  270    3-288     2-304 (308)
 14 TIGR03466 HpnA hopanoid-associ 100.0       0       0  293.2  13.0  271    1-288     1-320 (328)
 15 TIGR02197 heptose_epim ADP-L-g 100.0       0       0  282.9  12.4  277    3-290     1-350 (353)
 16 KOG0747 consensus              100.0 2.8E-45       0  274.1   8.7  274    2-289     8-321 (331)
 17 pfam02719 Polysacc_synt_2 Poly 100.0 5.6E-45       0  272.3   9.2  205    3-229     1-239 (280)
 18 TIGR02622 CDP_4_6_dhtase CDP-g 100.0 8.1E-44       0  265.9  13.6  275    2-288     6-336 (361)
 19 pfam01370 Epimerase NAD depend 100.0 1.4E-44       0  270.3   8.2  205    3-213     1-235 (235)
 20 pfam01073 3Beta_HSD 3-beta hyd 100.0 1.2E-43       0  265.0   9.9  227    4-233     1-268 (280)
 21 COG0451 WcaG Nucleoside-diphos 100.0 3.6E-40 9.8E-45  245.3  14.6  275    1-289     1-307 (314)
 22 KOG1429 consensus              100.0 7.8E-39   2E-43  237.8  11.4  269    1-289    28-329 (350)
 23 KOG1371 consensus              100.0 1.5E-37 3.7E-42  230.6  15.2  272    1-288     3-330 (343)
 24 TIGR03589 PseB UDP-N-acetylglu 100.0 2.2E-38 5.5E-43  235.3   7.9  204    2-230     6-241 (324)
 25 KOG1430 consensus              100.0 5.2E-36 1.3E-40  221.9  12.6  280    2-288     6-343 (361)
 26 PRK08125 bifunctional UDP-gluc 100.0 2.4E-34 6.2E-39  212.5  15.9  282    2-288   317-647 (660)
 27 COG1086 Predicted nucleoside-d 100.0 2.6E-33 6.7E-38  206.7  10.3  211    2-234   252-496 (588)
 28 KOG1502 consensus              100.0 3.9E-30 9.9E-35  188.9  12.7  268    1-290     7-320 (327)
 29 CHL00194 ycf39 Ycf39; Provisio 100.0 5.1E-29 1.3E-33  182.5  14.3  255    1-289     1-298 (319)
 30 KOG1431 consensus              100.0 2.5E-28 6.3E-33  178.7  13.6  272    1-288     2-304 (315)
 31 COG1089 Gmd GDP-D-mannose dehy 100.0 1.2E-27   3E-32  174.9  14.3  276    1-289     2-337 (345)
 32 PRK07201 short chain dehydroge 100.0 5.6E-28 1.4E-32  176.7  11.3  221    1-237     1-268 (663)
 33 TIGR01472 gmd GDP-mannose 4,6-  99.9 7.8E-27   2E-31  170.2  13.9  276    3-289     3-360 (365)
 34 pfam07993 NAD_binding_4 Male s  99.9 8.2E-28 2.1E-32  175.8   4.4  182    5-192     1-245 (245)
 35 TIGR01777 yfcH conserved hypot  99.9 3.4E-26 8.6E-31  166.7   8.2  262    3-283     1-307 (307)
 36 TIGR03443 alpha_am_amid L-amin  99.9 4.3E-25 1.1E-29  160.5  11.3  223    2-239   973-1265(1389)
 37 COG1090 Predicted nucleoside-d  99.9 1.9E-23 4.9E-28  151.2   9.4  270    3-289     1-296 (297)
 38 TIGR01746 Thioester-redct thio  99.9 5.2E-23 1.3E-27  148.7   8.2  224    2-229     1-304 (405)
 39 KOG1372 consensus               99.9 9.8E-22 2.5E-26  141.5  11.0  278    3-288    31-364 (376)
 40 pfam05368 NmrA NmrA-like famil  99.9 1.8E-21 4.5E-26  140.1  11.2  199    3-230     1-221 (232)
 41 KOG2865 consensus               99.8 3.7E-21 9.4E-26  138.3   9.1  207    3-235    64-295 (391)
 42 COG3320 Putative dehydrogenase  99.8 3.8E-21 9.8E-26  138.2   5.7  150    1-155     1-202 (382)
 43 KOG1221 consensus               99.8 2.6E-18 6.5E-23  122.3  12.9  223    2-229    14-327 (467)
 44 PRK12320 hypothetical protein;  99.7 3.2E-16 8.2E-21  110.5  11.8  230    1-286     1-245 (699)
 45 PRK05865 hypothetical protein;  99.7 8.7E-16 2.2E-20  108.1  10.8  233    1-286     1-252 (854)
 46 PRK07578 short chain dehydroge  99.6 6.4E-16 1.6E-20  108.8   8.4  175    1-197     1-188 (199)
 47 TIGR03649 ergot_EASG ergot alk  99.6 6.6E-15 1.7E-19  103.1  11.4  240    3-286     2-281 (285)
 48 PRK08219 short chain dehydroge  99.6 2.1E-15 5.3E-20  105.9   7.0  180    1-198     3-210 (226)
 49 KOG2774 consensus               99.6 7.6E-15 1.9E-19  102.8   9.7  267    2-287    46-347 (366)
 50 COG0702 Predicted nucleoside-d  99.6 4.6E-14 1.2E-18   98.4  11.2  202    1-232     1-217 (275)
 51 PRK05653 fabG 3-ketoacyl-(acyl  99.5 1.2E-14 3.1E-19  101.6   6.8  179    2-198     7-228 (246)
 52 PRK12825 fabG 3-ketoacyl-(acyl  99.5 1.5E-14 3.9E-19  101.1   6.5  179    2-198     9-231 (250)
 53 PRK08267 short chain dehydroge  99.5 4.2E-14 1.1E-18   98.6   8.3  128    1-139     1-164 (258)
 54 PRK10538 3-hydroxy acid dehydr  99.5   7E-14 1.8E-18   97.4   8.3  129    1-140     1-163 (248)
 55 PRK06180 short chain dehydroge  99.5 6.4E-14 1.6E-18   97.6   6.8  128    1-139     4-165 (277)
 56 PRK05693 short chain dehydroge  99.5   5E-14 1.3E-18   98.2   5.4  127    1-138     1-157 (274)
 57 PRK06953 short chain dehydroge  99.5 2.1E-13 5.3E-18   94.7   8.6  178    1-203     1-208 (222)
 58 PRK05650 short chain dehydroge  99.5 1.4E-13 3.7E-18   95.6   7.5  183    2-198     2-225 (270)
 59 PRK09009 C factor cell-cell si  99.5 2.9E-13 7.4E-18   93.9   8.6  175    1-198     1-216 (235)
 60 PRK07454 short chain dehydroge  99.5 2.5E-13 6.3E-18   94.3   7.5  177    1-198     6-223 (241)
 61 PRK05557 fabG 3-ketoacyl-(acyl  99.4 2.2E-13 5.5E-18   94.6   6.7  179    2-198     7-229 (248)
 62 PRK05872 short chain dehydroge  99.4 4.8E-13 1.2E-17   92.7   8.1  183    2-200    11-234 (296)
 63 PRK05565 fabG 3-ketoacyl-(acyl  99.4 2.5E-13 6.3E-18   94.3   6.4  179    2-198     7-229 (247)
 64 PRK08017 short chain dehydroge  99.4 1.5E-12 3.8E-17   89.9  10.2  129    1-140     1-162 (256)
 65 PRK05993 short chain dehydroge  99.4 3.6E-13 9.1E-18   93.4   6.2  125    3-138     7-162 (277)
 66 PRK07832 short chain dehydroge  99.4   1E-12 2.6E-17   90.9   8.5  126    2-138     2-165 (272)
 67 PRK06482 short chain dehydroge  99.4 3.8E-13 9.6E-18   93.2   6.2  126    3-139     5-163 (276)
 68 PRK12824 acetoacetyl-CoA reduc  99.4   4E-13   1E-17   93.1   6.3  179    1-197     1-225 (245)
 69 PRK07102 short chain dehydroge  99.4 6.6E-13 1.7E-17   91.9   7.1  128    1-139     1-163 (243)
 70 PRK06101 short chain dehydroge  99.4 9.4E-13 2.4E-17   91.0   7.9  128    1-139     1-156 (241)
 71 PRK05599 hypothetical protein;  99.4 9.3E-13 2.4E-17   91.0   7.8  169    1-198     1-213 (246)
 72 PRK09072 short chain dehydroge  99.4 9.2E-13 2.3E-17   91.1   7.6  179    2-199     7-221 (262)
 73 PRK12826 3-ketoacyl-(acyl-carr  99.4 6.1E-13 1.6E-17   92.1   6.4  129    3-141     9-173 (253)
 74 PRK06182 short chain dehydroge  99.4 4.4E-13 1.1E-17   92.9   5.6  126    3-139     6-161 (273)
 75 PRK06181 short chain dehydroge  99.4 2.5E-12 6.3E-17   88.6   9.1  183    2-198     3-225 (263)
 76 PRK07825 short chain dehydroge  99.4   2E-12 5.1E-17   89.2   7.6  175    2-199     7-216 (273)
 77 PRK07231 fabG 3-ketoacyl-(acyl  99.4   9E-13 2.3E-17   91.1   5.7  129    2-141     8-171 (250)
 78 PRK08340 glucose-1-dehydrogena  99.4 1.3E-12 3.2E-17   90.3   6.3  129    1-140     1-167 (259)
 79 PRK08217 fabG 3-ketoacyl-(acyl  99.4 2.2E-12 5.7E-17   88.9   7.1  177    2-197     7-236 (253)
 80 TIGR01829 AcAcCoA_reduct aceto  99.3 1.4E-12 3.6E-17   90.0   6.0  104    3-110     3-145 (244)
 81 PRK09186 flagellin modificatio  99.3 1.9E-12 4.8E-17   89.3   6.5  185    2-198     6-237 (255)
 82 PRK12827 short chain dehydroge  99.3 1.4E-12 3.7E-17   89.9   5.9  128    2-140     8-176 (251)
 83 PRK07024 short chain dehydroge  99.3 2.2E-12 5.5E-17   89.0   6.7  171    2-198     4-214 (256)
 84 PRK09730 hypothetical protein;  99.3 1.3E-12 3.4E-17   90.1   5.6  180    1-197     1-230 (247)
 85 PRK06179 short chain dehydroge  99.3 1.6E-12 4.1E-17   89.7   5.8  126    3-139     7-160 (270)
 86 PRK08263 short chain dehydroge  99.3 1.9E-12 4.9E-17   89.2   6.2  127    3-140     6-165 (275)
 87 PRK07326 short chain dehydroge  99.3 3.4E-12 8.6E-17   87.9   7.2  175    2-199     7-218 (235)
 88 PRK07666 fabG 3-ketoacyl-(acyl  99.3 3.9E-12   1E-16   87.5   7.5  174    2-199     8-223 (238)
 89 PRK05875 short chain dehydroge  99.3 2.1E-12 5.4E-17   89.0   5.9  128    3-141    10-177 (277)
 90 PRK08213 gluconate 5-dehydroge  99.3 3.4E-12 8.7E-17   87.8   6.9  183    2-198    14-240 (259)
 91 TIGR01830 3oxo_ACP_reduc 3-oxo  99.3 4.7E-12 1.2E-16   87.1   7.4  182    3-213     1-233 (238)
 92 PRK07774 short chain dehydroge  99.3 3.3E-12 8.4E-17   87.9   6.5  176    2-198     8-230 (250)
 93 PRK08220 2,3-dihydroxybenzoate  99.3 2.1E-12 5.4E-17   89.0   5.5  128    2-140    10-165 (253)
 94 PRK06139 short chain dehydroge  99.3 6.8E-12 1.7E-16   86.2   7.7  181    2-200     8-229 (324)
 95 PRK12936 3-ketoacyl-(acyl-carr  99.3 5.5E-12 1.4E-16   86.7   7.1  179    2-198     8-226 (245)
 96 PRK07201 short chain dehydroge  99.3 8.6E-12 2.2E-16   85.6   8.1  174    2-198   378-592 (663)
 97 PRK07707 consensus              99.3   3E-12 7.7E-17   88.1   5.8  179    1-197     1-220 (239)
 98 PRK07109 short chain dehydroge  99.3 9.9E-12 2.5E-16   85.2   8.4  178    3-199    11-231 (338)
 99 PRK07479 consensus              99.3 4.6E-12 1.2E-16   87.1   6.6  129    2-141     7-172 (252)
100 PRK08993 2-deoxy-D-gluconate 3  99.3 3.4E-12 8.7E-17   87.9   5.9  128    2-140    12-174 (253)
101 PRK07856 short chain dehydroge  99.3 3.1E-12 7.9E-17   88.1   5.5  127    2-139    10-164 (254)
102 PRK07776 consensus              99.3 4.6E-12 1.2E-16   87.1   6.4  178    2-198    10-229 (252)
103 PRK05717 oxidoreductase; Valid  99.3 7.4E-12 1.9E-16   86.0   7.4  126    3-139    13-172 (255)
104 pfam08659 KR KR domain. This e  99.3 2.3E-12 5.9E-17   88.8   4.5  129    2-141     2-166 (181)
105 PRK08251 short chain dehydroge  99.3 1.2E-11 3.1E-16   84.8   8.1  128    2-139     4-169 (248)
106 PRK12429 3-hydroxybutyrate deh  99.3   7E-12 1.8E-16   86.1   6.8  128    2-140     6-169 (258)
107 PRK06701 short chain dehydroge  99.3 7.6E-12 1.9E-16   85.9   6.9  128    2-140    47-210 (289)
108 PRK06124 gluconate 5-dehydroge  99.3 7.4E-12 1.9E-16   86.0   6.6  128    2-140    16-179 (259)
109 PRK09242 tropinone reductase;   99.3 7.4E-12 1.9E-16   86.0   6.6  128    2-140    12-177 (258)
110 PRK07890 short chain dehydroge  99.3 6.1E-12 1.6E-16   86.4   6.0  128    2-140     7-170 (258)
111 PRK06171 sorbitol-6-phosphate   99.3   5E-12 1.3E-16   86.9   5.5  128    2-140    11-174 (266)
112 PRK07060 short chain dehydroge  99.3 5.4E-12 1.4E-16   86.7   5.7  129    2-141    11-167 (245)
113 PRK09291 short chain dehydroge  99.3 9.6E-12 2.4E-16   85.3   6.7  127    2-140     4-161 (257)
114 TIGR03206 benzo_BadH 2-hydroxy  99.3   6E-12 1.5E-16   86.5   5.5  129    2-141     5-169 (250)
115 PRK07577 short chain dehydroge  99.3 5.7E-12 1.5E-16   86.6   5.4  128    2-141     5-156 (234)
116 PRK07023 short chain dehydroge  99.3 6.1E-12 1.5E-16   86.4   5.4  130    1-141     2-167 (243)
117 pfam00106 adh_short short chai  99.3 6.4E-12 1.6E-16   86.3   5.5  128    2-140     2-164 (167)
118 PRK08063 enoyl-(acyl carrier p  99.3 1.1E-11 2.7E-16   85.1   6.4  179    2-198     6-230 (250)
119 PRK08324 short chain dehydroge  99.3 1.2E-11 2.9E-16   84.9   6.5  128    3-141   424-587 (676)
120 PRK05866 short chain dehydroge  99.3 9.9E-12 2.5E-16   85.2   6.1  129    2-140    42-208 (290)
121 PRK07067 sorbitol dehydrogenas  99.3 8.5E-12 2.2E-16   85.6   5.6  127    3-140     8-168 (256)
122 PRK07035 short chain dehydroge  99.3 2.3E-11 5.8E-16   83.2   7.7  128    2-140    10-174 (252)
123 PRK06113 7-alpha-hydroxysteroi  99.3 1.4E-11 3.5E-16   84.4   6.6  177    2-198    13-234 (255)
124 PRK06914 short chain dehydroge  99.3 1.2E-11 3.1E-16   84.8   6.1  126    3-139     6-168 (280)
125 PRK06483 short chain dehydroge  99.3   1E-11 2.7E-16   85.1   5.8  127    3-140     5-164 (236)
126 PRK12939 short chain dehydroge  99.3 8.8E-12 2.3E-16   85.5   5.5  129    2-141     9-173 (250)
127 PRK07775 short chain dehydroge  99.2   1E-11 2.6E-16   85.1   5.8  128    2-140    12-175 (275)
128 PRK12384 sorbitol-6-phosphate   99.2 1.1E-11 2.9E-16   84.9   5.9  127    3-140     5-170 (259)
129 PRK07523 gluconate 5-dehydroge  99.2 9.7E-12 2.5E-16   85.3   5.6  128    2-140    11-171 (251)
130 PRK06398 aldose dehydrogenase;  99.2   9E-12 2.3E-16   85.5   5.3  127    2-139     8-160 (256)
131 PRK07806 short chain dehydroge  99.2 2.7E-11 6.8E-16   82.8   7.7  128    2-140     8-169 (248)
132 PRK07041 short chain dehydroge  99.2 1.6E-11 4.2E-16   84.0   6.5  177    2-197     9-222 (240)
133 PRK06194 hypothetical protein;  99.2 3.2E-11 8.1E-16   82.4   7.8  124    3-137     9-174 (301)
134 PRK08643 acetoin reductase; Va  99.2 1.2E-11 3.1E-16   84.7   5.6  127    3-140     5-168 (256)
135 PRK06463 fabG 3-ketoacyl-(acyl  99.2 1.7E-11 4.2E-16   84.0   6.1  129    2-140     9-167 (254)
136 PRK08277 D-mannonate oxidoredu  99.2 1.4E-11 3.5E-16   84.4   5.7  128    2-140    12-190 (278)
137 PRK09135 pteridine reductase;   99.2 2.2E-11 5.5E-16   83.3   6.6  175    3-197     9-229 (249)
138 PRK08264 short chain dehydroge  99.2   2E-11   5E-16   83.6   6.4  127    2-139     7-158 (235)
139 PRK06841 short chain dehydroge  99.2 1.2E-11   3E-16   84.9   5.2  128    2-140    17-177 (255)
140 PRK07069 short chain dehydroge  99.2   1E-11 2.6E-16   85.1   4.9  127    2-139     1-166 (251)
141 PRK12938 acetyacetyl-CoA reduc  99.2 1.9E-11   5E-16   83.6   6.2  127    3-140     6-169 (246)
142 PRK06924 short chain dehydroge  99.2 7.7E-12   2E-16   85.9   4.1  128    1-139     1-169 (251)
143 PRK06196 oxidoreductase; Provi  99.2 3.7E-11 9.5E-16   82.0   7.5  139    2-140    28-197 (316)
144 PRK07831 short chain dehydroge  99.2 5.1E-11 1.3E-15   81.2   8.0  128    2-140    18-185 (261)
145 PRK12937 short chain dehydroge  99.2 2.2E-11 5.6E-16   83.3   6.1  128    3-141     8-170 (245)
146 PRK07097 gluconate 5-dehydroge  99.2 1.8E-11 4.7E-16   83.7   5.5  129    2-141    12-176 (265)
147 PRK06949 short chain dehydroge  99.2 1.3E-11 3.4E-16   84.5   4.7  129    2-141    11-183 (258)
148 PRK05854 short chain dehydroge  99.2 6.1E-11 1.6E-15   80.8   7.9  138    3-140    17-191 (314)
149 PRK12745 3-ketoacyl-(acyl-carr  99.2 2.2E-11 5.6E-16   83.3   5.6  127    3-140     8-179 (259)
150 PRK12828 short chain dehydroge  99.2 1.8E-11 4.6E-16   83.8   5.1  175    2-198     9-220 (239)
151 PRK12481 2-deoxy-D-gluconate 3  99.2 2.4E-11 6.1E-16   83.1   5.7  128    2-140    10-172 (251)
152 PRK06523 short chain dehydroge  99.2 2.6E-11 6.6E-16   82.9   5.6  130    2-141    11-169 (260)
153 PRK06138 short chain dehydroge  99.2 2.5E-11 6.3E-16   83.0   5.3  127    3-140     8-169 (252)
154 PRK06935 2-deoxy-D-gluconate 3  99.2 2.4E-11 6.2E-16   83.1   5.2  128    2-140    17-179 (258)
155 PRK12743 acetoin dehydrogenase  99.2 3.2E-11 8.2E-16   82.4   5.9  130    1-141     1-170 (253)
156 PRK07063 short chain dehydroge  99.2 2.6E-11 6.7E-16   82.9   5.4  128    2-140     9-173 (259)
157 PRK06484 short chain dehydroge  99.2 2.9E-11 7.5E-16   82.6   5.5  128    2-140     7-167 (530)
158 PRK06172 short chain dehydroge  99.2 3.1E-11 7.8E-16   82.5   5.6  127    3-140    10-173 (253)
159 PRK06346 consensus              99.2 3.3E-11 8.4E-16   82.3   5.7  127    3-140     8-171 (251)
160 PRK08265 short chain dehydroge  99.2   3E-11 7.6E-16   82.5   5.3  129    2-141     8-167 (261)
161 PRK08177 short chain dehydroge  99.2 3.2E-11 8.2E-16   82.4   5.3  175    2-201     3-209 (225)
162 PRK08945 short chain dehydroge  99.2 4.7E-11 1.2E-15   81.4   6.1  129    2-141    15-183 (245)
163 PRK09134 short chain dehydroge  99.2 4.2E-11 1.1E-15   81.7   5.9  176    3-197    12-229 (256)
164 PRK07677 short chain dehydroge  99.2 3.6E-11 9.1E-16   82.1   5.5  127    2-139     5-168 (254)
165 PRK07814 short chain dehydroge  99.2 3.1E-11 7.8E-16   82.5   5.1  127    2-139    12-175 (263)
166 COG4221 Short-chain alcohol de  99.2 1.1E-10 2.8E-15   79.4   7.8  182    3-199     9-229 (246)
167 PRK06227 consensus              99.2   4E-11   1E-15   81.8   5.6  128    2-140     7-170 (256)
168 PRK06550 fabG 3-ketoacyl-(acyl  99.2 2.9E-11 7.3E-16   82.7   4.8  127    2-140     7-157 (237)
169 smart00822 PKS_KR This enzymat  99.2 2.6E-11 6.6E-16   82.9   4.6  128    3-141     3-166 (180)
170 PRK12935 acetoacetyl-CoA reduc  99.2 4.9E-11 1.3E-15   81.3   5.9  127    3-140     9-172 (247)
171 PRK06077 fabG 3-ketoacyl-(acyl  99.2 8.8E-11 2.2E-15   79.9   7.0  181    3-197     6-227 (249)
172 PRK06200 2,3-dihydroxy-2,3-dih  99.2   4E-11   1E-15   81.9   5.0  127    2-139     8-171 (263)
173 PRK08085 gluconate 5-dehydroge  99.2 5.7E-11 1.4E-15   81.0   5.6  128    2-140    11-174 (254)
174 PRK12829 short chain dehydroge  99.1 5.7E-11 1.5E-15   81.0   5.5  128    2-140    13-176 (264)
175 PRK13394 3-hydroxybutyrate deh  99.1 6.8E-11 1.7E-15   80.5   5.9  128    2-140     9-173 (262)
176 PRK06125 short chain dehydroge  99.1 9.3E-11 2.4E-15   79.8   6.5  128    2-140     9-169 (259)
177 TIGR03325 BphB_TodD cis-2,3-di  99.1 5.8E-11 1.5E-15   80.9   5.1  125    3-139     8-170 (262)
178 PRK05855 short chain dehydroge  99.1   1E-10 2.6E-15   79.5   6.3  124    3-137   318-478 (582)
179 PRK07576 short chain dehydroge  99.1 7.2E-11 1.8E-15   80.4   5.5  128    2-140    10-172 (260)
180 PRK12823 benD 1,6-dihydroxycyc  99.1 6.4E-11 1.6E-15   80.7   5.2  126    2-140    10-171 (260)
181 PRK06057 short chain dehydroge  99.1 6.8E-11 1.7E-15   80.5   5.3  128    2-140     9-170 (255)
182 PRK12748 3-ketoacyl-(acyl-carr  99.1 8.5E-11 2.2E-15   80.0   5.7  178    3-198     8-238 (257)
183 PRK08642 fabG 3-ketoacyl-(acyl  99.1 4.5E-11 1.1E-15   81.6   4.2  128    2-140     8-176 (254)
184 PRK05867 short chain dehydroge  99.1 8.4E-11 2.1E-15   80.0   5.6  130    2-140    11-177 (253)
185 PRK08589 short chain dehydroge  99.1 7.7E-11   2E-15   80.2   5.3  127    3-140     9-170 (272)
186 PRK08703 short chain dehydroge  99.1 1.8E-10 4.5E-15   78.2   7.1  174    2-197     8-226 (239)
187 PRK06484 short chain dehydroge  99.1 7.5E-11 1.9E-15   80.3   5.2  127    3-140   277-436 (530)
188 KOG1203 consensus               99.1 1.1E-09 2.7E-14   73.8  10.9  204    1-224    80-312 (411)
189 PRK08415 enoyl-(acyl carrier p  99.1 1.6E-10   4E-15   78.5   6.4  129    2-141     7-174 (274)
190 PRK06947 glucose-1-dehydrogena  99.1 7.7E-11   2E-15   80.2   4.6  128    3-140     9-177 (252)
191 PRK06505 enoyl-(acyl carrier p  99.1 1.8E-10 4.5E-15   78.2   6.3  129    2-141     9-176 (271)
192 PRK08628 short chain dehydroge  99.1 1.1E-10 2.9E-15   79.3   5.2  129    2-141     9-170 (258)
193 PRK08339 short chain dehydroge  99.1 1.6E-10 4.1E-15   78.4   5.9  127    3-140    11-173 (263)
194 PRK06198 short chain dehydroge  99.1 1.3E-10 3.2E-15   79.0   5.3  129    2-141     8-174 (268)
195 COG0300 DltE Short-chain dehyd  99.1 1.3E-10 3.4E-15   78.9   5.4  179    2-200     8-228 (265)
196 PRK08261 fabG 3-ketoacyl-(acyl  99.1 1.6E-10 4.1E-15   78.4   5.7  128    3-141   210-370 (447)
197 PRK06500 short chain dehydroge  99.1 1.6E-10 4.2E-15   78.4   5.7  128    2-140     8-166 (249)
198 PRK06197 short chain dehydroge  99.1   3E-10 7.7E-15   76.9   7.1  138    3-140    19-194 (306)
199 PRK07062 short chain dehydroge  99.1   2E-10   5E-15   77.9   6.0  128    2-140    10-175 (265)
200 PRK08159 enoyl-(acyl carrier p  99.1   3E-10 7.6E-15   76.9   6.8  129    2-141    12-179 (272)
201 PRK08936 glucose-1-dehydrogena  99.1 1.4E-10 3.6E-15   78.8   5.1  127    3-140    10-174 (261)
202 PRK07074 short chain dehydroge  99.1 1.4E-10 3.6E-15   78.8   5.1  127    3-141     5-164 (256)
203 PRK08226 short chain dehydroge  99.1 1.6E-10 4.1E-15   78.5   5.4  128    2-140     8-171 (263)
204 PRK06114 short chain dehydroge  99.1 1.6E-10 4.1E-15   78.4   5.4  129    3-140    19-184 (262)
205 PRK06128 oxidoreductase; Provi  99.1   2E-10 5.1E-15   77.9   5.7  128    2-140    57-221 (300)
206 PRK08594 enoyl-(acyl carrier p  99.1 2.6E-10 6.7E-15   77.3   6.3  179    2-198     8-236 (256)
207 PRK08278 short chain dehydroge  99.1   2E-10 5.2E-15   77.9   5.6  178    3-198     9-232 (273)
208 PRK07478 short chain dehydroge  99.1 2.1E-10 5.3E-15   77.8   5.5  128    3-140     9-173 (254)
209 PRK07370 enoyl-(acyl carrier p  99.1 2.9E-10 7.5E-15   77.0   6.2  129    2-141     9-179 (259)
210 PRK05786 fabG 3-ketoacyl-(acyl  99.1 5.4E-10 1.4E-14   75.5   7.4  128    2-140     7-166 (238)
211 PRK07791 short chain dehydroge  99.0 2.5E-10 6.4E-15   77.4   5.1  128    2-140     8-186 (285)
212 PRK07533 enoyl-(acyl carrier p  99.0 4.3E-10 1.1E-14   76.0   6.0  128    2-140     8-174 (254)
213 PRK12744 short chain dehydroge  99.0 2.6E-10 6.7E-15   77.2   4.9  128    2-140    10-175 (257)
214 PRK12746 short chain dehydroge  99.0   4E-10   1E-14   76.2   5.7  129    2-141     8-177 (254)
215 PRK05876 short chain dehydroge  99.0 3.3E-10 8.5E-15   76.6   5.3  126    2-138     8-170 (275)
216 PRK12747 short chain dehydroge  99.0 5.1E-10 1.3E-14   75.6   6.2  179    2-198     6-234 (252)
217 PRK06123 short chain dehydroge  99.0 3.3E-10 8.5E-15   76.6   5.2  128    3-140     6-174 (249)
218 PRK05884 short chain dehydroge  99.0 1.9E-10   5E-15   78.0   3.6  126    1-141     1-157 (223)
219 PRK12859 3-ketoacyl-(acyl-carr  99.0   5E-10 1.3E-14   75.7   5.6  178    3-198     9-239 (257)
220 KOG1205 consensus               99.0 1.3E-09 3.3E-14   73.3   7.4  135    2-147    14-190 (282)
221 PRK06603 enoyl-(acyl carrier p  99.0 1.1E-09 2.7E-14   73.8   6.5  128    2-140    10-176 (260)
222 PRK12742 oxidoreductase; Provi  99.0 6.7E-10 1.7E-14   75.0   5.2  130    2-141     8-163 (237)
223 PRK07985 oxidoreductase; Provi  99.0 9.1E-10 2.3E-14   74.2   5.8  128    2-140    51-215 (294)
224 PRK07453 protochlorophyllide o  99.0 3.9E-09 9.8E-14   70.7   8.4  139    3-141     9-210 (322)
225 PRK07904 short chain dehydroge  98.9 3.1E-09   8E-14   71.2   7.3  172    2-198    10-222 (253)
226 PRK07792 fabG 3-ketoacyl-(acyl  98.9 1.3E-09 3.3E-14   73.3   4.8  178    2-198    11-235 (303)
227 COG3967 DltE Short-chain dehyd  98.9 3.2E-09 8.1E-14   71.2   6.6  124    3-137     8-165 (245)
228 TIGR01963 PHB_DH 3-hydroxybuty  98.9   7E-09 1.8E-13   69.2   7.2  127    1-130     1-167 (258)
229 PRK12428 3-alpha-hydroxysteroi  98.9 6.8E-09 1.7E-13   69.3   7.1   95    2-100     7-117 (261)
230 PRK06079 enoyl-(acyl carrier p  98.9 2.9E-09 7.3E-14   71.4   5.1  128    2-140     9-173 (252)
231 COG2910 Putative NADH-flavin r  98.9   2E-08   5E-13   66.7   9.4  178    1-198     1-199 (211)
232 COG1028 FabG Dehydrogenases wi  98.8 5.1E-09 1.3E-13   70.0   5.5  128    1-139     6-171 (251)
233 PRK08690 enoyl-(acyl carrier p  98.8 8.2E-09 2.1E-13   68.8   6.4  128    2-140     8-176 (261)
234 PRK08416 7-alpha-hydroxysteroi  98.8 3.5E-09 8.9E-14   70.9   4.5  129    2-141    10-182 (260)
235 KOG4288 consensus               98.8 5.6E-10 1.4E-14   75.4   0.3  184    1-197     3-261 (283)
236 PRK06997 enoyl-(acyl carrier p  98.8 1.1E-08 2.7E-13   68.2   6.7  128    2-140     8-175 (260)
237 KOG1208 consensus               98.8 1.8E-08 4.7E-13   66.9   7.9  141    2-142    37-215 (314)
238 PRK07889 enoyl-(acyl carrier p  98.8   1E-08 2.6E-13   68.3   5.6  127    2-140     9-174 (256)
239 TIGR02632 RhaD_aldol-ADH rhamn  98.8 2.3E-08   6E-13   66.3   7.2  126    3-140   427-605 (709)
240 PRK07984 enoyl-(acyl carrier p  98.8 1.4E-08 3.6E-13   67.5   5.4  128    2-140     8-175 (262)
241 KOG4039 consensus               98.8 2.3E-08 5.9E-13   66.3   6.5  139    1-155    19-174 (238)
242 KOG1209 consensus               98.7   3E-08 7.8E-13   65.6   5.9  125    2-137     9-165 (289)
243 PRK06940 short chain dehydroge  98.7 2.2E-08 5.5E-13   66.4   4.8  136    2-140     6-188 (277)
244 PRK08862 short chain dehydroge  98.7 3.8E-08 9.8E-13   65.1   5.4  124    3-140     8-170 (227)
245 TIGR02415 23BDH acetoin reduct  98.6   5E-08 1.3E-12   64.4   5.4  130    3-143     3-176 (258)
246 PRK08303 short chain dehydroge  98.6 3.9E-08   1E-12   65.0   4.6  129    3-140    11-191 (305)
247 KOG0725 consensus               98.6   7E-08 1.8E-12   63.6   5.6  130    2-141    10-181 (270)
248 KOG1200 consensus               98.6   2E-07   5E-12   61.1   6.5  182    3-196    17-236 (256)
249 PRK06720 hypothetical protein;  98.6 1.4E-07 3.7E-12   61.8   5.8  107    3-109    19-160 (169)
250 KOG1610 consensus               98.5 1.6E-07   4E-12   61.6   5.8  122    3-135    32-189 (322)
251 KOG1201 consensus               98.5 2.4E-07 6.2E-12   60.5   5.6  123    2-135    40-197 (300)
252 COG1748 LYS9 Saccharopine dehy  98.5 2.8E-07 7.1E-12   60.2   5.7   57    1-60      2-78  (389)
253 PRK12367 short chain dehydroge  98.4 7.4E-07 1.9E-11   57.8   5.6  182    2-222    19-228 (250)
254 KOG1210 consensus               98.2 1.1E-05 2.7E-10   51.3   9.0   99    2-101    35-173 (331)
255 KOG1611 consensus               98.2 3.4E-06 8.7E-11   54.1   5.8  128    3-138     6-185 (249)
256 KOG1207 consensus               98.1 3.4E-06 8.8E-11   54.1   5.0  124    2-136     9-162 (245)
257 KOG4169 consensus               98.1 3.6E-06 9.1E-11   54.0   4.7  132    2-148     7-174 (261)
258 PRK07424 bifunctional sterol d  98.1 7.8E-06   2E-10   52.1   6.1  162    2-198   182-373 (410)
259 KOG3019 consensus               98.1 1.6E-06   4E-11   56.0   1.8  260    3-288    15-315 (315)
260 pfam03435 Saccharop_dh Sacchar  98.0 1.5E-05 3.9E-10   50.4   6.2   55    3-60      1-77  (384)
261 KOG1014 consensus               98.0 1.8E-05 4.6E-10   50.0   5.6  123    3-136    52-212 (312)
262 PRK06300 enoyl-(acyl carrier p  97.8 5.9E-05 1.5E-09   47.1   5.6  178    3-198    11-269 (298)
263 PRK08309 short chain dehydroge  97.7 0.00016 4.1E-09   44.7   6.9   32    1-32      1-32  (182)
264 TIGR01832 kduD 2-deoxy-D-gluco  97.5 0.00015 3.9E-09   44.8   4.1  130    2-135     7-173 (249)
265 PRK08655 prephenate dehydrogen  97.4 0.00043 1.1E-08   42.3   6.0   59    1-61      1-69  (441)
266 PRK09496 trkA potassium transp  97.4 0.00055 1.4E-08   41.6   6.5   53    1-55      1-70  (455)
267 TIGR01369 CPSaseII_lrg carbamo  97.3 0.00053 1.3E-08   41.8   5.8  144    2-159     8-181 (1089)
268 PRK06732 phosphopantothenate--  97.3  0.0009 2.3E-08   40.5   7.0   63    1-63      1-94  (228)
269 TIGR02114 coaB_strep phosphopa  97.3 0.00046 1.2E-08   42.1   5.1   62    1-62      1-95  (253)
270 pfam08643 DUF1776 Fungal famil  97.2 0.00054 1.4E-08   41.7   4.7  137    3-150     6-200 (296)
271 COG0027 PurT Formate-dependent  97.2 0.00095 2.4E-08   40.3   5.7   54    2-56     14-81  (394)
272 KOG1199 consensus               97.1  0.0011 2.7E-08   40.1   5.5  117    3-130    12-173 (260)
273 PRK00436 argC N-acetyl-gamma-g  97.1  0.0016   4E-08   39.1   6.0   86    1-106     2-106 (345)
274 TIGR02356 adenyl_thiF thiazole  97.1 0.00064 1.6E-08   41.3   4.0   96    2-99     23-147 (210)
275 PRK09288 purT phosphoribosylgl  97.1  0.0028 7.3E-08   37.6   7.1   53    2-55     14-80  (395)
276 pfam02571 CbiJ Precorrin-6x re  97.0  0.0012   3E-08   39.8   5.1   83    1-99      1-98  (246)
277 PRK12767 carbamoyl phosphate s  97.0  0.0027   7E-08   37.7   6.9   55    1-57      2-76  (325)
278 PRK11863 N-acetyl-gamma-glutam  97.0  0.0017 4.2E-08   39.0   5.7   79    2-102     4-84  (314)
279 PRK05086 malate dehydrogenase;  96.9 0.00063 1.6E-08   41.3   2.8   95    1-99      1-118 (312)
280 cd05292 LDH_2 A subgroup of L-  96.9  0.0043 1.1E-07   36.6   6.9   94    1-99      1-116 (308)
281 cd00704 MDH Malate dehydrogena  96.9 0.00074 1.9E-08   40.9   2.7   95    1-99      1-126 (323)
282 pfam01113 DapB_N Dihydrodipico  96.9  0.0017 4.4E-08   38.8   4.6   80    1-100     1-97  (122)
283 cd01078 NAD_bind_H4MPT_DH NADP  96.9  0.0053 1.4E-07   36.1   7.0   31    2-32     30-61  (194)
284 cd01337 MDH_glyoxysomal_mitoch  96.8  0.0015 3.7E-08   39.3   3.5   90    1-94      1-110 (310)
285 COG3268 Uncharacterized conser  96.7  0.0016 4.1E-08   39.1   3.5   55    3-59      9-80  (382)
286 TIGR00036 dapB dihydrodipicoli  96.7  0.0029 7.4E-08   37.6   4.7   58    1-58      2-83  (281)
287 cd01336 MDH_cytoplasmic_cytoso  96.6  0.0011 2.9E-08   39.9   2.3   95    1-99      3-128 (325)
288 KOG2733 consensus               96.6  0.0031   8E-08   37.4   4.6   55    3-59      8-92  (423)
289 KOG1478 consensus               96.6  0.0057 1.5E-07   35.9   5.8  131    1-134     2-207 (341)
290 pfam00056 Ldh_1_N lactate/mala  96.6 0.00094 2.4E-08   40.3   1.6   33    1-33      1-36  (142)
291 cd01338 MDH_choloroplast_like   96.6  0.0012   3E-08   39.8   2.0   95    1-99      3-128 (322)
292 PRK06598 aspartate-semialdehyd  96.6  0.0026 6.6E-08   37.9   3.7   84    2-105     4-101 (348)
293 KOG1198 consensus               96.6   0.013 3.3E-07   33.9   7.3   61    1-61    159-236 (347)
294 PRK05442 malate dehydrogenase;  96.5  0.0051 1.3E-07   36.2   5.0   95    1-99      5-130 (325)
295 cd05294 LDH-like_MDH_nadp A la  96.5   0.003 7.7E-08   37.5   3.6   95    1-99      1-121 (309)
296 PRK05447 1-deoxy-D-xylulose 5-  96.4   0.014 3.6E-07   33.7   6.9   58    1-58      1-96  (379)
297 PRK11199 tyrA bifunctional cho  96.4  0.0076 1.9E-07   35.2   5.5   51    2-59    100-151 (374)
298 PRK13301 putative L-aspartate   96.4  0.0037 9.3E-08   37.0   3.8   61    1-63      3-75  (267)
299 TIGR01758 MDH_euk_cyt malate d  96.4   0.003 7.6E-08   37.5   3.2   46    2-48      1-47  (325)
300 TIGR01759 MalateDH-SF1 malate   96.3  0.0021 5.4E-08   38.4   2.1  211    2-241     5-262 (329)
301 PRK00048 dihydrodipicolinate r  96.3  0.0051 1.3E-07   36.2   4.0   32    1-32      3-37  (265)
302 PRK12815 carB carbamoyl phosph  96.3   0.018 4.7E-07   33.1   6.7  139    2-156     9-179 (1068)
303 PRK08507 prephenate dehydrogen  96.3   0.023 5.8E-07   32.6   7.1   32    1-33      1-35  (275)
304 PRK08057 cobalt-precorrin-6x r  96.2   0.012 2.9E-07   34.2   5.5   82    2-99      3-96  (241)
305 COG0002 ArgC Acetylglutamate s  96.2  0.0092 2.3E-07   34.8   4.7  115    1-134     3-141 (349)
306 PRK13302 putative L-aspartate   96.1   0.022 5.5E-07   32.7   6.4   59    1-62      7-79  (271)
307 COG0569 TrkA K+ transport syst  96.1   0.028 7.2E-07   32.0   7.0   31    1-32      1-32  (225)
308 TIGR01369 CPSaseII_lrg carbamo  96.1  0.0073 1.9E-07   35.3   3.9  133    2-155   575-739 (1089)
309 PRK09620 hypothetical protein;  96.1   0.037 9.4E-07   31.4   7.4   63    1-63      4-100 (229)
310 PRK07417 arogenate dehydrogena  96.1   0.025 6.4E-07   32.3   6.5   55    1-59      2-67  (280)
311 PRK06019 phosphoribosylaminoim  96.0   0.031 7.9E-07   31.8   6.7   52    1-55      8-73  (377)
312 PTZ00117 malate dehydrogenase;  96.0     0.1 2.6E-06   28.9   9.3  222    1-248     1-255 (313)
313 pfam01470 Peptidase_C15 Pyrogl  95.9   0.013 3.4E-07   33.9   4.5   57    1-58      1-68  (203)
314 PRK13304 L-aspartate dehydroge  95.9   0.012   3E-07   34.2   4.0   59    1-62      2-73  (265)
315 TIGR01831 fabG_rel 3-oxoacyl-(  95.8   0.017 4.3E-07   33.3   4.8  125    3-131     1-164 (239)
316 PRK05671 aspartate-semialdehyd  95.8   0.004   1E-07   36.8   1.4   22    1-22      5-26  (336)
317 pfam01118 Semialdhyde_dh Semia  95.8  0.0089 2.3E-07   34.9   3.2   82    2-105     1-103 (121)
318 PRK05294 carB carbamoyl phosph  95.7   0.046 1.2E-06   30.9   6.7  140    2-157     9-180 (1063)
319 smart00829 PKS_ER Enoylreducta  95.7   0.043 1.1E-06   31.0   6.5   32    1-32    106-138 (288)
320 cd05290 LDH_3 A subgroup of L-  95.7   0.037 9.5E-07   31.4   6.1   95    2-99      1-119 (307)
321 KOG1204 consensus               95.6  0.0025 6.5E-08   37.9  -0.0  126    3-139     9-173 (253)
322 PRK13194 pyrrolidone-carboxyla  95.6   0.019 4.9E-07   33.0   4.3   57    1-58      1-68  (204)
323 pfam04127 DFP DNA / pantothena  95.6   0.061 1.6E-06   30.1   6.9   62    2-63      4-97  (197)
324 TIGR02817 adh_fam_1 zinc-bindi  95.6   0.045 1.1E-06   30.9   6.1   48    2-56    153-202 (338)
325 pfam03721 UDPG_MGDP_dh_N UDP-g  95.5   0.022 5.7E-07   32.6   4.4   31    1-32      1-32  (185)
326 PTZ00082 L-lactate dehydrogena  95.5    0.11 2.9E-06   28.6   8.0  225    2-248     9-267 (322)
327 PRK05690 molybdopterin biosynt  95.5   0.029 7.4E-07   32.0   4.9   99    2-101    34-156 (245)
328 PRK10754 quinone oxidoreductas  95.5   0.041   1E-06   31.1   5.6   30    2-31    143-173 (327)
329 PRK05294 carB carbamoyl phosph  95.4   0.062 1.6E-06   30.1   6.5  134    2-155   555-718 (1063)
330 PRK06849 hypothetical protein;  95.4    0.09 2.3E-06   29.2   7.2   59    1-59      5-85  (387)
331 TIGR01850 argC N-acetyl-gamma-  95.4    0.02   5E-07   32.9   3.7  113    1-134     1-146 (361)
332 PRK13193 pyrrolidone-carboxyla  95.3   0.024 6.2E-07   32.4   4.1   58    1-59      1-69  (201)
333 PRK06728 aspartate-semialdehyd  95.3   0.011 2.8E-07   34.3   2.3   22    1-22      6-27  (347)
334 COG2099 CobK Precorrin-6x redu  95.2   0.037 9.4E-07   31.4   4.7   83    1-99      3-100 (257)
335 PRK08229 2-dehydropantoate 2-r  95.1   0.038 9.6E-07   31.3   4.6   32    1-33      3-35  (341)
336 PRK13303 L-aspartate dehydroge  95.1   0.031   8E-07   31.8   4.1   59    1-62      2-73  (265)
337 PRK07688 thiamine/molybdopteri  95.1   0.038 9.8E-07   31.3   4.5   99    1-101    25-150 (339)
338 PRK05579 bifunctional phosphop  95.1     0.1 2.6E-06   28.9   6.7   29    2-30      5-38  (392)
339 PRK06522 2-dehydropantoate 2-r  95.1   0.035 8.8E-07   31.5   4.2   31    1-32      1-32  (307)
340 pfam02670 DXP_reductoisom 1-de  95.1   0.088 2.3E-06   29.2   6.3   51    3-57      1-54  (129)
341 PRK08664 aspartate-semialdehyd  95.0   0.042 1.1E-06   31.1   4.6   29    1-29      4-34  (350)
342 PRK12475 thiamine/molybdopteri  95.0   0.037 9.3E-07   31.4   4.1   98    2-101    26-150 (337)
343 PRK06223 malate dehydrogenase;  94.9   0.021 5.3E-07   32.8   2.7   94    1-99      1-118 (312)
344 PRK13197 pyrrolidone-carboxyla  94.9   0.042 1.1E-06   31.0   4.2   57    1-58      2-69  (215)
345 COG0136 Asd Aspartate-semialde  94.8   0.031   8E-07   31.8   3.5   86    1-104     2-102 (334)
346 COG2085 Predicted dinucleotide  94.8    0.09 2.3E-06   29.2   5.8   32    1-32      1-33  (211)
347 PRK00711 D-amino acid dehydrog  94.8   0.046 1.2E-06   30.8   4.2   31    1-32      1-32  (416)
348 TIGR01289 LPOR light-dependent  94.7   0.063 1.6E-06   30.1   4.8   98    3-100     6-143 (321)
349 PRK12815 carB carbamoyl phosph  94.7    0.17 4.3E-06   27.6   6.9   60    2-61    556-641 (1068)
350 PRK12921 2-dehydropantoate 2-r  94.6   0.052 1.3E-06   30.5   4.2   31    1-32      1-32  (306)
351 TIGR02823 oxido_YhdH putative   94.6   0.046 1.2E-06   30.9   3.9   50    2-58    151-202 (330)
352 TIGR00978 asd_EA aspartate-sem  94.6   0.031   8E-07   31.8   3.0   24    1-24      1-24  (358)
353 TIGR03026 NDP-sugDHase nucleot  94.6    0.12 2.9E-06   28.6   5.9   31    1-32      1-32  (411)
354 COG1004 Ugd Predicted UDP-gluc  94.6     0.1 2.6E-06   28.9   5.6   31    1-32      1-32  (414)
355 cd01493 APPBP1_RUB Ubiquitin a  94.5    0.06 1.5E-06   30.2   4.3  104    1-105    21-150 (425)
356 TIGR00715 precor6x_red precorr  94.5   0.045 1.2E-06   30.9   3.6   82    1-98      1-100 (260)
357 COG1712 Predicted dinucleotide  94.4   0.058 1.5E-06   30.3   4.1   58    1-61      1-71  (255)
358 cd01492 Aos1_SUMO Ubiquitin ac  94.4   0.085 2.2E-06   29.4   4.9  100    1-104    22-147 (197)
359 PRK08762 molybdopterin biosynt  94.4   0.064 1.6E-06   30.0   4.2   94    2-99    140-260 (379)
360 PRK12446 N-acetylglucosaminyl   94.3    0.12   3E-06   28.6   5.4   64    1-64      1-105 (352)
361 pfam00899 ThiF ThiF family. Th  94.3    0.11 2.7E-06   28.8   5.2   97    2-100     3-124 (134)
362 pfam02826 2-Hacid_dh_C D-isome  94.3    0.13 3.3E-06   28.3   5.7   58    1-61     37-100 (176)
363 PRK08306 dipicolinate synthase  94.3    0.17 4.3E-06   27.7   6.2   59    1-62      3-67  (296)
364 PTZ00325 malate dehydrogenase;  94.2   0.032 8.2E-07   31.7   2.3   94    2-99      3-117 (313)
365 PRK07411 hypothetical protein;  94.2   0.095 2.4E-06   29.1   4.7   96    2-100    40-161 (390)
366 COG0604 Qor NADPH:quinone redu  94.0    0.34 8.6E-06   26.0   7.3   48    2-56    145-193 (326)
367 PRK07878 molybdopterin biosynt  93.9    0.12   3E-06   28.5   4.9   97    2-100    44-165 (392)
368 cd01485 E1-1_like Ubiquitin ac  93.9    0.12   3E-06   28.6   4.7  102    2-104    21-150 (198)
369 PRK00885 phosphoribosylamine--  93.9     0.4   1E-05   25.5   7.5   55    1-56      1-68  (424)
370 PRK05597 molybdopterin biosynt  93.9    0.11 2.7E-06   28.8   4.5   96    2-99     30-150 (355)
371 cd00757 ThiF_MoeB_HesA_family   93.8    0.17 4.4E-06   27.6   5.5   31    1-32     22-54  (228)
372 KOG1494 consensus               93.8   0.047 1.2E-06   30.8   2.5  121    2-130    30-177 (345)
373 PRK08040 putative semialdehyde  93.7     0.1 2.7E-06   28.8   4.2   29    2-30      6-38  (337)
374 PRK05708 2-dehydropantoate 2-r  93.6     0.1 2.7E-06   28.8   4.1   31    1-32      3-34  (305)
375 PRK05600 thiamine biosynthesis  93.6    0.12   3E-06   28.5   4.3   96    2-99     43-163 (370)
376 PRK07574 formate dehydrogenase  93.6    0.23 5.8E-06   26.9   5.8   76   17-98     61-143 (385)
377 COG2201 CheB Chemotaxis respon  93.5    0.32 8.2E-06   26.1   6.4   80    1-101     2-83  (350)
378 pfam01210 NAD_Gly3P_dh_N NAD-d  93.4    0.18 4.6E-06   27.5   5.0   31    1-32      1-32  (159)
379 COG0743 Dxr 1-deoxy-D-xylulose  93.4    0.32 8.3E-06   26.1   6.3   30    1-30      2-34  (385)
380 pfam01488 Shikimate_DH Shikima  93.3    0.27 6.9E-06   26.5   5.8   56    1-59     13-84  (134)
381 COG0623 FabI Enoyl-[acyl-carri  93.3    0.29 7.5E-06   26.3   5.9   63    2-64      8-98  (259)
382 COG0289 DapB Dihydrodipicolina  93.3    0.18 4.7E-06   27.5   4.9   78    1-96      3-97  (266)
383 cd01483 E1_enzyme_family Super  93.2    0.18 4.6E-06   27.5   4.8   99    2-101     1-123 (143)
384 PRK06395 phosphoribosylamine--  93.0    0.53 1.4E-05   24.9   6.9   55    1-56      3-71  (435)
385 COG1179 Dinucleotide-utilizing  93.0     0.2 5.1E-06   27.3   4.7   79    2-101    32-153 (263)
386 COG0039 Mdh Malate/lactate deh  92.8   0.089 2.3E-06   29.2   2.7   88    1-93      1-110 (313)
387 pfam01408 GFO_IDH_MocA Oxidore  92.8    0.35 8.9E-06   25.9   5.7   57    1-58      1-70  (120)
388 PRK13195 pyrrolidone-carboxyla  92.7    0.22 5.6E-06   27.0   4.6   56    2-58      3-69  (222)
389 PRK13790 phosphoribosylamine--  92.7    0.68 1.7E-05   24.2   7.4   55    1-56      1-69  (415)
390 COG0287 TyrA Prephenate dehydr  92.7     0.3 7.6E-06   26.3   5.3   57    1-58      4-72  (279)
391 PRK07502 cyclohexadienyl dehyd  92.5    0.31 7.9E-06   26.2   5.2   55    2-59      8-75  (307)
392 cd00650 LDH_MDH_like NAD-depen  92.5    0.11 2.8E-06   28.7   2.9   93    3-99      1-119 (263)
393 TIGR02685 pter_reduc_Leis pter  92.4     0.3 7.5E-06   26.3   5.0   28    3-30      4-32  (283)
394 PRK00045 hemA glutamyl-tRNA re  92.3    0.77   2E-05   24.0   7.0   56    2-60    184-252 (429)
395 PRK07588 hypothetical protein;  92.3    0.23 5.8E-06   26.9   4.3   31    1-32      1-32  (391)
396 PRK13789 phosphoribosylamine--  92.3    0.77   2E-05   23.9   7.6   55    1-56      5-74  (426)
397 PRK08328 hypothetical protein;  92.3    0.23 5.7E-06   27.0   4.2   99    2-101    29-152 (230)
398 PRK06753 hypothetical protein;  92.3    0.22 5.7E-06   27.0   4.2   31    1-32      1-32  (373)
399 PRK00726 murG N-acetylglucosam  92.3    0.41   1E-05   25.5   5.6   20   44-63     85-104 (359)
400 cd05293 LDH_1 A subgroup of L-  92.2    0.13 3.3E-06   28.3   2.9   93    1-99      4-120 (312)
401 COG0026 PurK Phosphoribosylami  92.2    0.71 1.8E-05   24.1   6.7   52    1-55      2-67  (375)
402 smart00859 Semialdhyde_dh Semi  92.1    0.13 3.2E-06   28.4   2.8   89    2-105     1-105 (122)
403 PRK11559 garR tartronate semia  92.0    0.43 1.1E-05   25.4   5.4   56    1-59      2-66  (295)
404 PRK00257 erythronate-4-phospha  92.0    0.66 1.7E-05   24.3   6.3   54    2-58    118-176 (379)
405 pfam00070 Pyr_redox Pyridine n  92.0    0.41   1E-05   25.5   5.2   54    2-56      1-60  (82)
406 PRK13982 bifunctional SbtC-lik  91.9    0.44 1.1E-05   25.3   5.3   27    4-30     74-105 (476)
407 PRK09191 two-component respons  91.9    0.61 1.5E-05   24.5   6.0   10  221-230   197-206 (261)
408 pfam02254 TrkA_N TrkA-N domain  91.9    0.43 1.1E-05   25.4   5.2   36    3-45      1-36  (115)
409 PRK08236 hypothetical protein;  91.8    0.34 8.7E-06   25.9   4.7   58    1-58      2-59  (207)
410 pfam03446 NAD_binding_2 NAD bi  91.8    0.41   1E-05   25.5   5.1   55    1-58      2-65  (163)
411 PRK06249 2-dehydropantoate 2-r  91.7    0.23 5.9E-06   26.9   3.8   32    1-33      6-38  (313)
412 cd01489 Uba2_SUMO Ubiquitin ac  91.7    0.74 1.9E-05   24.0   6.3  102    2-104     1-127 (312)
413 PRK00094 gpsA NAD(P)H-dependen  91.6    0.52 1.3E-05   24.9   5.4   31    1-32      2-33  (325)
414 PRK08223 hypothetical protein;  91.5    0.42 1.1E-05   25.4   4.9   95    2-99     29-151 (287)
415 COG1893 ApbA Ketopantoate redu  91.5    0.38 9.6E-06   25.7   4.6   32    1-33      1-33  (307)
416 KOG2018 consensus               91.3    0.33 8.5E-06   26.0   4.2   76    3-96     77-194 (430)
417 cd00755 YgdL_like Family of ac  91.2    0.44 1.1E-05   25.3   4.8   94    2-96     13-131 (231)
418 PRK10643 DNA-binding transcrip  91.2       1 2.6E-05   23.3   6.7   51    1-58      1-52  (222)
419 COG0458 CarB Carbamoylphosphat  91.2    0.61 1.6E-05   24.5   5.5  138    1-153     6-163 (400)
420 TIGR01772 MDH_euk_gproteo mala  91.2    0.23 5.8E-06   26.9   3.2  128    2-139     1-188 (379)
421 cd04510 consensus               91.1    0.21 5.4E-06   27.1   3.0   23    1-23      2-24  (334)
422 PRK08644 thiamine biosynthesis  91.0    0.86 2.2E-05   23.7   6.0   54    2-56     29-99  (209)
423 PRK12464 1-deoxy-D-xylulose 5-  91.0    0.69 1.8E-05   24.2   5.5   27    5-31      1-30  (392)
424 cd01484 E1-2_like Ubiquitin ac  90.9    0.69 1.8E-05   24.2   5.5  100    2-104     1-128 (234)
425 COG0111 SerA Phosphoglycerate   90.9     1.1 2.7E-05   23.2   6.5   50    1-56      2-51  (324)
426 PRK13196 pyrrolidone-carboxyla  90.8    0.47 1.2E-05   25.2   4.5   57    1-58      2-70  (212)
427 COG2039 Pcp Pyrrolidone-carbox  90.7    0.39 9.9E-06   25.6   4.1   58    1-58      1-68  (207)
428 COG4982 3-oxoacyl-[acyl-carrie  90.6       1 2.6E-05   23.2   6.2  141    3-154   399-604 (866)
429 PRK13435 response regulator; P  90.6     1.2   3E-05   22.9   6.7   50    1-56      2-52  (141)
430 PRK12409 D-amino acid dehydrog  90.5    0.37 9.4E-06   25.8   3.8   32    1-33      1-34  (410)
431 cd05291 HicDH_like L-2-hydroxy  90.4    0.28 7.2E-06   26.4   3.2   93    2-99      2-117 (306)
432 cd06334 PBP1_ABC_ligand_bindin  90.4     1.2 3.1E-05   22.8   7.8   13    5-17      8-20  (351)
433 COG0240 GpsA Glycerol-3-phosph  90.3    0.82 2.1E-05   23.8   5.5   31    1-32      2-33  (329)
434 PRK11880 pyrroline-5-carboxyla  90.3    0.62 1.6E-05   24.5   4.8   31    1-32      3-37  (267)
435 KOG2380 consensus               90.3    0.53 1.3E-05   24.9   4.5   61    2-64     54-122 (480)
436 PRK06444 prephenate dehydrogen  90.3    0.35 8.8E-06   25.9   3.5   28    1-28      1-29  (197)
437 TIGR02853 spore_dpaA dipicolin  90.1    0.67 1.7E-05   24.3   4.9   18   81-98    103-120 (288)
438 PRK12480 D-lactate dehydrogena  89.6     1.1 2.8E-05   23.1   5.7   30    1-30      2-32  (330)
439 TIGR00243 Dxr 1-deoxy-D-xylulo  89.6    0.65 1.6E-05   24.4   4.4   28    3-30      6-36  (406)
440 KOG1257 consensus               89.5     1.3 3.3E-05   22.7   5.9   64   39-128   378-442 (582)
441 PRK11064 wecC UDP-N-acetyl-D-m  89.5     0.6 1.5E-05   24.5   4.2   31    1-32      4-35  (415)
442 PRK05784 phosphoribosylamine--  89.4     1.5 3.8E-05   22.4   7.5   55    1-56      1-75  (485)
443 pfam01262 AlaDh_PNT_C Alanine   89.0     1.6 4.1E-05   22.2   6.9   86    2-102    22-124 (150)
444 TIGR02813 omega_3_PfaA polyket  88.9    0.34 8.6E-06   26.0   2.6  119   34-166  2266-2402(2773)
445 TIGR00877 purD phosphoribosyla  88.7     1.6 4.1E-05   22.1   6.0   54    1-55      1-73  (459)
446 cd03802 GT1_AviGT4_like This f  88.7     1.2   3E-05   22.9   5.3   55    1-55      1-92  (335)
447 PRK02318 mannitol-1-phosphate   88.4     1.7 4.4E-05   22.0   6.9   31    1-32      1-33  (381)
448 KOG0172 consensus               88.4    0.99 2.5E-05   23.3   4.7   54    2-58      4-76  (445)
449 COG0677 WecC UDP-N-acetyl-D-ma  88.3    0.99 2.5E-05   23.3   4.7   74    1-77     10-109 (436)
450 PRK07538 hypothetical protein;  88.2    0.85 2.2E-05   23.7   4.3   31    1-32      1-32  (413)
451 TIGR00872 gnd_rel 6-phosphoglu  88.2    0.69 1.8E-05   24.2   3.8   32    1-33      1-34  (341)
452 cd00501 Peptidase_C15 Pyroglut  88.1    0.52 1.3E-05   24.9   3.1   59    1-59      1-69  (194)
453 TIGR03385 CoA_CoA_reduc CoA-di  88.1     1.4 3.7E-05   22.4   5.4   55    2-57    139-200 (427)
454 PRK12490 6-phosphogluconate de  88.0     1.5 3.9E-05   22.3   5.5   57    1-58      1-67  (298)
455 cd03785 GT1_MurG MurG is an N-  88.0     1.3 3.3E-05   22.7   5.1   20   44-63     83-102 (350)
456 pfam06408 consensus             87.8     0.3 7.6E-06   26.3   1.7   20    2-22      3-22  (471)
457 PRK11517 transcriptional regul  87.7     1.9 4.9E-05   21.7   6.6   50    1-57      1-51  (223)
458 PRK08410 2-hydroxyacid dehydro  87.7     1.7 4.4E-05   22.0   5.6   88    1-98      1-92  (311)
459 PRK06487 glycerate dehydrogena  87.5       2 5.1E-05   21.6   6.0   90    1-99      1-96  (317)
460 cd04962 GT1_like_5 This family  87.5     1.5 3.7E-05   22.4   5.1   54    1-54      1-88  (371)
461 PRK05957 aspartate aminotransf  87.4       1 2.6E-05   23.3   4.3   88    3-104    92-202 (389)
462 PRK04965 nitric oxide reductas  87.3     1.7 4.3E-05   22.0   5.4   29    2-31      4-35  (378)
463 PRK06932 glycerate dehydrogena  87.3     1.6   4E-05   22.2   5.2   89    1-99      2-95  (314)
464 cd01491 Ube1_repeat1 Ubiquitin  87.3     2.1 5.2E-05   21.6   6.8  101    2-104    21-142 (286)
465 PRK11259 solA N-methyltryptoph  87.2     1.1 2.7E-05   23.2   4.3   31    1-32      2-35  (377)
466 PRK09260 3-hydroxybutyryl-CoA   87.2     1.8 4.5E-05   21.9   5.4   31    2-33      4-35  (289)
467 PRK07309 aromatic amino acid a  87.1     1.6 4.2E-05   22.1   5.2  128    3-154    94-253 (390)
468 KOG1496 consensus               87.0    0.51 1.3E-05   25.0   2.5   29    1-30      5-33  (332)
469 PRK00066 ldh L-lactate dehydro  87.0    0.63 1.6E-05   24.5   3.0   93    2-99      8-122 (315)
470 PRK09276 aspartate aminotransf  86.9     1.4 3.6E-05   22.5   4.8   89    3-104    96-208 (385)
471 PRK09836 DNA-binding transcrip  86.6     2.3 5.7E-05   21.3   6.7   77    1-100     1-80  (226)
472 PTZ00317 malic enzyme; Provisi  86.4     2.2 5.5E-05   21.4   5.5   10   51-60    238-247 (570)
473 PRK06290 aspartate aminotransf  86.2    0.58 1.5E-05   24.7   2.5  131    3-154   109-267 (411)
474 pfam02844 GARS_N Phosphoribosy  86.1     2.4 6.1E-05   21.2   6.9   54    2-56      1-67  (99)
475 PRK07324 transaminase; Validat  86.1    0.92 2.4E-05   23.5   3.5  127    2-153    82-237 (373)
476 cd00762 NAD_bind_malic_enz NAD  85.9     2.2 5.7E-05   21.4   5.4   83    1-100    26-141 (254)
477 PRK09599 6-phosphogluconate de  85.9     2.3 5.8E-05   21.3   5.4   57    1-58      1-67  (301)
478 COG1052 LdhA Lactate dehydroge  85.8     2.5 6.3E-05   21.1   6.5   91    1-98      1-95  (324)
479 PRK09147 aminotransferase; Pro  85.7     1.7 4.4E-05   22.0   4.7  100   37-154   154-261 (397)
480 PRK07261 topology modulation p  85.6       1 2.7E-05   23.2   3.6   31    1-31      1-33  (171)
481 PRK13512 coenzyme A disulfide   85.6     2.3 5.9E-05   21.2   5.3   29    2-31      3-34  (438)
482 COG3947 Response regulator con  85.5       2 5.1E-05   21.6   5.0  106    1-128     1-108 (361)
483 PRK07680 late competence prote  85.4       2 5.1E-05   21.6   4.9   31    1-32      1-36  (273)
484 PRK08605 D-lactate dehydrogena  85.3     2.6 6.6E-05   21.0   5.5   48    1-55      2-50  (332)
485 TIGR01915 npdG NADPH-dependent  85.3     1.1 2.9E-05   23.0   3.6   52    1-52      1-61  (233)
486 TIGR01771 L-LDH-NAD L-lactate   85.2     1.9 4.8E-05   21.8   4.7  207    8-248     3-253 (302)
487 PRK10816 DNA-binding transcrip  85.1     2.7 6.8E-05   20.9   6.7   78    1-101     1-81  (223)
488 PRK10336 DNA-binding transcrip  85.1     2.7 6.8E-05   20.9   6.6   49    1-56      1-50  (219)
489 KOG2013 consensus               85.0     1.3 3.4E-05   22.6   3.9   61    2-63     14-94  (603)
490 PRK03815 murD UDP-N-acetylmura  85.0     1.2 3.2E-05   22.8   3.7   30    1-31      1-31  (401)
491 COG1023 Gnd Predicted 6-phosph  84.9     2.3 5.8E-05   21.3   5.0  100    1-101     1-121 (300)
492 TIGR02667 moaB_proteo molybden  84.9    0.27 6.8E-06   26.6   0.3   50   13-62     24-77  (163)
493 PRK11790 D-3-phosphoglycerate   84.9     2.5 6.5E-05   21.0   5.3   47    1-55     11-58  (409)
494 PRK05868 hypothetical protein;  84.8     1.6   4E-05   22.2   4.1   31    1-32      1-33  (372)
495 pfam02737 3HCDH_N 3-hydroxyacy  84.2     1.8 4.5E-05   21.9   4.2   31    2-33      1-32  (180)
496 PRK07045 putative monooxygenas  84.2     1.7 4.4E-05   22.0   4.1   30    1-31      6-36  (388)
497 PRK00258 aroE shikimate 5-dehy  84.2       3 7.5E-05   20.7   5.7   93    2-97    124-239 (275)
498 TIGR00421 ubiX_pad polyprenyl   84.0     2.5 6.4E-05   21.1   4.9   42    3-45      4-55  (181)
499 PRK00141 murD UDP-N-acetylmura  84.0     2.1 5.3E-05   21.5   4.5   74    2-96     19-104 (476)
500 PRK07679 pyrroline-5-carboxyla  83.9       3 7.8E-05   20.6   5.3   54    1-57      4-72  (279)

No 1  
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005913    dTDP-4-dehydrorhamnose reductase (1.1.1.133 from EC) catalyzes the last of 4 steps in making dTDP-rhamnose, a precursor of LPS molecules such as core antigen and O-antigen.  dTDP-6-deoxy-L-mannose + NADP+ = dTDP-4-dehydro-6-deoxy-L-mannose + NADPH  ; GO: 0008831 dTDP-4-dehydrorhamnose reductase activity, 0045226 extracellular polysaccharide biosynthetic process.
Probab=100.00  E-value=0  Score=547.58  Aligned_cols=288  Identities=42%  Similarity=0.688  Sum_probs=271.8

Q ss_pred             EEEEECCCCHHHHHHHHHHH-CCCEEEEECHH----------HCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCC
Q ss_conf             49999788978899999996-49859996136----------70878999999999755998999786344543223322
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRP----------DIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEP   70 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~----------~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~~e~~~   70 (290)
                      ||||||++|+||++|++.|. .|.++++++++          ++||+|++.+.++++..+||+|||+||||+||+||+||
T Consensus         1 rilitGa~GQlG~~L~~~l~~~g~~~~~~~~~~~~~~~~~~~~~Dl~dP~~l~~~~r~~~Pd~vvntAAYT~VD~AE~~~   80 (317)
T TIGR01214         1 RILITGANGQLGRELVQQLSKPGRVVVALTRSTRLKLAARWSQLDLTDPEALEELLRAIRPDAVVNTAAYTDVDGAESDP   80 (317)
T ss_pred             CEEEECCCCHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCEEEECCHHCCCCCCCCCH
T ss_conf             97887387567999999707888278643687776113365440622468899999852875376230110100003777


Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCC--CCCC
Q ss_conf             102420122211000112233333344553211135----7554421111222211101245666653101222--3223
Q gi|254780921|r   71 EIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDG----LSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTN--NYVI  144 (290)
Q Consensus        71 ~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g----~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~--~~~I  144 (290)
                      +.+|++|..++.+|+++|...|+.+||+||||||||    ++..||.|+|++||+|.||.||++||+.+++..+  +++|
T Consensus        81 ~~AyavNa~A~~~lA~~A~~~Ga~~vh~STDYVFDGdfGG~~~~PY~e~D~~nPlnvYG~SK~~GE~a~~~~~~~e~~lI  160 (317)
T TIGR01214        81 EKAYAVNALAPQNLARAAARVGARLVHISTDYVFDGDFGGEGKRPYREDDETNPLNVYGQSKLAGEQAVRAAGPDENALI  160 (317)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEEEEEEECEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEE
T ss_conf             78765740789999999986691599986342344755788866887646879843121115689999998379985788


Q ss_pred             CCCCCCEECCC---CCCCCEEECCC-CCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHH--HHCCCCCCCCCEEEECCCC
Q ss_conf             55542000368---63200020112-466521530455454452236899999999844--2024433443137623866
Q gi|254780921|r  145 LRTAWVYSIFG---SNFLLSMLRLA-KERREISVVCDQFGTPTSALQIARAIIQIAHNL--IENSDTSLRGIFHMTADGG  218 (290)
Q Consensus       145 lR~~~vyG~~~---~~~v~~~l~~~-~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~--~~~~~~~~~Giyn~~~~~~  218 (290)
                      +|++||||.++   +||+.+|++++ ++++++.+|.||+++|||+.|+|++|..++++.  .-.......||||++++ +
T Consensus       161 vRTsWlY~~~g~~g~NF~~tMlrLaG~~~~~l~vV~DQ~GsPTy~~dLA~~~~~ll~~~~Wdv~~~a~~~GvYH~~~~-G  239 (317)
T TIGR01214       161 VRTSWLYGAGGGSGRNFVKTMLRLAGKEREELRVVDDQIGSPTYAKDLARAIAALLERLNWDVEDAARARGVYHLANS-G  239 (317)
T ss_pred             EEEEEEECCCCCCCCCHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCEEEEEEC-C
T ss_conf             985213448998842179999985378998403785576873589999999999997613340010136734677505-4


Q ss_pred             CCCHHHHHHHHHHHHHHHC--CCCH-HEEECCHHHHCCCCCCCCCCCCCHHHHHHHHC---CCCCCHHHHHHHHHHHC
Q ss_conf             6788999999999999727--9800-05762858808768997511008689999617---89999899999999719
Q gi|254780921|r  219 PVSWADFAEYIFWESAERG--GPYS-KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHN---IRISTWKEGVRNILVNI  290 (290)
Q Consensus       219 ~~s~~e~a~~I~~~~~~~~--~~~~-~i~~~~~~~~~~~a~RP~~~~Ld~~K~~~~lg---~~~~~~~e~i~~~i~~l  290 (290)
                      .+||||||+.|++.+...+  .... +|.||++++||.+|+||.||+||+.|+.+.||   .+||+||++|+++|+++
T Consensus       240 ~~SWyeFA~~If~~~~~~g~~~~~~~~v~Pis~~~yp~pA~RPayS~Ld~~~~~~~~g~P~~~lp~Wr~al~~~l~~~  317 (317)
T TIGR01214       240 QVSWYEFAQAIFEVAGECGLLLKVPEEVKPISSKEYPTPARRPAYSVLDNTKLVKTLGKPLLVLPDWREALRAVLKEA  317 (317)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCCCCCCEECHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCC
T ss_conf             313688999999999854710487200010113207789988643044568999960866679987899999997409


No 2  
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional
Probab=100.00  E-value=0  Score=506.72  Aligned_cols=287  Identities=39%  Similarity=0.624  Sum_probs=265.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCCEEEEECH--HHC--CCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCEEEEE
Q ss_conf             9499997889788999999964985999613--670--878999999999755998999786344543223322102420
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGR--PDI--DLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSI   76 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~~~v~~~~r--~~~--D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~~e~~~~~~~~~   76 (290)
                      |||||||++|+||++|.+.|.+.+++.++++  .+.  |++|.+++.+++.+.+||+||||||+|+||.||.+|+.++++
T Consensus         1 MkILvtGa~GqLG~~l~~~l~~~~~~~~~~~~~~~~~~Dit~~~~v~~~~~~~~Pd~IIN~aA~T~VD~~E~~~~~a~~v   80 (299)
T PRK09987          1 MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRKIRPDVIVNAAAHTAVDKAESEPEFAQLL   80 (299)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCEEEECHHHCCHHHHHCCHHHHHHH
T ss_conf             97999899997899999986650988998526300136789999999999965999999883101636652489999998


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCEECCCC
Q ss_conf             12221100011223333334455321113575544211112222111012456666531012223223555420003686
Q gi|254780921|r   77 NAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGS  156 (290)
Q Consensus        77 Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~~~~IlR~~~vyG~~~~  156 (290)
                      |+.++.+|+++|++.++++||+|||+||||.++.||.|+|+++|+|.||+||++||+.++..+.+++|+|++||||+.+.
T Consensus        81 N~~~~~~La~~~~~~~~~lIhiSTD~VFdG~~~~pY~E~d~~~P~n~YG~sKl~GE~~v~~~~~~~~IlRtswl~~~~g~  160 (299)
T PRK09987         81 NATSVEAIAKAANEVGAWVVHYSTDYVFPGTGDIPWQETDATAPLNVYGETKLAGEKALQDNCAKHLIFRTSWVYAGKGN  160 (299)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEECCCEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCC
T ss_conf             88999999999997398599963211606899989999998896368989999989999962874088514788647898


Q ss_pred             CCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             32000201124665215304554544522368999999998442024433443137623866678899999999999972
Q gi|254780921|r  157 NFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER  236 (290)
Q Consensus       157 ~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~  236 (290)
                      ||+.+|++.+++++++.++.||+++||++.|+|+++..+++....  ....+||||++++ +.+||||||++|++.+...
T Consensus       161 nFv~~il~~~~~~~~l~vv~Dq~gsPT~~~~la~~~~~~i~~~~~--~~~~~GiyH~~~~-g~~S~yefA~~I~~~a~~~  237 (299)
T PRK09987        161 NFAKTMLRLAKEREELSVINDQFGAPTGAELLADCTAHAIRVALN--KPEVAGLYHLVAG-GTTTWHDYAALVFEEARKA  237 (299)
T ss_pred             CHHHHHHHHHHCCCCCEEECCEECCCCCHHHHHHHHHHHHHHHHC--CCCCCCEEEECCC-CCCCHHHHHHHHHHHHHHC
T ss_conf             799999999873998713557458974699999999999999735--8755671560499-8848999999999999973


Q ss_pred             CCC--CHHEEECCHHHHCCCCCCCCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             798--000576285880876899751100868999961789999899999999719
Q gi|254780921|r  237 GGP--YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI  290 (290)
Q Consensus       237 ~~~--~~~i~~~~~~~~~~~a~RP~~~~Ld~~K~~~~lg~~~~~~~e~i~~~i~~l  290 (290)
                      +..  ..++.|+++.+++.+|+||+|++||++|+++.||+++++|+++|+++|++|
T Consensus       238 ~~~~~~~~i~~i~s~~~~~~A~RP~~s~Ld~~Ki~~~~gi~~p~W~~~L~~~l~el  293 (299)
T PRK09987        238 GITLALTKLNAVPTSAYPTPARRPHNSRLNTEKFQRNFALVLPDWQVGVKRMLTEL  293 (299)
T ss_pred             CCCCCCCEEEEEEHHHCCCCCCCCCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             99756570478666545888999873426789999872999967899999999998


No 3  
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=488.61  Aligned_cols=280  Identities=43%  Similarity=0.729  Sum_probs=262.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCCEEEEECHHHCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCEEEEECCCC
Q ss_conf             94999978897889999999649859996136708789999999997559989997863445432233221024201222
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEG   80 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~~~v~~~~r~~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~   80 (290)
                      |||||||++|++|++|.++|..+++|++++|.++|++|++.+.+++++.+||+|||||||++||.||.+|+.+|.+|+.+
T Consensus         1 M~iLi~G~~GqLG~~L~~~l~~~~~v~a~~~~~~Ditd~~~v~~~i~~~~PDvVIn~AAyt~vD~aE~~~e~A~~vNa~~   80 (281)
T COG1091           1 MKILITGANGQLGTELRRALPGEFEVIATDRAELDITDPDAVLEVIRETRPDVVINAAAYTAVDKAESEPELAFAVNATG   80 (281)
T ss_pred             CCEEEECCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             95899769876799999971778439951576555568589999998619998998732036541338989977767799


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCEECCCCCCCC
Q ss_conf             11000112233333344553211135755442111122221110124566665310122232235554200036863200
Q gi|254780921|r   81 AGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLL  160 (290)
Q Consensus        81 ~~~l~~~~~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~~~~IlR~~~vyG~~~~~~v~  160 (290)
                      +.+|+++|.+.|+++||+|||+||||.+..||.|+|+++|+|.||+||++||+.+++++++++|+|++||||.+++||+.
T Consensus        81 ~~~lA~aa~~~ga~lVhiSTDyVFDG~~~~~Y~E~D~~~P~nvYG~sKl~GE~~v~~~~~~~~I~Rtswv~g~~g~nFv~  160 (281)
T COG1091          81 AENLARAAAEVGARLVHISTDYVFDGEKGGPYKETDTPNPLNVYGRSKLAGEEAVRAAGPRHLILRTSWVYGEYGNNFVK  160 (281)
T ss_pred             HHHHHHHHHHHCCEEEEEECCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEECCCCCCHHH
T ss_conf             99999999971976999634457438989888778999970245477897899999739987999856554588877899


Q ss_pred             EEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             02011246652153045545445223689999999984420244334431376238666788999999999999727980
Q gi|254780921|r  161 SMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY  240 (290)
Q Consensus       161 ~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~  240 (290)
                      +|++++++++++.++.||+++|||+.|+|++|..++....      ..|+||++++ +.+||||||+.|++.+...+   
T Consensus       161 tml~la~~~~~l~vv~Dq~gsPt~~~dlA~~i~~ll~~~~------~~~~yH~~~~-g~~Swydfa~~I~~~~~~~~---  230 (281)
T COG1091         161 TMLRLAKEGKELKVVDDQYGSPTYTEDLADAILELLEKEK------EGGVYHLVNS-GECSWYEFAKAIFEEAGVDG---  230 (281)
T ss_pred             HHHHHHHCCCCEEEECCEEECCCCHHHHHHHHHHHHHCCC------CCCEEEEECC-CCCCHHHHHHHHHHHHCCCC---
T ss_conf             9999850599269979845387469999999999983455------5867998079-74119999999999838886---


Q ss_pred             HHEEECCHHHHCCCCCCCCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             00576285880876899751100868999961789999899999999719
Q gi|254780921|r  241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI  290 (290)
Q Consensus       241 ~~i~~~~~~~~~~~a~RP~~~~Ld~~K~~~~lg~~~~~~~e~i~~~i~~l  290 (290)
                      ..++++++.+++..|+||.|++||++|+++.+|++|++||++++++++++
T Consensus       231 ~v~~~~~~~~~~~~a~RP~~S~L~~~k~~~~~~~~~~~w~~~l~~~~~~~  280 (281)
T COG1091         231 EVIEPIASAEYPTPAKRPANSSLDTKKLEKAFGLSLPEWREALKALLDEL  280 (281)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHC
T ss_conf             41455562236766789755542528899974889825999999997331


No 4  
>pfam04321 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.
Probab=100.00  E-value=0  Score=457.03  Aligned_cols=282  Identities=46%  Similarity=0.770  Sum_probs=262.7

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHHCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCEEEEECCCCC
Q ss_conf             999978897889999999-6498599961367087899999999975599899978634454322332210242012221
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGA   81 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~   81 (290)
                      ||||||+||||++|++.| .+|++|++++|.++|++|++.+++++++.+||+||||||++.++.|+.+|+.++++|+.+|
T Consensus         1 ILVtG~~GfiGs~l~~~L~~~g~~v~~~~r~~~D~~d~~~l~~~~~~~~pd~VihlAa~~~~~~~~~~~~~~~~~Nv~~t   80 (284)
T pfam04321         1 ILVTGANGQLGRELTRLLAERGVEVVALDRPELDLTDPEAVAALVREARPDVVVNAAAYTAVDKAESEPELAYAVNALGP   80 (284)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCHHHHHCHHHHHHHHHHHH
T ss_conf             69964899899999999986899899954862578899999999986499799972413555677748888998759999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCE
Q ss_conf             10001122333333445532111357554421111222211101245666653101222322355542000368632000
Q gi|254780921|r   82 GAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLS  161 (290)
Q Consensus        82 ~~l~~~~~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~~~~IlR~~~vyG~~~~~~v~~  161 (290)
                      .+|+++|++.++++||+||++||+|....|++|+|+++|.+.||.||+++|+++++++.+++|+|++++|||++++|+.+
T Consensus        81 ~~l~~~~~~~~~~~i~~Ss~~Vy~g~~~~p~~E~~~~~P~~~Yg~sK~~~E~~~~~~~~~~~IlR~~~vyG~~~~~~~~~  160 (284)
T pfam04321        81 GNLAEACAARGAPLIHISTDYVFDGAKGGPYREDDPTGPLNVYGRTKLAGEQAVLAANPRHLILRTAWVYGEYGNNFVKT  160 (284)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHHH
T ss_conf             99999987449857984175300068998854577778988016575899999997253460787734428888788999


Q ss_pred             EECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCH
Q ss_conf             20112466521530455454452236899999999844202443344313762386667889999999999997279800
Q gi|254780921|r  162 MLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS  241 (290)
Q Consensus       162 ~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~  241 (290)
                      +++.+..++++.+++||+++|+|++|+|+++..++++....  ...+||||++++ +.+|++||++.|.+.   .+....
T Consensus       161 ~~~~~~~~~~i~i~~d~~~~~~~v~D~a~~~~~~~e~~~~~--~~~~giyNi~~~-~~~s~~ela~~i~~~---~g~~~~  234 (284)
T pfam04321       161 MLRLAAERDELRVVDDQLGSPTSARDLADALLALIRKRLRG--PALAGTYHLAGS-GETSWYDFARAIFDE---AGADGG  234 (284)
T ss_pred             HHHHHHCCCCCEEECCCCCCCEEHHHHHHHHHHHHHHCCCC--CCCCCCEEECCC-CCEEHHHHHHHHHHH---HCCCCC
T ss_conf             99998628982685375689698999999999999820337--777761374189-844099999999999---688877


Q ss_pred             HEEECCHHHHCCCCCCCCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             0576285880876899751100868999961789999899999999719
Q gi|254780921|r  242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI  290 (290)
Q Consensus       242 ~i~~~~~~~~~~~a~RP~~~~Ld~~K~~~~lg~~~~~~~e~i~~~i~~l  290 (290)
                      .+.+++..+++..++||.+++||++|+++.+||+|++|||||+++|+++
T Consensus       235 ~i~~v~~~~~~~~~~rP~~~~lD~sK~~~~lg~~p~~~~egl~~~l~~~  283 (284)
T pfam04321       235 RVRPIPTAEYPTPARRPANSVLDTSKLEATFGIPLPDWREALAEVLDEL  283 (284)
T ss_pred             CEEEEEHHHCCCCCCCCCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             4266118888878999760015599999976879998999999999996


No 5  
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: IPR005888    The conversion of dTDP-glucose into dTDP-4-keto-6-deoxyglucose by Escherichia coli dTDP-glucose 4,6-dehydratase) takes place in the active site in three steps: dehydrogenation to dTDP-4-ketoglucose, dehydration to dTDP-4-ketoglucose-5,6-ene, and rereduction of C6 to the methyl group. The 4,6-dehydratase makes use of tightly bound NAD^+ as the coenzyme for transiently oxidizing the substrate, activating it for the dehydration step . This and other 4,6-dehydratases catalyze the first committed step in all 6-deoxysugar biosynthetic pathways described to date. Numerous 6-deoxysugars are used in bacterial lipopolysaccharide production as well as in the biosynthesis of a diverse array of secondary metabolites.; GO: 0008460 dTDP-glucose 46-dehydratase activity, 0009225 nucleotide-sugar metabolic process.
Probab=100.00  E-value=0  Score=357.26  Aligned_cols=278  Identities=21%  Similarity=0.259  Sum_probs=233.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHC---CCEEEEECH------H---------------HCCCCCHHHHHHHHHHCCCCEEEEC
Q ss_conf             499997889788999999964---985999613------6---------------7087899999999975599899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ---DVEIIRVGR------P---------------DIDLLKPKDFASFFLSFSPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~---~~~v~~~~r------~---------------~~D~~~~~~~~~~l~~~~pd~Vih~   57 (290)
                      |||||||+||||++++++..+   ..+|+.+|.      .               +.||+|.+.+.++|++.+||+|||+
T Consensus         1 ~~LVTGGaGFIGsnFvry~~~~~~D~~v~vlDkLTYAgn~e~L~~l~~~pr~~Fv~GDI~D~~lv~~~~~e~~~D~VvhF   80 (340)
T TIGR01181         1 RILVTGGAGFIGSNFVRYILNEHPDAEVIVLDKLTYAGNLENLADLEDNPRYRFVKGDIGDRELVDRLLKEHDPDAVVHF   80 (340)
T ss_pred             CCEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEC
T ss_conf             92363278525689999999747995799863544557865552332396615674230228899888400176778862


Q ss_pred             CCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCC--C--------CCC-CCCCCCCCCCCCCCCC--C-CCCCCCCCCCCC
Q ss_conf             634454322332210242012221100011223--3--------333-3445532111357554--4-211112222111
Q gi|254780921|r   58 AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADS--I--------GIP-CIYISTDYVFDGLSRT--P-IDEFSPTNPLNI  123 (290)
Q Consensus        58 Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~--~--------~~~-~I~iSS~~Vy~g~~~~--p-~~E~d~~~P~~~  123 (290)
                      ||.|.||+|-..|+.-.++||.||.-|+|++++  .        ++| |+|||||.|||.-+..  . ++|+||.+|-||
T Consensus        81 AAESHVDRSI~~P~~F~~TNv~GT~tLLEA~R~~w~aL~e~~~a~~r~l~HiSTDEVYGdl~~~~~~~ftE~tpl~PsSP  160 (340)
T TIGR01181        81 AAESHVDRSISGPEAFIETNVVGTYTLLEAVRKYWHALREAKKAGVRKLHHISTDEVYGDLEKGDPASFTETTPLAPSSP  160 (340)
T ss_pred             CCCCHHHHCCCCCHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCEEECCCCCCCCEEEEECCCCCCCCC
T ss_conf             22052333014541144403378899999997404456644513102635760301440467896734423278877872


Q ss_pred             CHHHHHHHHHHHCCCCCC----CCCCCCCCCEECCC--CCCCCEEECCCCCCCCEEECCC--CCCCCCCHHHHHHHHHHH
Q ss_conf             012456666531012223----22355542000368--6320002011246652153045--545445223689999999
Q gi|254780921|r  124 YGKSKLAGEEKVASYTNN----YVILRTAWVYSIFG--SNFLLSMLRLAKERREISVVCD--QFGTPTSALQIARAIIQI  195 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~~~----~~IlR~~~vyG~~~--~~~v~~~l~~~~~~~~i~~~~d--~~~~p~~v~D~a~~i~~~  195 (290)
                      |+.||++++++|+++...    +.|-|.|+=|||+.  ..+|+.|+..+..|+++.+++|  |+|.=+||+|-++||..+
T Consensus       161 YSASKAasD~LVrAy~rTYGLp~~ITrCsNNYGPYQfpEKLIPl~I~nal~G~plPvYGdG~~vRDWlyV~DHcrA~~~V  240 (340)
T TIGR01181       161 YSASKAASDLLVRAYHRTYGLPVLITRCSNNYGPYQFPEKLIPLMITNALAGKPLPVYGDGQQVRDWLYVEDHCRAIELV  240 (340)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEHHHHHHHHHHH
T ss_conf             45889888789888887548860576885577875674201368999987389983301788320324523478999999


Q ss_pred             HHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCCCCCCC---CCCCCHHHHHHHH
Q ss_conf             9844202443344313762386667889999999999997279800057628588087689975---1100868999961
Q gi|254780921|r  196 AHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPA---YSCLDCSKLANTH  272 (290)
Q Consensus       196 ~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP~---~~~Ld~~K~~~~l  272 (290)
                      +++...++      +|||||+.+.+. .|+++.|++.+.+..-....  ....+.+.-...||.   ...||++||++.|
T Consensus       241 L~~G~~GE------~YNIgg~~Er~N-lE~V~~Il~~lgklaP~~p~--~~~~~li~~V~DRPGHDrRYAiD~sKi~~EL  311 (340)
T TIGR01181       241 LEKGRVGE------VYNIGGGNERTN-LEVVEIILELLGKLAPDKPV--KSDEDLIEHVEDRPGHDRRYAIDASKIRREL  311 (340)
T ss_pred             HHCCCCCC------EEECCCCCCCHH-HHHHHHHHHHHHHHCCCCCC--CCCHHHHEECCCCCCCCCCCCCCHHHHHHHC
T ss_conf             82695212------564378762212-88999999874320767767--8884350036769886411044736767616


Q ss_pred             CCCCC-CHHHHHHHHHH
Q ss_conf             78999-98999999997
Q gi|254780921|r  273 NIRIS-TWKEGVRNILV  288 (290)
Q Consensus       273 g~~~~-~~~e~i~~~i~  288 (290)
                      ||+|. +|+|||++.|+
T Consensus       312 GW~P~~tfEeGlr~Tv~  328 (340)
T TIGR01181       312 GWAPKYTFEEGLRETVQ  328 (340)
T ss_pred             CCCCCCCHHHHHHHHHH
T ss_conf             89874238999999999


No 6  
>TIGR01179 galE UDP-glucose 4-epimerase; InterPro: IPR005886    Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (5.1.3.2 from EC) interconverts UDP-glucose and UDP-galactose which are precursors of glucose- and galactose-containing exopolysaccharides (EPS). A set of related proteins, some of which are tentatively identified as UDP-glucose-4-epimerase in Thermotoga maritima, Bacillus halodurans, and several archaea, but deeply branched from this set and lacking experimental evidence, are excluded and described by a separate model. ; GO: 0003978 UDP-glucose 4-epimerase activity, 0006012 galactose metabolic process.
Probab=100.00  E-value=0  Score=351.97  Aligned_cols=268  Identities=21%  Similarity=0.267  Sum_probs=222.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECH-----H-----------------HCCCCCHHHHHHHHH----HCCCCEE
Q ss_conf             4999978897889999999-64985999613-----6-----------------708789999999997----5599899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGR-----P-----------------DIDLLKPKDFASFFL----SFSPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r-----~-----------------~~D~~~~~~~~~~l~----~~~pd~V   54 (290)
                      |||||||+||||||.++.| .+||+|+.+|-     .                 +.||.|.+.++++|+    +.+||+|
T Consensus         1 ~iLVTGGAGYIGSHt~~~Ll~~G~ev~vlDNLs~G~~~~l~~~~~~~G~~~~fv~gDL~D~~~l~~~f~kqql~~~idAV   80 (341)
T TIGR01179         1 KILVTGGAGYIGSHTVRQLLESGYEVVVLDNLSNGSAEALKRGEEITGKEVTFVEGDLRDRELLRRVFEKQQLEHKIDAV   80 (341)
T ss_pred             CEEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCCCEECCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             92686146644358878876359728998157888488750023414853205871751579999998774311675467


Q ss_pred             EECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCHHHHHHHH
Q ss_conf             978634454322332210242012221100011223333-33445532111357554421111222-2111012456666
Q gi|254780921|r   55 INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTN-PLNIYGKSKLAGE  132 (290)
Q Consensus        55 ih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~-P~~~Yg~sK~~~E  132 (290)
                      ||+||...|..|..+|-+.|..||.+|.+|++.|++.|+ +|||.||+.||+-+...|++|+.|.+ |.||||+||+|.|
T Consensus        81 iHFAg~~~VgESv~~Pl~YY~NNv~nTl~L~~~m~~~GV~~~iFSSsAaVYG~p~~~Pi~E~~pl~~PinPYG~sKlM~E  160 (341)
T TIGR01179        81 IHFAGLIAVGESVQKPLKYYRNNVVNTLNLLEAMQETGVKKFIFSSSAAVYGEPESIPISEDSPLGDPINPYGRSKLMVE  160 (341)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             52011212525575245440004689999999999818974153042145077885550222567787486655668899


Q ss_pred             HHHCCCCC-----CCCCCCCCCCEECC--C----------C-CCCCEEECCC-CCCCCEEECCCCC--------CCCCCH
Q ss_conf             53101222-----32235554200036--8----------6-3200020112-4665215304554--------544522
Q gi|254780921|r  133 EKVASYTN-----NYVILRTAWVYSIF--G----------S-NFLLSMLRLA-KERREISVVCDQF--------GTPTSA  185 (290)
Q Consensus       133 ~~v~~~~~-----~~~IlR~~~vyG~~--~----------~-~~v~~~l~~~-~~~~~i~~~~d~~--------~~p~~v  185 (290)
                      ++++++..     +++|||..++.|..  |          + ++++.+.+.+ .+++++.+|++.|        |+.+||
T Consensus       161 ~iL~D~~~a~~~~~~v~LRYFNv~GA~p~GY~iGe~~~~~tNhLip~~~~~A~G~~~~l~IFGtDYPT~DGTcvRDYIHV  240 (341)
T TIGR01179       161 RILRDLSKADPDLSYVILRYFNVAGADPEGYEIGEDPPGITNHLIPYACQVAVGKRDKLTIFGTDYPTPDGTCVRDYIHV  240 (341)
T ss_pred             HHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCEECCCCCCCCCCCEEEEEEEC
T ss_conf             99999987387677998505785144888772366852029418999999844899731362487876798765300200


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCCCCCCCC---CC
Q ss_conf             368999999998442024433443137623866678899999999999972798000576285880876899751---10
Q gi|254780921|r  186 LQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAY---SC  262 (290)
Q Consensus       186 ~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP~~---~~  262 (290)
                      .|+|++.+..++.+..+.+..   |||+|.+.+. |    .+++++.+.+..+....+..        ..+||.|   ..
T Consensus       241 ~DLA~AH~~Al~~L~~g~~s~---~~NlG~G~G~-S----V~EVi~a~~~vsG~~~~~~~--------~~RR~GDpa~l~  304 (341)
T TIGR01179       241 MDLAEAHLAALEYLENGGESH---VYNLGYGQGF-S----VLEVIEAFKKVSGKDIPVEL--------APRRPGDPASLV  304 (341)
T ss_pred             CCHHHHHHHHHHHHHCCCCEE---EEECCCCCCC-C----HHHHHHHHHHHCCCEEEEEE--------CCCCCCCCCEEE
T ss_conf             207778999999986079636---9862467541-0----99999998661098137887--------687798845487


Q ss_pred             CCHHHHHHHHCCCCC-C-HHHHHHH
Q ss_conf             086899996178999-9-8999999
Q gi|254780921|r  263 LDCSKLANTHNIRIS-T-WKEGVRN  285 (290)
Q Consensus       263 Ld~~K~~~~lg~~~~-~-~~e~i~~  285 (290)
                      -|++|+++.|||+|. + +++=+++
T Consensus       305 Ada~ki~~~LgW~p~y~~Le~i~~~  329 (341)
T TIGR01179       305 ADASKIRRELGWQPKYDDLEIIIKT  329 (341)
T ss_pred             CCHHHHHHHCCCCCCCCCHHHHHHH
T ss_conf             3869999753853456888999999


No 7  
>PRK10675 UDP-galactose-4-epimerase; Provisional
Probab=100.00  E-value=0  Score=328.90  Aligned_cols=275  Identities=19%  Similarity=0.203  Sum_probs=214.1

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHCCCCEEEEC
Q ss_conf             94999978897889999999-649859996136----------------------7087899999999975599899978
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSFSPDVIINP   57 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~~pd~Vih~   57 (290)
                      ||||||||+||||++|++.| .+|++|+++++-                      +.|++|...+++++++.+||+|||+
T Consensus         1 MkvLVTGg~GFIGs~l~~~Ll~~g~~V~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~Di~d~~~~~~~~~~~~~d~V~Hl   80 (338)
T PRK10675          1 MRVLVTGGSGYIGSHTCVQLLQNGHDVVILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHF   80 (338)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCEEEEC
T ss_conf             91999898767999999999978498999988988737678888861478875998327998999999986599999989


Q ss_pred             CCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCHHHHHHHHHHH
Q ss_conf             634454322332210242012221100011223333-3344553211135755442111122-22111012456666531
Q gi|254780921|r   58 AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPT-NPLNIYGKSKLAGEEKV  135 (290)
Q Consensus        58 Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~-~P~~~Yg~sK~~~E~~v  135 (290)
                      ||++.+..+..+|...+++|+.+|.+|+++|+..++ ++||+||++||+.....|+.|+.+. .|.++||.||+++|+++
T Consensus        81 Aa~~~~~~~~~~p~~~~~~Nv~gt~nllea~~~~~vkr~v~~SS~~vYG~~~~~p~~E~~~~~~P~s~Yg~sK~~~E~~l  160 (338)
T PRK10675         81 AGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNLIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQIL  160 (338)
T ss_pred             CCCCCCCCHHHCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCEEECCCCCCCEECCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             86545462110989998868988999999999739887999637203378988980024789999994135578999999


Q ss_pred             CCCCC-----CCCCCCCCCCEECCCCC------------CCCEEECCC-CCCCCEEECC------C--CCCCCCCHHHHH
Q ss_conf             01222-----32235554200036863------------200020112-4665215304------5--545445223689
Q gi|254780921|r  136 ASYTN-----NYVILRTAWVYSIFGSN------------FLLSMLRLA-KERREISVVC------D--QFGTPTSALQIA  189 (290)
Q Consensus       136 ~~~~~-----~~~IlR~~~vyG~~~~~------------~v~~~l~~~-~~~~~i~~~~------d--~~~~p~~v~D~a  189 (290)
                      ..+..     +..++|+.++||++...            ++.++.+.+ ..++++.+++      |  |.|+.+|++|++
T Consensus       161 ~~~~~~~~~~~~~i~R~fn~~G~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~~~l~i~G~~~~~~dG~~~Rdfi~V~D~~  240 (338)
T PRK10675        161 TDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLA  240 (338)
T ss_pred             HHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCEEHHHHH
T ss_conf             99998768986899966354254777766879732167999999999844787077527975467998665633187799


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCCCCCCCCCCCCHHHHH
Q ss_conf             99999998442024433443137623866678899999999999972798000576285880876899751100868999
Q gi|254780921|r  190 RAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLA  269 (290)
Q Consensus       190 ~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP~~~~Ld~~K~~  269 (290)
                      +++..+++.+....   ...+||++++ ...|..|+++.+.+..    +....+...+     .....+....+|++|++
T Consensus       241 ~a~~~a~~~~~~~~---~~~i~Nigsg-~~~si~el~~~i~~~~----g~~~~~~~~~-----~r~~d~~~~~~d~~ka~  307 (338)
T PRK10675        241 DGHVVAMEKLANKP---GVHIYNLGAG-VGSSVLDVVNAFSKAC----GKPVNYHFAP-----RREGDLPAYWADASKAD  307 (338)
T ss_pred             HHHHHHHHHHCCCC---CCEEEEECCC-CCEEHHHHHHHHHHHH----CCCCCEEECC-----CCCCCCCEEEECHHHHH
T ss_conf             99999999741689---8458996799-7578999999999997----8997736689-----99998787438799999


Q ss_pred             HHHCCCCC-CHHHHHHHHHH
Q ss_conf             96178999-98999999997
Q gi|254780921|r  270 NTHNIRIS-TWKEGVRNILV  288 (290)
Q Consensus       270 ~~lg~~~~-~~~e~i~~~i~  288 (290)
                      +.|||+|+ +++|||+++++
T Consensus       308 ~~LGw~p~~sl~egl~~t~~  327 (338)
T PRK10675        308 RELNWRVTRTLDEMAQDTWH  327 (338)
T ss_pred             HHHCCCCCCCHHHHHHHHHH
T ss_conf             98299858899999999999


No 8  
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional
Probab=100.00  E-value=0  Score=322.03  Aligned_cols=277  Identities=19%  Similarity=0.230  Sum_probs=212.6

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCE-EEEECH---------------------HHCCCCCHHHHHHHHHHCCCCEEEEC
Q ss_conf             94999978897889999999-64985-999613---------------------67087899999999975599899978
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVE-IIRVGR---------------------PDIDLLKPKDFASFFLSFSPDVIINP   57 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~-v~~~~r---------------------~~~D~~~~~~~~~~l~~~~pd~Vih~   57 (290)
                      ||||||||+||||++|++.| .++++ |+.+++                     .+.|++|...++++++..+||+|||+
T Consensus         1 MkILVTGg~GFIGs~l~~~Ll~~~~~~v~~vd~~~~~~~~~~~~~~~~~~~~~~~~~Di~d~~~l~~~~~~~~~D~ViHl   80 (352)
T PRK10084          1 MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNLESLADVSDSERYVFEHADICDRAELDRIFAQHQPDAVMHL   80 (352)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCEEEEC
T ss_conf             97999751008999999999977998899984798767788888763089717998567899999999997399999997


Q ss_pred             CCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC---------CC-CCCCCCCCCCCCC---------CCCCC-CCCCCC
Q ss_conf             6344543223322102420122211000112233---------33-3344553211135---------75544-211112
Q gi|254780921|r   58 AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSI---------GI-PCIYISTDYVFDG---------LSRTP-IDEFSP  117 (290)
Q Consensus        58 Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~---------~~-~~I~iSS~~Vy~g---------~~~~p-~~E~d~  117 (290)
                      ||.+.++.+..+|...+++|+.||.+|+++|+..         ++ +|||+||+.||+.         ....| +.|+++
T Consensus        81 AA~~~~~~s~~~p~~~~~~Nv~gt~nllea~~~~~~~l~~~~~~~~rfv~~SS~~vYG~~~~p~~~~~~~~~p~~~e~~~  160 (352)
T PRK10084         81 AAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDEDKKNAFRFHHISTDEVYGDLPHPDEVENSVELPLFTETTA  160 (352)
T ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCEEECCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             73466561330967865223786999999999986432001354058887101403468888633356655776557899


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCC----CCCCCCCCCCEECCCC--CCCCEEECCCCCCCCEEECCC--CCCCCCCHHHHH
Q ss_conf             22211101245666653101222----3223555420003686--320002011246652153045--545445223689
Q gi|254780921|r  118 TNPLNIYGKSKLAGEEKVASYTN----NYVILRTAWVYSIFGS--NFLLSMLRLAKERREISVVCD--QFGTPTSALQIA  189 (290)
Q Consensus       118 ~~P~~~Yg~sK~~~E~~v~~~~~----~~~IlR~~~vyG~~~~--~~v~~~l~~~~~~~~i~~~~d--~~~~p~~v~D~a  189 (290)
                      .+|.++||.+|+++|.+++.+..    +++|+|++++|||++.  .++..++..+.+++++.+++|  |.|+.+|++|++
T Consensus       161 ~~p~~~Y~~sK~~~E~l~~~~~~~~gl~~~i~R~~nvyGP~~~~~~~i~~~i~~~l~g~~i~i~G~G~~~Rdf~yV~D~v  240 (352)
T PRK10084        161 YAPSSPYSASKASSDHLVRAWLRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKPLPIYGKGDQIRDWLYVEDHA  240 (352)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCEEEEEEEHHHHH
T ss_conf             99999899999999999998776515876998527530869996036999999998097368817998567129759999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCCCCCC---CCCCCCHH
Q ss_conf             999999984420244334431376238666788999999999999727980005762858808768997---51100868
Q gi|254780921|r  190 RAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRP---AYSCLDCS  266 (290)
Q Consensus       190 ~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP---~~~~Ld~~  266 (290)
                      +++..++....      ...+||++++ ...|..|++..|...+...........    .+......||   ....+|++
T Consensus       241 ~a~~~~~~~~~------~g~~yNig~~-~~~s~~e~~~~i~~~~~~~~~~~~~~~----~~i~~~~~rp~~~~~~~~d~s  309 (352)
T PRK10084        241 RALYKVVTEGK------AGETYNIGGH-NEKKNLDVVLTICDLLDEIVPKATSYR----EQITYVADRPGHDRRYAIDAS  309 (352)
T ss_pred             HHHHHHHHCCC------CCCEEEECCC-CCCCHHHHHHHHHHHHHHHHHHCCCCC----CCCEECCCCCCCCCEEEECHH
T ss_conf             99999986699------9995998999-976389999999999998741216853----232246999999754313899


Q ss_pred             HHHHHHCCCCC-CHHHHHHHHHH
Q ss_conf             99996178999-98999999997
Q gi|254780921|r  267 KLANTHNIRIS-TWKEGVRNILV  288 (290)
Q Consensus       267 K~~~~lg~~~~-~~~e~i~~~i~  288 (290)
                      |+++.|||+|. +++|||+++++
T Consensus       310 k~~~~LGw~P~~sl~eGl~~ti~  332 (352)
T PRK10084        310 KISRELGWKPQETFESGIRKTVE  332 (352)
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             99998499869999999999999


No 9  
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional
Probab=100.00  E-value=0  Score=321.83  Aligned_cols=280  Identities=21%  Similarity=0.259  Sum_probs=215.3

Q ss_pred             CE-EEEECCCCHHHHHHHHHHH-CCCE-EEEECHH---------------------HCCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             94-9999788978899999996-4985-9996136---------------------708789999999997559989997
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMCV-QDVE-IIRVGRP---------------------DIDLLKPKDFASFFLSFSPDVIIN   56 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l~-~~~~-v~~~~r~---------------------~~D~~~~~~~~~~l~~~~pd~Vih   56 (290)
                      || ||||||+||||++|++.|. ++++ ++.++..                     +.|++|.+.+++++++++||+|||
T Consensus         1 MKkILVTGg~GFIGs~Lv~~Ll~~~~~~v~~~d~~~~~~~~~~~~~~~~~~~~~~~~~Di~d~~~l~~~~~~~~pD~ViH   80 (355)
T PRK10217          1 MRKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICDRAELARVFTEYQPDCVMH   80 (355)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             99699937875799999999997699889998289876525444454127871699800588999999998619988999


Q ss_pred             CCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCC---------CC-CCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCC
Q ss_conf             8634454322332210242012221100011223---------33-33344553211135--755442111122221110
Q gi|254780921|r   57 PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADS---------IG-IPCIYISTDYVFDG--LSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        57 ~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~---------~~-~~~I~iSS~~Vy~g--~~~~p~~E~d~~~P~~~Y  124 (290)
                      +||.+.+..+..+|...+.+|+.+|.+|+++|+.         .+ .+++|+||+.||+.  ..+.++.|+++..|.++|
T Consensus        81 lAa~~~~~~s~~~p~~~~~~N~~gt~~lleaar~~~~~l~~~~~~~~~~~~~SS~~vYG~~~~~~~~~~E~~~~~P~s~Y  160 (355)
T PRK10217         81 LAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDKKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPY  160 (355)
T ss_pred             ECCCCCHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHCCCCCCCCCCCCCCCCCCCCCCHH
T ss_conf             42422110121196775430307578999999997754433036614888655420036777888876778888999888


Q ss_pred             HHHHHHHHHHHCCCCC----CCCCCCCCCCEECCCC--CCCCEEECCCCCCCCEEECCC--CCCCCCCHHHHHHHHHHHH
Q ss_conf             1245666653101222----3223555420003686--320002011246652153045--5454452236899999999
Q gi|254780921|r  125 GKSKLAGEEKVASYTN----NYVILRTAWVYSIFGS--NFLLSMLRLAKERREISVVCD--QFGTPTSALQIARAIIQIA  196 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~----~~~IlR~~~vyG~~~~--~~v~~~l~~~~~~~~i~~~~d--~~~~p~~v~D~a~~i~~~~  196 (290)
                      |.+|+++|+++..+..    +++|+|++++|||+..  .++..++..+..++++.+++|  |.|+.+||+|+++++..++
T Consensus       161 g~sK~~~E~l~~~~~~~~gl~~~i~R~~nvYGP~~~~~~~i~~~i~~~~~g~~i~i~G~G~q~Rdf~yV~D~v~a~~~~~  240 (355)
T PRK10217        161 SASKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVA  240 (355)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEECCCCEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEHHHHHHHHHHHH
T ss_conf             99987665543555541588769723575579199984049999999974998862799982897585899999999999


Q ss_pred             HHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCH-HEEECCHHHHCCCCCCCC---CCCCCHHHHHHHH
Q ss_conf             844202443344313762386667889999999999997279800-057628588087689975---1100868999961
Q gi|254780921|r  197 HNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS-KVYRIFTKQYPTKAHRPA---YSCLDCSKLANTH  272 (290)
Q Consensus       197 ~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~-~i~~~~~~~~~~~a~RP~---~~~Ld~~K~~~~l  272 (290)
                      ++..      ...+||++++ ...|..|+++.|...+........ .+... .........||.   ...+|++|+++.|
T Consensus       241 ~~~~------~ge~yNiG~g-~~~~~~~~~~~i~~~~~~l~~~~~~~~~~~-~~~i~~~~~rp~~~~~~~~D~ska~~~L  312 (355)
T PRK10217        241 TTGK------VGETYNIGGH-NERKNLDVVETICELLEELAPNKPHGVAHY-RDLITFVADRPGHDLRYAIDASKIAREL  312 (355)
T ss_pred             HCCC------CCCEEEECCC-CCCCHHHHHHHHHHHHHHHCCCCCCCCCCC-CCCEEECCCCCCCCCEEEECHHHHHHHH
T ss_conf             6699------9997997999-962079999999999997623566554443-4551567999999856322889999984


Q ss_pred             CCCCC-CHHHHHHHHHH
Q ss_conf             78999-98999999997
Q gi|254780921|r  273 NIRIS-TWKEGVRNILV  288 (290)
Q Consensus       273 g~~~~-~~~e~i~~~i~  288 (290)
                      ||+|. +++|||+++++
T Consensus       313 Gw~P~~sleeGl~~ti~  329 (355)
T PRK10217        313 GWLPQETFESGMRKTVQ  329 (355)
T ss_pred             CCCCCCCHHHHHHHHHH
T ss_conf             99889999999999999


No 10 
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional
Probab=100.00  E-value=0  Score=322.14  Aligned_cols=283  Identities=19%  Similarity=0.165  Sum_probs=214.1

Q ss_pred             CE-EEEECCCCHHHHHHHHHHH--CCCEEEEECHH----------------HCCCC-CHHHHHHHHHHCCCCEEEECCCC
Q ss_conf             94-9999788978899999996--49859996136----------------70878-99999999975599899978634
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMCV--QDVEIIRVGRP----------------DIDLL-KPKDFASFFLSFSPDVIINPAAY   60 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l~--~~~~v~~~~r~----------------~~D~~-~~~~~~~~l~~~~pd~Vih~Aa~   60 (290)
                      || ||||||+||||++|++.|.  .+++|+++++.                +.|++ +.+.++..++  +||+|||+||.
T Consensus         1 MKkILVTGgaGFIGs~Lv~~Ll~~~~~~V~~~d~~~~~~~~~~~~~~~~~~~gDi~~~~~~~~~~~~--~~D~V~HlAa~   78 (347)
T PRK11908          1 MKKVLILGVNGFIGHHLTKRILETTDWEVYGMDMQTDRLGDLVNHPRMHFFEGDITINKEWIEYHVK--KCDVVLPLVAI   78 (347)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHCCCCCEEEEECCCCCCHHHHHHHHC--CCCEEEEEHHC
T ss_conf             9889997574389999999999828978999979976367755799859997754469999997660--59889752000


Q ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-------CCCCCCHHHHHHHHH
Q ss_conf             4543223322102420122211000112233333344553211135755442111122-------221110124566665
Q gi|254780921|r   61 TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT-------NPLNIYGKSKLAGEE  133 (290)
Q Consensus        61 ~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~-------~P~~~Yg~sK~~~E~  133 (290)
                      +.+..+..+|..++++|+.++.+++++|.+.+.++||+||+.||+.....++.|++++       .|.+.||.||+++|.
T Consensus        79 ~~~~~~~~~p~~~~~~nv~~t~~ll~~~~~~~~r~if~SS~~VYG~~~~~~~~~~~~~~~~~p~~~p~~~Y~~sK~~~E~  158 (347)
T PRK11908         79 ATPATYVKQPLRVFELDFEANLPIVRSAVKYGKHLVFPSTSEVYGMCSDEEFDPEASALTYGPINKPRWIYACSKQLMDR  158 (347)
T ss_pred             CCHHHHHHCHHHHHHHHHHHHHHHHHHHHHHCCEEEECCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             36488886889999999999999999999739838962661265478999989777876578877865477899999999


Q ss_pred             HHCCCCC----CCCCCCCCCCEECCCC----------CCCCEEECCCCCCCCEEECC--CCCCCCCCHHHHHHHHHHHHH
Q ss_conf             3101222----3223555420003686----------32000201124665215304--554544522368999999998
Q gi|254780921|r  134 KVASYTN----NYVILRTAWVYSIFGS----------NFLLSMLRLAKERREISVVC--DQFGTPTSALQIARAIIQIAH  197 (290)
Q Consensus       134 ~v~~~~~----~~~IlR~~~vyG~~~~----------~~v~~~l~~~~~~~~i~~~~--d~~~~p~~v~D~a~~i~~~~~  197 (290)
                      +++.++.    ++.|+|++++|||+..          .++..++..+..++++.+++  +|.|+.+||+|++++++.+++
T Consensus       159 l~~~y~~~~~l~~~ilR~~nvyGP~~~~~~~~~~~~~~vi~~~i~~~~~g~~i~i~g~G~~~Rdf~yV~D~v~a~~~~l~  238 (347)
T PRK11908        159 VIWAYGMEEGLNFTLFRPFNWIGPGLDSIYTPKEGSSRVVTQFLGHIVRGEPISLVDGGSQKRAFTDIDDGISALMKIIE  238 (347)
T ss_pred             HHHHHHHHHCCCEEEEEECCEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCEEHHHHHHHHHHHHH
T ss_conf             99999998589879997666766996655685446320279999999838984035999710367866799999999996


Q ss_pred             HHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCC-----CCHHEEECCHHHHCCC-CCCCCCCCCCHHHHHHH
Q ss_conf             44202443344313762386667889999999999997279-----8000576285880876-89975110086899996
Q gi|254780921|r  198 NLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-----PYSKVYRIFTKQYPTK-AHRPAYSCLDCSKLANT  271 (290)
Q Consensus       198 ~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~-----~~~~i~~~~~~~~~~~-a~RP~~~~Ld~~K~~~~  271 (290)
                      +..   .....++||+++.+..+|..|+++.|...+.....     ...++.+.+...+... ...+.+...|++|+++.
T Consensus       239 ~~~---~~~~~~i~NIGs~~~~~si~el~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~di~ka~~~  315 (347)
T PRK11908        239 NKD---GVASGKIYNIGNPKNNFSVRELAEKMLELAAEYPEYADSAKKVKLVETTSGAYYGKGYQDVQNRVPKIDNTMQE  315 (347)
T ss_pred             CCC---CCCCCCEEEECCCCCCEEHHHHHHHHHHHHCCCCCCCCCHHCCEEEECCCCCCCCCCCCCHHHCCCCHHHHHHH
T ss_conf             778---88889979958899863699999999998602520035210150342488644565544354420276999998


Q ss_pred             HCCCCC-CHHHHHHHHHH
Q ss_conf             178999-98999999997
Q gi|254780921|r  272 HNIRIS-TWKEGVRNILV  288 (290)
Q Consensus       272 lg~~~~-~~~e~i~~~i~  288 (290)
                      |||+|. +++|||+++++
T Consensus       316 LGw~P~~sleeGl~~ti~  333 (347)
T PRK11908        316 LGWAPQTTFDDALRRIFE  333 (347)
T ss_pred             HCCCCCCCHHHHHHHHHH
T ss_conf             499658969999999999


No 11 
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=307.32  Aligned_cols=269  Identities=23%  Similarity=0.266  Sum_probs=216.1

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECH-----------H-----HCCCCCHHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             94999978897889999999-64985999613-----------6-----7087899999999975599899978634454
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGR-----------P-----DIDLLKPKDFASFFLSFSPDVIINPAAYTAV   63 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r-----------~-----~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~   63 (290)
                      |+||||||+||||||.+..| .+|++|+.+|.           .     +.|++|.+.+.++|++.+||.|||+||...|
T Consensus         1 ~~iLVtGGAGYIGSHtv~~Ll~~G~~vvV~DNL~~g~~~~v~~~~~~f~~gDi~D~~~L~~vf~~~~idaViHFAa~~~V   80 (329)
T COG1087           1 MKVLVTGGAGYIGSHTVRQLLKTGHEVVVLDNLSNGHKIALLKLQFKFYEGDLLDRALLTAVFEENKIDAVVHFAASISV   80 (329)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHCCCCEEEECCCCHHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             92999658654689999999978984899956887888886020485688334319999999986499889987300432


Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCC--
Q ss_conf             322332210242012221100011223333-33445532111357554421111222211101245666653101222--
Q gi|254780921|r   64 DKAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTN--  140 (290)
Q Consensus        64 ~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~--  140 (290)
                      ..+-.+|...|..|+.||.+|+++|++.++ ++||.||+.||+.+...|++|+.+.+|.|+||+||++.|++++.+..  
T Consensus        81 gESv~~Pl~Yy~NNv~gTl~Ll~am~~~gv~~~vFSStAavYG~p~~~Pi~E~~~~~p~NPYG~sKlm~E~iL~d~~~a~  160 (329)
T COG1087          81 GESVQNPLKYYDNNVVGTLNLIEAMLQTGVKKFIFSSTAAVYGEPTTSPISETSPLAPINPYGRSKLMSEEILRDAAKAN  160 (329)
T ss_pred             CHHHHCHHHHHHHCHHHHHHHHHHHHHHCCCEEEEECCCHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             34441878888603086999999999829976999243010389987664788888998853157999999999998716


Q ss_pred             --CCCCCCCCCCEECCC-----------CCCCCEEECC-CCCCCCEEECCCCCCCC--------CCHHHHHHHHHHHHHH
Q ss_conf             --322355542000368-----------6320002011-24665215304554544--------5223689999999984
Q gi|254780921|r  141 --NYVILRTAWVYSIFG-----------SNFLLSMLRL-AKERREISVVCDQFGTP--------TSALQIARAIIQIAHN  198 (290)
Q Consensus       141 --~~~IlR~~~vyG~~~-----------~~~v~~~l~~-~~~~~~i~~~~d~~~~p--------~~v~D~a~~i~~~~~~  198 (290)
                        ++++||..++-|...           .++++.+++. +.+++.+.+|+|.|-+|        +||.|+|++.+..++.
T Consensus       161 ~~~~v~LRYFN~aGA~~~G~iGe~~~~~thLip~~~q~A~G~r~~l~ifG~DY~T~DGT~iRDYIHV~DLA~aHv~Al~~  240 (329)
T COG1087         161 PFKVVILRYFNVAGACPDGTLGQRYPGATLLIPVAAEAALGKRDKLFIFGDDYDTKDGTCIRDYIHVDDLADAHVLALKY  240 (329)
T ss_pred             CCCEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEEEEEEHHHHHHHHHHHHHH
T ss_conf             97289998513356798876677999933688999999846886557848989999987022343246679999999999


Q ss_pred             HHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCCCCCCC---CCCCCHHHHHHHHCCC
Q ss_conf             4202443344313762386667889999999999997279800057628588087689975---1100868999961789
Q gi|254780921|r  199 LIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPA---YSCLDCSKLANTHNIR  275 (290)
Q Consensus       199 ~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP~---~~~Ld~~K~~~~lg~~  275 (290)
                      +.+++..   .+||++++.+ .|-    +++++.+.+..+....++-        ..+||.   -..-|.+|+++.|||+
T Consensus       241 L~~~g~~---~~~NLG~G~G-~SV----~evi~a~~~vtg~~ip~~~--------~~RR~GDpa~l~Ad~~kA~~~LgW~  304 (329)
T COG1087         241 LKEGGSN---NIFNLGSGNG-FSV----LEVIEAAKKVTGRDIPVEI--------APRRAGDPAILVADSSKARQILGWQ  304 (329)
T ss_pred             HHHCCCE---EEEECCCCCC-EEH----HHHHHHHHHHHCCCCCEEE--------CCCCCCCCCEEEECHHHHHHHHCCC
T ss_conf             9818960---4897468975-249----9999999998699576265--------7889999611476789999883997


Q ss_pred             CC--CHHHHHHH
Q ss_conf             99--98999999
Q gi|254780921|r  276 IS--TWKEGVRN  285 (290)
Q Consensus       276 ~~--~~~e~i~~  285 (290)
                      |.  ++++-+++
T Consensus       305 p~~~~L~~ii~~  316 (329)
T COG1087         305 PTYDDLEDIIKD  316 (329)
T ss_pred             CCCCCHHHHHHH
T ss_conf             633789999998


No 12 
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=306.78  Aligned_cols=274  Identities=22%  Similarity=0.245  Sum_probs=223.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCC---CEEEEECHH---------------------HCCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             94999978897889999999649---859996136---------------------708789999999997559989997
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQD---VEIIRVGRP---------------------DIDLLKPKDFASFFLSFSPDVIIN   56 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~---~~v~~~~r~---------------------~~D~~~~~~~~~~l~~~~pd~Vih   56 (290)
                      |++|||||+||||+++++.+.+.   .+|+.+|.-                     +.|++|.+.+.+++++.+||+|+|
T Consensus         1 ~~iLVTGGaGFIGsnfvr~~~~~~~d~~v~~~DkLTYAgn~~~l~~~~~~~~~~fv~~DI~D~~~v~~~~~~~~~D~Vvh   80 (340)
T COG1088           1 MKILVTGGAGFIGSNFVRYILNKHPDDHVVNLDKLTYAGNLENLADVEDSPRYRFVQGDICDRELVDRLFKEYQPDAVVH   80 (340)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             93799657515778999999960997528997523315778788864069971588545547999999997448875998


Q ss_pred             CCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             8634454322332210242012221100011223333--3344553211135755--44211112222111012456666
Q gi|254780921|r   57 PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI--PCIYISTDYVFDGLSR--TPIDEFSPTNPLNIYGKSKLAGE  132 (290)
Q Consensus        57 ~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~--~~I~iSS~~Vy~g~~~--~p~~E~d~~~P~~~Yg~sK~~~E  132 (290)
                      +||.|.||++-.+|+.-.++|+.||.+|+|++++...  ||+|||||.||+....  ..++|++|.+|.|+|+.||++++
T Consensus        81 fAAESHVDRSI~~P~~Fi~TNv~GT~~LLEaar~~~~~frf~HISTDEVYG~l~~~~~~FtE~tp~~PsSPYSASKAasD  160 (340)
T COG1088          81 FAAESHVDRSIDGPAPFIQTNVVGTYTLLEAARKYWGKFRFHHISTDEVYGDLGLDDDAFTETTPYNPSSPYSASKAASD  160 (340)
T ss_pred             ECHHCCCCCCCCCHHHHHHCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             11001332233570553400028799999999984666207994152102566678887544799999997404455678


Q ss_pred             HHHCCCCC----CCCCCCCCCCEECCC--CCCCCEEECCCCCCCCEEECCC--CCCCCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             53101222----322355542000368--6320002011246652153045--545445223689999999984420244
Q gi|254780921|r  133 EKVASYTN----NYVILRTAWVYSIFG--SNFLLSMLRLAKERREISVVCD--QFGTPTSALQIARAIIQIAHNLIENSD  204 (290)
Q Consensus       133 ~~v~~~~~----~~~IlR~~~vyG~~~--~~~v~~~l~~~~~~~~i~~~~d--~~~~p~~v~D~a~~i~~~~~~~~~~~~  204 (290)
                      .+++++..    +.+|.|.++-|||+.  ..+++.++..+..++++.+++|  |.|.-+||+|-++++..++++...   
T Consensus       161 ~lVray~~TYglp~~ItrcSNNYGPyqfpEKlIP~~I~nal~g~~lpvYGdG~~iRDWl~VeDh~~ai~~Vl~kg~~---  237 (340)
T COG1088         161 LLVRAYVRTYGLPATITRCSNNYGPYQFPEKLIPLMIINALLGKPLPVYGDGLQIRDWLYVEDHCRAIDLVLTKGKI---  237 (340)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEECCCCCEEEEEEEHHHHHHHHHHHHCCCC---
T ss_conf             99999998719966984477776887671556679999997399985436985402058717578899999956867---


Q ss_pred             CCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCCCCCCC---CCCCCHHHHHHHHCCCCC-CHH
Q ss_conf             3344313762386667889999999999997279800057628588087689975---110086899996178999-989
Q gi|254780921|r  205 TSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPA---YSCLDCSKLANTHNIRIS-TWK  280 (290)
Q Consensus       205 ~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP~---~~~Ld~~K~~~~lg~~~~-~~~  280 (290)
                         ..+||++|+.+. +-.|+.+.|+..+.+......++       +.-...||.   ...+|.+|+++.|||.|. +|+
T Consensus       238 ---GE~YNIgg~~E~-~Nlevv~~i~~~l~~~~~~~~~l-------i~~V~DRpGHD~RYaid~~Ki~~eLgW~P~~~fe  306 (340)
T COG1088         238 ---GETYNIGGGNER-TNLEVVKTICELLGKDKPDYRDL-------ITFVEDRPGHDRRYAIDASKIKRELGWRPQETFE  306 (340)
T ss_pred             ---CCEEEECCCCCC-HHHHHHHHHHHHHCCCCCCHHHH-------EEECCCCCCCCCCEEECHHHHHHHCCCCCCCCHH
T ss_conf             ---766871787520-07999999999867665110412-------4761678997501010667776542988678888


Q ss_pred             HHHHHHHH
Q ss_conf             99999997
Q gi|254780921|r  281 EGVRNILV  288 (290)
Q Consensus       281 e~i~~~i~  288 (290)
                      +||++.++
T Consensus       307 ~GlrkTv~  314 (340)
T COG1088         307 TGLRKTVD  314 (340)
T ss_pred             HHHHHHHH
T ss_conf             89999999


No 13 
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional
Probab=100.00  E-value=0  Score=294.82  Aligned_cols=270  Identities=19%  Similarity=0.201  Sum_probs=197.1

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCC-EEEEECHH----------HCCCCC---HHH-HHHHHHH---CCCCEEEECCCCCCC
Q ss_conf             999978897889999999-6498-59996136----------708789---999-9999975---599899978634454
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDV-EIIRVGRP----------DIDLLK---PKD-FASFFLS---FSPDVIINPAAYTAV   63 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~-~v~~~~r~----------~~D~~~---~~~-~~~~l~~---~~pd~Vih~Aa~~~~   63 (290)
                      ||||||+||||++|++.| .+|+ +|+.++.-          ++|+.|   .+. +..++..   .++|+|+|+||.+.+
T Consensus         2 ILVTGgaGFIGS~l~~~L~~~G~~~V~~~Dnl~~~~~~~~l~~~~~~d~~~~~~~~~~~~~~~~~~~id~V~Hlaa~~~~   81 (308)
T PRK11150          2 IIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDLDIADYMDKEDFLAQIMAGDDFGDIEAIFHEGACSST   81 (308)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCHHCCHHHHHHHHHHCCCCCCCCEEEECCCCCCC
T ss_conf             99940597999999999997799809999789997313012356310120389999998611345787689999866666


Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCC---
Q ss_conf             32233221024201222110001122333333445532111357554421111222211101245666653101222---
Q gi|254780921|r   64 DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTN---  140 (290)
Q Consensus        64 ~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~---  140 (290)
                      .  +.++...+..|+.++.+|+++|.+.++++||.||++||++....|..|+++++|.|+||.||+++|++++.+..   
T Consensus        82 ~--~~~~~~~~~~n~~~t~nll~~~~~~~~~~i~aSSs~vYG~~~~~~~~E~~~~~P~s~Yg~sK~~~E~~~~~~~~~~~  159 (308)
T PRK11150         82 T--EWDGKYMMDNNYQYSKELLHYCLEREIPFLYASSAATYGGRTSDFIEEREYEKPLNVYGYSKFLFDEYVRQILPEAN  159 (308)
T ss_pred             C--CCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             4--55651132149999999999999749988995475640898889865688899868767609999999999999839


Q ss_pred             -CCCCCCCCCCEECCCCC------CCCEEECCCCCCCCEEEC-CC--CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             -32235554200036863------200020112466521530-45--545445223689999999984420244334431
Q gi|254780921|r  141 -NYVILRTAWVYSIFGSN------FLLSMLRLAKERREISVV-CD--QFGTPTSALQIARAIIQIAHNLIENSDTSLRGI  210 (290)
Q Consensus       141 -~~~IlR~~~vyG~~~~~------~v~~~l~~~~~~~~i~~~-~d--~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Gi  210 (290)
                       +.+++|+.+||||+...      ++..+.+.+.+++++.++ ++  |.|+.+||+|+++++..+++.       ...|+
T Consensus       160 ~~~~~lR~fnvYGP~~~~~~~~~~v~~~~~~~~~~g~~~~~~~G~g~~~RDfiyV~Dv~~a~~~~~~~-------~~~gv  232 (308)
T PRK11150        160 SQICGFRYFNVYGPREGHKGSMASVAFHLNNQLNNGENPKLFEGSENFKRDFVYVGDVAAVNLWFLEN-------GVSGI  232 (308)
T ss_pred             CCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCCEEECCCCCEEEEEEEHHHHHHHHHHHHHC-------CCCCE
T ss_conf             98289876237895978888732079999999977999747539998788457789999999999856-------99874


Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCCCCCCCCCCCCHHHHHHHHCCCCC-CHHHHHHHHHH
Q ss_conf             3762386667889999999999997279800057628588087689975110086899996178999-98999999997
Q gi|254780921|r  211 FHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRIS-TWKEGVRNILV  288 (290)
Q Consensus       211 yn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP~~~~Ld~~K~~~~lg~~~~-~~~e~i~~~i~  288 (290)
                      ||++++ ..+|..|+++.|.+...   .  ..+..++..+. .....+.++..|++|+++.++|+|. +++|||+++++
T Consensus       233 ~NiGsg-~~~si~el~~~i~~~~g---~--~~i~~i~~p~~-~~~~~~~~~~aDisK~~~lg~~~p~~sleeGl~~tv~  304 (308)
T PRK11150        233 FNLGTG-RAESFQAVADAVLAYHK---K--GEIEYIPFPDK-LKGRYQAFTQADLTKLRAAGYDKPFKTVAEGVTEYMA  304 (308)
T ss_pred             EEECCC-CCEEHHHHHHHHHHHHC---C--CCCEECCCCCC-CCCCCCEEEECCHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             998799-96979999999999849---8--87124268544-5777751112569999982589998799999999999


No 14 
>TIGR03466 HpnA hopanoid-associated sugar epimerase. The sequences in this family are members of the pfam01370 superfamily of NAD-dependent epimerases and dehydratases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene.
Probab=100.00  E-value=0  Score=293.20  Aligned_cols=271  Identities=16%  Similarity=0.152  Sum_probs=197.0

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------CCCCCHHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             94999978897889999999-6498599961367---------------0878999999999755998999786344543
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------IDLLKPKDFASFFLSFSPDVIINPAAYTAVD   64 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~   64 (290)
                      ||||||||+||||++|++.| .+|++|.++.|..               .|++|.+.+++.++.+  |+||||||.... 
T Consensus         1 MriLVTGgtGfiG~~l~~~L~~~G~~V~~l~r~~~~~~~~~~~~~~~~~gDl~d~~~~~~~~~~~--d~ViH~Aa~~~~-   77 (328)
T TIGR03466         1 MKVLVTGATGFVGSAVVRLLLERGEEVRVLVRPTSDRRNLEGLDVEIVEGDLRDPASLRKALAGC--RALFHVAADYRL-   77 (328)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHCCCCCEEEEEECCCHHHHHHHHHCC--CEEEEECCCCCC-
T ss_conf             94999867779999999999978498999989998655652179779982079999999997178--589761342344-


Q ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCC-CCCCCCCCCCCC---CCCHHHHHHHHHHHCCCC
Q ss_conf             22332210242012221100011223333-3344553211135755-442111122221---110124566665310122
Q gi|254780921|r   65 KAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSR-TPIDEFSPTNPL---NIYGKSKLAGEEKVASYT  139 (290)
Q Consensus        65 ~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~-~p~~E~d~~~P~---~~Yg~sK~~~E~~v~~~~  139 (290)
                       ...+|...+++|+.||.+|+++|++.++ |+||+||.+||+...+ .|.+|+.+..|.   ++|+.||+++|++++++.
T Consensus        78 -~~~~~~~~~~~Nv~gt~nll~aa~~~~v~r~V~~SS~~v~g~~~~~~~~~E~~p~~~~~~~~~Y~~sK~~aE~~~~~~~  156 (328)
T TIGR03466        78 -WAPDPEEMYRANVEGTRNLLRAALEAGVERVVYTSSVATLGVPGDGTPADETTPSSLEKMIGHYKRSKFLAEEAALRMI  156 (328)
T ss_pred             -CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             -6799899999999999999999997298743156335785578888740256765456665778899999999999999


Q ss_pred             C----CCCCCCCCCCEECCCCCCC--CEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEE
Q ss_conf             2----3223555420003686320--002011246652153045545445223689999999984420244334431376
Q gi|254780921|r  140 N----NYVILRTAWVYSIFGSNFL--LSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHM  213 (290)
Q Consensus       140 ~----~~~IlR~~~vyG~~~~~~v--~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~  213 (290)
                      .    +.+|+|++.+|||++....  ..++..+..++ +..+.+.-.+++|++|+|+++..++++...      ...||+
T Consensus       157 ~~~gl~~~ilRp~~v~Gp~d~~~~~~~~~i~~~~~~~-~p~~~~~g~~~v~V~Dva~a~~~a~~~~~~------g~~y~~  229 (328)
T TIGR03466       157 AEKGLPVVIVNPSTPIGPRDIKPTPTGRIIVDFLRGK-MPAYVDTGLNLVHVDDVAEGHLLALERGRI------GERYIL  229 (328)
T ss_pred             HHCCCCEEEECCCCEECCCCCCCCCHHHHHHHHHCCC-CCEEECCCCEEEEEHHHHHHHHHHHHCCCC------CCEEEE
T ss_conf             9729975997778568899888876699999997599-976755871899838999999999757998------987997


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHH---------H-HCCCC-CCCC-----------CCCCCHHHHHHH
Q ss_conf             238666788999999999999727980005762858---------8-08768-9975-----------110086899996
Q gi|254780921|r  214 TADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTK---------Q-YPTKA-HRPA-----------YSCLDCSKLANT  271 (290)
Q Consensus       214 ~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~---------~-~~~~a-~RP~-----------~~~Ld~~K~~~~  271 (290)
                      ++  +.+|+.|+++.|.+...    .......++..         + +.... +.|.           +..+|++|+++.
T Consensus       230 ~~--~~~t~~e~~~~i~~~~g----~~~~~~~~p~~~~~~~~~~~e~~~~~~~~~p~~~~~~~~~~~~~~~~d~~kA~~~  303 (328)
T TIGR03466       230 GG--ENLTLAQILAKLAEITG----RKAPRVKLPRWLLLPVAWGAEALARLTGKEPRVTLDGVRMAKKKMYFSSDKAVRE  303 (328)
T ss_pred             CC--CCCCHHHHHHHHHHHHC----CCCCCEECCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCCCCHHHHHHH
T ss_conf             99--97109999999999858----9987110573788888999999887419998764677764156631177999998


Q ss_pred             HCCCCCCHHHHHHHHHH
Q ss_conf             17899998999999997
Q gi|254780921|r  272 HNIRISTWKEGVRNILV  288 (290)
Q Consensus       272 lg~~~~~~~e~i~~~i~  288 (290)
                      |||+|++++|||+++++
T Consensus       304 LG~~p~~~eegl~~tv~  320 (328)
T TIGR03466       304 LGYRQRPAREALRDAVE  320 (328)
T ss_pred             HCCCCCCHHHHHHHHHH
T ss_conf             29997889999999999


No 15 
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; InterPro: IPR011912   Lipopolysaccharides (LPS) are glycolipids that consitutes the outer monolayer of the outer membranes of most Gram-negative bacteria . They consist of lipid A (endotoxin) which anchors LPS to the outer membrane, a non-repeating core oligosachharide, and an immunogenic O-antigen repeat polymer, which is an oligosaccharide of 1-40 units that variesbetween different strains of bacteria. Although the O-antigen and most of the core domain are not necessary for growth in the lab, they appear to help bacteria resist environmental stresses including the complement system and antibiotics.   This family consists of examples of ADP-L-glycero-D-mannoheptose-6-epimerase, an enzyme involved in biosynthesis of the inner core of LPS in Gram-negative bacteria . This enzyme is homologous to UDP-glucose 4-epimerase (IPR005886 from INTERPRO) and belongs to the NAD dependent epimerase/dehydratase family. It participates in the biosynthetic pathway leading to incorporation of heptose, a conserved sugar, into the core region of LPS, performing the reaction shown below: ADP-D-glycero-D-manno-heptose = ADP-L-glycero-D-manno-heptose It is a homopentameric enzyme with each monomer composed of two domains: an N-terminal modified Rossman fold domain for NADP binding, and a C-terminal substrate binding domain.; GO: 0008712 ADP-glyceromanno-heptose 6-epimerase activity, 0050661 NADP binding, 0005975 carbohydrate metabolic process.
Probab=100.00  E-value=0  Score=282.94  Aligned_cols=277  Identities=19%  Similarity=0.248  Sum_probs=209.8

Q ss_pred             EEEECCCCHHHHHHHHHHHCCC---EEEEECH--H-------------H------------CCCCC-HHHHHHHHHH---
Q ss_conf             9999788978899999996498---5999613--6-------------7------------08789-9999999975---
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMCVQDV---EIIRVGR--P-------------D------------IDLLK-PKDFASFFLS---   48 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l~~~~---~v~~~~r--~-------------~------------~D~~~-~~~~~~~l~~---   48 (290)
                      |+||||+|||||+|+..|.+.+   +|+.+|.  +             +            .|..| .+-++.+-+.   
T Consensus         1 IiVTGGAGFIGSNlv~~LN~~gP~~dI~vvD~L~~~~~F~ng~~~slg~~kk~~Nl~~~~I~d~i~k~~~~~~l~~~~~~   80 (353)
T TIGR02197         1 IIVTGGAGFIGSNLVKALNERGPETDILVVDNLRDDATFENGNPQSLGHFKKFLNLADLEIADYIDKDDLLDRLEKGSEA   80 (353)
T ss_pred             CEECCCCCHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCHHHCCCCCCCCCCHHHCCCCCHHHHHHHHHCCCC
T ss_conf             95506763689999999964389542888740787552467774322342443255541121335885469999830201


Q ss_pred             -CCCCEEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC------CC
Q ss_conf             -59989997863445432233221024201222110001122333333445532111357554421111222------21
Q gi|254780921|r   49 -FSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN------PL  121 (290)
Q Consensus        49 -~~pd~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~------P~  121 (290)
                       .++|+|||-+|+|+  +.|.|-+..++.|...+..|+++|.+.++++||.||++|| |....+++|+....      |+
T Consensus        81 ~~~~~avfH~GAcS~--TTe~D~~~~m~nN~~ys~~Ll~~c~~~~~~~IYASSAatY-G~~~~~f~~~~~~e~L~kLrPl  157 (353)
T TIGR02197        81 LGKIEAVFHQGACSD--TTETDGEYMMENNYQYSKRLLDWCAEKGVPFIYASSAATY-GDGEAGFREDRELEELQKLRPL  157 (353)
T ss_pred             CCCCCEEEECCHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCHHHC-CCCCCCCCCCCCHHHHHHCCCC
T ss_conf             388337997331253--5886279999889999999999999648986885031210-7687777766565889751878


Q ss_pred             CCCHHHHHHHHHHHCCC-----CCC-CCC-CCCCCCEECCCC------CCCCEEECCCCCCCCEEEC--C-C------CC
Q ss_conf             11012456666531012-----223-223-555420003686------3200020112466521530--4-5------54
Q gi|254780921|r  122 NIYGKSKLAGEEKVASY-----TNN-YVI-LRTAWVYSIFGS------NFLLSMLRLAKERREISVV--C-D------QF  179 (290)
Q Consensus       122 ~~Yg~sK~~~E~~v~~~-----~~~-~~I-lR~~~vyG~~~~------~~v~~~l~~~~~~~~i~~~--~-d------~~  179 (290)
                      |.||-||.+-+++++..     ..+ .++ ||..+||||+..      +++..+...+..++.+.+|  + +      |.
T Consensus       158 N~YGySK~lFD~~v~~~~~~~~~~~~q~~GLrYFNVYGP~E~HKG~MASv~f~~~~q~~~~~~v~LF~~~~~~~~dGeQ~  237 (353)
T TIGR02197       158 NVYGYSKFLFDQYVRRRVLPGEALSAQVVGLRYFNVYGPREYHKGKMASVAFHLFNQIKAGGNVKLFKSHKEGFKDGEQL  237 (353)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
T ss_conf             86122167898999998601247986424102113468886754436999999888997378820235668589887811


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCC---------CHHEEECCHHH
Q ss_conf             544522368999999998442024433443137623866678899999999999972798---------00057628588
Q gi|254780921|r  180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP---------YSKVYRIFTKQ  250 (290)
Q Consensus       180 ~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~---------~~~i~~~~~~~  250 (290)
                      |+.|||+||+++..-++++      ...+||||+|. +-.-|..|++..+++.+......         ...|+.++..+
T Consensus       238 RDFVYV~DV~~~n~~~~~~------~~~SGifN~Gt-G~ArsF~dla~a~~~~~~~~~~~~LSl~~lv~~~~i~Yi~~Pe  310 (353)
T TIGR02197       238 RDFVYVKDVVKVNLWLLEN------PSKSGIFNVGT-GKARSFNDLADAVFKALGTNKGEPLSLKELVEDFKIEYIDMPE  310 (353)
T ss_pred             CCCEEHHHHHHHHHHHHHC------CCCCEEEECCC-CCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCEECCCH
T ss_conf             0115527699999999848------89841564477-8886689999999998731468885779887306720102835


Q ss_pred             HCCCCCCCCCCCCCHHHHHHHHCCCCC-CHHHHHHHHHHHC
Q ss_conf             087689975110086899996178999-9899999999719
Q gi|254780921|r  251 YPTKAHRPAYSCLDCSKLANTHNIRIS-TWKEGVRNILVNI  290 (290)
Q Consensus       251 ~~~~a~RP~~~~Ld~~K~~~~lg~~~~-~~~e~i~~~i~~l  290 (290)
                       ..+.+-..++.-|.+|+|+.+..+|. +++|||++|+++|
T Consensus       311 -~lrg~YQ~fTqAd~~~lr~aGy~~~~~~LeeGV~dY~~~~  350 (353)
T TIGR02197       311 -ALRGKYQYFTQADIDKLREAGYYKPFTTLEEGVKDYVQWL  350 (353)
T ss_pred             -HHHHCCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHH
T ss_conf             -7400057401664899997327876734889999999998


No 16 
>KOG0747 consensus
Probab=100.00  E-value=2.8e-45  Score=274.07  Aligned_cols=274  Identities=23%  Similarity=0.263  Sum_probs=221.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHCC---CEEEEECHH---------------------HCCCCCHHHHHHHHHHCCCCEEEEC
Q ss_conf             4999978897889999999649---859996136---------------------7087899999999975599899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQD---VEIIRVGRP---------------------DIDLLKPKDFASFFLSFSPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~~---~~v~~~~r~---------------------~~D~~~~~~~~~~l~~~~pd~Vih~   57 (290)
                      ++|||||.||||++..+.+...   ++.+.++.-                     +.|+.+...+.-++.....|.|||+
T Consensus         8 ~vlItgg~gfi~Sn~~~~~~~~~p~~~~v~idkL~~~s~~~~l~~~~n~p~ykfv~~di~~~~~~~~~~~~~~id~vihf   87 (331)
T KOG0747           8 NVLITGGAGFIGSNFINYLVDKYPDYKFVNLDKLDYCSNLKNLEPVRNSPNYKFVEGDIADADLVLYLFETEEIDTVIHF   87 (331)
T ss_pred             EEEEECCCCCCCHHHHHHCCCCCCCCCEEEEECCCCCCCHHHHHHHCCCCCCEEEECHHCCCHHHHHHHCCCCHHHHHHH
T ss_conf             08985476753113455334679987778762000024313544312588716860301050998765336715777767


Q ss_pred             CCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC-C-CCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCHHHHHHHHHH
Q ss_conf             63445432233221024201222110001122333-3-33445532111357554421-111222211101245666653
Q gi|254780921|r   58 AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIG-I-PCIYISTDYVFDGLSRTPID-EFSPTNPLNIYGKSKLAGEEK  134 (290)
Q Consensus        58 Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~-~-~~I~iSS~~Vy~g~~~~p~~-E~d~~~P~~~Yg~sK~~~E~~  134 (290)
                      ||.+.+|.|-.+|-...+.|+.++..|+++++..| + +|||+||+.|||+..+.... |.+.++|.|+|+.+|+++|+.
T Consensus        88 aa~t~vd~s~~~~~~~~~nnil~t~~Lle~~~~sg~i~~fvhvSTdeVYGds~~~~~~~E~s~~nPtnpyAasKaAaE~~  167 (331)
T KOG0747          88 AAQTHVDRSFGDSFEFTKNNILSTHVLLEAVRVSGNIRRFVHVSTDEVYGDSDEDAVVGEASLLNPTNPYAASKAAAEML  167 (331)
T ss_pred             HHHHHHHHHHCCHHHHHCCCCHHHHHHHHHHHHCCCEEEEEEECCCCEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             76641466507658774576034577999988504734799964640234766445633225689998037889999999


Q ss_pred             HCCCCCCC----CCCCCCCCEECCCC--CCCCEEECCCCCCCCEEECCC--CCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             10122232----23555420003686--320002011246652153045--54544522368999999998442024433
Q gi|254780921|r  135 VASYTNNY----VILRTAWVYSIFGS--NFLLSMLRLAKERREISVVCD--QFGTPTSALQIARAIIQIAHNLIENSDTS  206 (290)
Q Consensus       135 v~~~~~~~----~IlR~~~vyG~~~~--~~v~~~l~~~~~~~~i~~~~d--~~~~p~~v~D~a~~i~~~~~~~~~~~~~~  206 (290)
                      ++.+...|    +|+|+++||||+.-  ..+.+++.++..+++..+-+|  |.++.+|++|+++++.++.++.      .
T Consensus       168 v~Sy~~sy~lpvv~~R~nnVYGP~q~~~klipkFi~l~~~~~~~~i~g~g~~~rs~l~veD~~ea~~~v~~Kg------~  241 (331)
T KOG0747         168 VRSYGRSYGLPVVTTRMNNVYGPNQYPEKLIPKFIKLAMRGKEYPIHGDGLQTRSYLYVEDVSEAFKAVLEKG------E  241 (331)
T ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCEECCCCCCEEEEEHHHHHHHHHHHHHCC------C
T ss_conf             9998760497179994157338885716776889999971897642157410122576999999999998457------8


Q ss_pred             CCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHC-CCCCCCCC---CCCCHHHHHHHHCCCCC-CHHH
Q ss_conf             4431376238666788999999999999727980005762858808-76899751---10086899996178999-9899
Q gi|254780921|r  207 LRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYP-TKAHRPAY---SCLDCSKLANTHNIRIS-TWKE  281 (290)
Q Consensus       207 ~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~-~~a~RP~~---~~Ld~~K~~~~lg~~~~-~~~e  281 (290)
                      ...|||++.+ .+.+..|+++.|...+.....   ++.+   +.++ ..-.||.+   ..++++|++ .|||+|+ +|++
T Consensus       242 ~geIYNIgtd-~e~~~~~l~k~i~eli~~~~~---~~~~---~p~~~~v~dRp~nd~Ry~~~~eKik-~LGw~~~~p~~e  313 (331)
T KOG0747         242 LGEIYNIGTD-DEMRVIDLAKDICELFEKRLP---NIDT---EPFIFFVEDRPYNDLRYFLDDEKIK-KLGWRPTTPWEE  313 (331)
T ss_pred             CCCEEECCCC-CHHHHHHHHHHHHHHHHHHCC---CCCC---CCCCEECCCCCCCCCCCCCCHHHHH-HCCCCCCCCHHH
T ss_conf             5623641683-076699999999999997546---8888---8863315888764201000588897-538721576788


Q ss_pred             HHHHHHHH
Q ss_conf             99999971
Q gi|254780921|r  282 GVRNILVN  289 (290)
Q Consensus       282 ~i~~~i~~  289 (290)
                      ||+.+|+.
T Consensus       314 GLrktie~  321 (331)
T KOG0747         314 GLRKTIEW  321 (331)
T ss_pred             HHHHHHHH
T ss_conf             89999999


No 17 
>pfam02719 Polysacc_synt_2 Polysaccharide biosynthesis protein. This is a family of diverse bacterial polysaccharide biosynthesis proteins including the CapD protein, WalL protein mannosyl-transferase and several putative epimerases (e.g. WbiI).
Probab=100.00  E-value=5.6e-45  Score=272.33  Aligned_cols=205  Identities=23%  Similarity=0.259  Sum_probs=173.0

Q ss_pred             EEEECCCCHHHHHHHHHH-HCC-CEEEEECHH-----------------------HCCCCCHHHHHHHHHHCCCCEEEEC
Q ss_conf             999978897889999999-649-859996136-----------------------7087899999999975599899978
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQD-VEIIRVGRP-----------------------DIDLLKPKDFASFFLSFSPDVIINP   57 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~-~~v~~~~r~-----------------------~~D~~~~~~~~~~l~~~~pd~Vih~   57 (290)
                      ||||||+||||++|++.| ..+ +.++.+++.                       ..|++|.+.+.++++..+||+|||+
T Consensus         1 ILVTGGaGFIGS~Lv~~Ll~~g~~~v~v~d~~~~~~~~~~~~l~~~~~~~~~~~~~~DI~D~~~l~~~~~~~~~D~V~Hl   80 (280)
T pfam02719         1 VLVTGGGGSIGSELCRQILKFNPKKIILFSRDEFKLYEIEQELREEYNDPKLRFFIGDVRDRERLERAMEEYGVDTVFHA   80 (280)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEC
T ss_conf             79974886799999999996899889999088742778999988626789838998116898999999875499999981


Q ss_pred             CCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             634454322332210242012221100011223333-3344553211135755442111122221110124566665310
Q gi|254780921|r   58 AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVA  136 (290)
Q Consensus        58 Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~  136 (290)
                      ||.+.|+.++.+|..++++|+.||.+|+++|++.++ ++||+||+..              ++|.|+||.||+++|++++
T Consensus        81 AA~~~V~~s~~~P~~~~~~Nv~gT~nlLe~a~~~~vk~~v~~STd~a--------------~~P~s~Yg~sK~~~E~l~~  146 (280)
T pfam02719        81 AALKHVPLVEYNPMEAIKTNVLGTENVAEAAIENGVEKFVLISTDKA--------------VNPTNVMGATKRLAEKLFQ  146 (280)
T ss_pred             HHHCCCCCHHHCHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCC--------------CCCCCCCCCCHHHHHHHHH
T ss_conf             03116532766999999887277799998888539624551476644--------------5699845423777899999


Q ss_pred             CCCC-------CCCCCCCCCCEECCCCCCCCEEECCCCCCCCEEEC-CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             1222-------32235554200036863200020112466521530-455454452236899999999844202443344
Q gi|254780921|r  137 SYTN-------NYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV-CDQFGTPTSALQIARAIIQIAHNLIENSDTSLR  208 (290)
Q Consensus       137 ~~~~-------~~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~-~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~  208 (290)
                      .+..       ++.++|+++||||++. +++.+++++.+++++++. ++|.|+.+||+|++++++.+++...      ..
T Consensus       147 ~y~~~~~~~~~~~~~lR~fNVyGprgs-VIp~Fi~~~~~~~pi~I~dg~qtRdf~~V~D~v~~~l~a~~~~~------~g  219 (280)
T pfam02719       147 AANRESGSGKTRFSAVRFGNVLGSRGS-VIPLFKKQIAEGGPVTVTHPDMTRFFMTIPEAVQLVLQAGAMGK------GG  219 (280)
T ss_pred             HHHHHHCCCCCEEEEEEECCEECCCCC-CHHHHHHHHHCCCCEEECCCCCEEEEEEHHHHHHHHHHHHHHCC------CC
T ss_conf             999971999854898754450289977-09999999985998656599843855879999999999997287------78


Q ss_pred             CCEEEECCCCCCCHHHHHHHH
Q ss_conf             313762386667889999999
Q gi|254780921|r  209 GIFHMTADGGPVSWADFAEYI  229 (290)
Q Consensus       209 Giyn~~~~~~~~s~~e~a~~I  229 (290)
                      .|||+++ +..+|..|+|+.+
T Consensus       220 eifnig~-g~~~sI~dLAk~i  239 (280)
T pfam02719       220 EIFVLDM-GEPVKIVDLAKAM  239 (280)
T ss_pred             CEEECCC-CCCEEHHHHHHHH
T ss_conf             6788889-9866999999975


No 18 
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: IPR013445    This entry contains CDP-glucose 4,6-dehydratases from a variety of Gram-negative and Gram-positive bacteria. Members are typically encoded next to a gene that encodes a glucose-1-phosphate cytidylyltransferase, which produces the substrate CDP-D-glucose. This is used by the proteins in this entry to produce CDP-4-keto-6-deoxyglucose..
Probab=100.00  E-value=8.1e-44  Score=265.85  Aligned_cols=275  Identities=18%  Similarity=0.217  Sum_probs=220.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CCEEEEECHH--------------------------HCCCCCHHHHHHHHHHCCCCEE
Q ss_conf             499997889788999999964-9859996136--------------------------7087899999999975599899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRP--------------------------DIDLLKPKDFASFFLSFSPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~--------------------------~~D~~~~~~~~~~l~~~~pd~V   54 (290)
                      ||||||.|||=||-|.--|.+ |-+|.|++-+                          -.||+|.+++++++++++||+|
T Consensus         6 kVl~TGHTGFKGSWL~lWL~~lGA~V~GYSL~P~t~PnlFe~l~l~~~~~~~Wyf~~~~gDIrD~~~L~~~~~~~~PeIv   85 (361)
T TIGR02622         6 KVLITGHTGFKGSWLSLWLLELGAEVAGYSLDPPTSPNLFELLNLAKKIKDSWYFSSIFGDIRDAAKLEKAIAEFKPEIV   85 (361)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCEEEEEEEECCCCHHHHHHHHHHCCCCEE
T ss_conf             78984578642558999998479679897168878840555752542432350554233032327899999997289898


Q ss_pred             EECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC-CC-CCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             97863445432233221024201222110001122333-33-3445532111357-554421111222211101245666
Q gi|254780921|r   55 INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIG-IP-CIYISTDYVFDGL-SRTPIDEFSPTNPLNIYGKSKLAG  131 (290)
Q Consensus        55 ih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~-~~-~I~iSS~~Vy~g~-~~~p~~E~d~~~P~~~Yg~sK~~~  131 (290)
                      ||+||..-|.+|-.+|..+|++||.||.+|+|+++... ++ +|-|.||-||++. ...+|.|+|+..-.++|+.||.+|
T Consensus        86 FHlAAQPLVr~SY~~P~~Tf~TNVmGT~~lLea~r~~~~~~a~v~vTsDK~Y~N~EW~wgYRE~D~LGGhDPYS~SKAcA  165 (361)
T TIGR02622        86 FHLAAQPLVRKSYADPLETFETNVMGTVNLLEAIRAIKSVKAVVLVTSDKVYENKEWVWGYRETDPLGGHDPYSSSKACA  165 (361)
T ss_pred             EHHHHHHHHHHHHHCHHHHEEEHHHHHHHHHHHHHHCCCCEEEEEEECCEEECCCCCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             33354278898673202022200322257788997469956999861672330787887523247887716775328999


Q ss_pred             HHHHCCCCC----------CCC----CCCCCCCEECCC---CCCCCEEECCCCCCCCEEECCCCCCCCC------CHHHH
Q ss_conf             653101222----------322----355542000368---6320002011246652153045545445------22368
Q gi|254780921|r  132 EEKVASYTN----------NYV----ILRTAWVYSIFG---SNFLLSMLRLAKERREISVVCDQFGTPT------SALQI  188 (290)
Q Consensus       132 E~~v~~~~~----------~~~----IlR~~~vyG~~~---~~~v~~~l~~~~~~~~i~~~~d~~~~p~------~v~D~  188 (290)
                      |.++..+..          ++.    +.|.|+|.|.++   +..|+.+++++.+++.|.+     |||.      ||-|=
T Consensus       166 ELv~~syR~SF~~~~~f~~~h~~~iAsaRAGNVIGGGDWs~DRliPD~irA~~~n~~v~I-----RnP~A~RPWQHVLEP  240 (361)
T TIGR02622       166 ELVIASYRSSFFGEANFQSTHGIKIASARAGNVIGGGDWSEDRLIPDVIRALSSNKIVTI-----RNPDATRPWQHVLEP  240 (361)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCCCCHHHCCHHHHHHHHHCCCEEEE-----ECCCCCCCCCCCCCC
T ss_conf             999999986068888755468636899860640476750010417899996426873774-----377885897430145


Q ss_pred             HHHHHHHHHHHHHCCCCCCCC-CEEEECCC-CCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCCCCCCCCCCCCHH
Q ss_conf             999999998442024433443-13762386-6678899999999999972798000576285880876899751100868
Q gi|254780921|r  189 ARAIIQIAHNLIENSDTSLRG-IFHMTADG-GPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCS  266 (290)
Q Consensus       189 a~~i~~~~~~~~~~~~~~~~G-iyn~~~~~-~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP~~~~Ld~~  266 (290)
                      -.+-+.|.+++..+.. ...| -||+|.+. +..+-.++   |........+....+......+-|..|   ....||++
T Consensus       241 L~GYLlLAekL~~~~~-~~~~eafNFGP~~~~~~~v~~~---v~~~~~~~~g~~~~~~~~~~~~~PhEA---~lL~Ld~~  313 (361)
T TIGR02622       241 LSGYLLLAEKLFEGQA-ELAGEAFNFGPEASENARVVEL---VADALELWPGDDAEWEKQSDNNHPHEA---NLLKLDSD  313 (361)
T ss_pred             CCHHHHHHHHHHCCCC-CCCCCCCCCCCCCCCCCCHHHH---HHHHHHHCCCCCEEEECCCCCCCCCCC---CCCCCCHH
T ss_conf             1107999999852873-4124554558887776555999---999999668983164067789887235---66775879


Q ss_pred             HHHHHHCCCCC-CHHHHHHHHHH
Q ss_conf             99996178999-98999999997
Q gi|254780921|r  267 KLANTHNIRIS-TWKEGVRNILV  288 (290)
Q Consensus       267 K~~~~lg~~~~-~~~e~i~~~i~  288 (290)
                      |++..|||+|+ +++|+|+.+++
T Consensus       314 KA~~~LgW~P~w~~~~~v~~T~~  336 (361)
T TIGR02622       314 KARALLGWQPRWGLEEAVSRTVE  336 (361)
T ss_pred             HHHHHCCCCCCCCHHHHHHHHHH
T ss_conf             99843188655458899999998


No 19 
>pfam01370 Epimerase NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions.
Probab=100.00  E-value=1.4e-44  Score=270.26  Aligned_cols=205  Identities=28%  Similarity=0.402  Sum_probs=175.5

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------HCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             999978897889999999-649859996136----------------708789999999997559989997863445432
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------DIDLLKPKDFASFFLSFSPDVIINPAAYTAVDK   65 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~   65 (290)
                      ||||||+||||++|++.| .++++|++++|.                ..|++|.+.++++++..+||+||||||.+..+.
T Consensus         1 ILItGasGfiG~~l~~~L~~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~dl~~~~~~~~~~~~~~~D~VihlAa~~~~~~   80 (235)
T pfam01370         1 ILVTGGTGFIGSALVRRLLQEGYEVIVLGRRRRSESLNTGRIRFRFHEGDLTDPDALERLLAEVQPDAVIHLAAQSGVGA   80 (235)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCEEEEEECCCHHHHHHHHHHCCCCEEEECCCCCCCHH
T ss_conf             79972897999999999997879899998997301222114676599965889999999985389989998977478326


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCC----
Q ss_conf             2332210242012221100011223333-33445532111357554421111222211101245666653101222----
Q gi|254780921|r   66 AEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTN----  140 (290)
Q Consensus        66 ~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~----  140 (290)
                      +..+|...++.|+.++.+|+++|.+.++ ++||+||+.||+.....|++|+++++|.++||.+|+++|++++.+..    
T Consensus        81 ~~~~~~~~~~~N~~~t~~ll~~~~~~~~~~~I~~SS~~vYg~~~~~~~~E~~~~~p~~~Y~~sK~~~E~~~~~~~~~~~~  160 (235)
T pfam01370        81 SFEDPAEFIRANVLGTLNLLEAARRAGVKRFVFASSSEVYGDVADPPITEDTPLGPLSPYAAAKLAGERLVLAYARAYGL  160 (235)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             55199999999999999999999983999899925635747999999777778898507999999999999999998488


Q ss_pred             CCCCCCCCCCEECCCC-----CCCCEEECCCCCCC-CEEECCC--CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEE
Q ss_conf             3223555420003686-----32000201124665-2153045--54544522368999999998442024433443137
Q gi|254780921|r  141 NYVILRTAWVYSIFGS-----NFLLSMLRLAKERR-EISVVCD--QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFH  212 (290)
Q Consensus       141 ~~~IlR~~~vyG~~~~-----~~v~~~l~~~~~~~-~i~~~~d--~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn  212 (290)
                      +++|+|++.+|||+..     .++..+++.+..++ .+.+++|  |+++.+|++|+++++..++++.      ...|+||
T Consensus       161 ~~~ilR~~~vyGp~~~~~~~~~~i~~~i~~~~~~~~~~~~~g~g~~~r~~i~v~D~~~ai~~~~~~~------~~g~iyN  234 (235)
T pfam01370       161 RAVILRLFNVYGPGDNDTFVTHVIPALIRRILEGKPEILLLGDGTQRRDFLYVDDVARAILLALEHP------DGGEVYN  234 (235)
T ss_pred             CCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCEEECCCCEEECCCCHHHHHHHHHHHHCCC------CCCCCEE
T ss_conf             9865001259889988776214899999999828997277089997891794999999999998189------9999242


Q ss_pred             E
Q ss_conf             6
Q gi|254780921|r  213 M  213 (290)
Q Consensus       213 ~  213 (290)
                      +
T Consensus       235 I  235 (235)
T pfam01370       235 I  235 (235)
T ss_pred             C
T ss_conf             9


No 20 
>pfam01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family. The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones.
Probab=100.00  E-value=1.2e-43  Score=264.96  Aligned_cols=227  Identities=21%  Similarity=0.237  Sum_probs=178.3

Q ss_pred             EEECCCCHHHHHHHHHH-HCCC--EEEEECHH------------------HCCCCCHHHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             99978897889999999-6498--59996136------------------708789999999997559989997863445
Q gi|254780921|r    4 LVIGNNGQIAQSLSSMC-VQDV--EIIRVGRP------------------DIDLLKPKDFASFFLSFSPDVIINPAAYTA   62 (290)
Q Consensus         4 LVtG~~G~iG~~l~~~l-~~~~--~v~~~~r~------------------~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~   62 (290)
                      |||||+||||++|++.| .+|+  +|..+++.                  +.|++|.+.++++++.+  |+|||+||.+.
T Consensus         1 LVTGg~GFIGs~lv~~Ll~~g~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~gDl~d~~~l~~~~~~~--D~V~H~Aa~~~   78 (280)
T pfam01073         1 LVTGGGGFLGRHIVRLLLREGELQEVRVFDLRFSPELLEDFSKLQVITYIEGDVTDKQDLRRALQGS--DVVIHTAAIID   78 (280)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCC--CEEEEECCCCC
T ss_conf             9058675999999999997799757999878898678887322588759991289999999998479--98997212235


Q ss_pred             CCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC-CCCCC---CCCCC--CCCCCCCHHHHHHHHHHH
Q ss_conf             4322332210242012221100011223333-33445532111357-55442---11112--222111012456666531
Q gi|254780921|r   63 VDKAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGL-SRTPI---DEFSP--TNPLNIYGKSKLAGEEKV  135 (290)
Q Consensus        63 ~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~-~~~p~---~E~d~--~~P~~~Yg~sK~~~E~~v  135 (290)
                      +. +..+++..+++|+.||.+|+++|++.|+ +|||+||..||+.. ...++   +|+++  .+|.++|+.||+++|+++
T Consensus        79 ~~-~~~~~~~~~~~Nv~gt~~ll~aa~~~gvkr~V~~SS~~v~g~~~~~~~~~~~~e~~p~~~~~~~~Y~~SK~~aE~~v  157 (280)
T pfam01073        79 VF-GKAYRDTIMKVNVKGTQNVLDACVKAGVRVLVYTSSMEVVGPNSYGQPIVNGDETTPYESTHQDPYPESKALAEKLV  157 (280)
T ss_pred             CC-CCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             55-66799999999999999999999964777079970047876777788756788888788888980288999999999


Q ss_pred             CCCCC---------CCCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCC--CCCCCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             01222---------3223555420003686320002011246652153045--545445223689999999984420244
Q gi|254780921|r  136 ASYTN---------NYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD--QFGTPTSALQIARAIIQIAHNLIENSD  204 (290)
Q Consensus       136 ~~~~~---------~~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d--~~~~p~~v~D~a~~i~~~~~~~~~~~~  204 (290)
                      ++...         ..+|+|+++||||+++.++..+++.+++++.+.+++|  +.++++||+|++++++..++++.....
T Consensus       158 l~a~~~~~~~~~~~~~v~lRp~~vyGp~~~~~~~~~~~~~~~g~~~~~~g~g~~~~~~v~V~Dva~A~vlA~~~l~~~~~  237 (280)
T pfam01073       158 LKANGSTLKNGGRLYTCALRPAGIFGEGDPFLFPFLVRLLKNGLAKFRTGDKNVLSDRVYVGNVAWAHILAARALQDPKK  237 (280)
T ss_pred             HHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             98503344314553168854666538995159999999997599973679999888972787699999999986014566


Q ss_pred             -CCCC-CCEEEECCCCCCCHHHHHHHHHHHH
Q ss_conf             -3344-3137623866678899999999999
Q gi|254780921|r  205 -TSLR-GIFHMTADGGPVSWADFAEYIFWES  233 (290)
Q Consensus       205 -~~~~-Giyn~~~~~~~~s~~e~a~~I~~~~  233 (290)
                       .... .+||++++....|+.||++.+.+.+
T Consensus       238 ~~~~~Ge~y~i~~~~p~~s~~e~~~~~~~al  268 (280)
T pfam01073       238 ASSIAGQFYFISDDTPHNSYDDFNRTLLKAL  268 (280)
T ss_pred             CCCCCCCEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             7788974899779991677999999999980


No 21 
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=100.00  E-value=3.6e-40  Score=245.30  Aligned_cols=275  Identities=23%  Similarity=0.272  Sum_probs=199.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-CCEEEEECHH--------------HCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             9499997889788999999964-9859996136--------------708789999999997559989997863445432
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRP--------------DIDLLKPKDFASFFLSFSPDVIINPAAYTAVDK   65 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~--------------~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~   65 (290)
                      |+|||||++||||++|++.|.+ |++|++++|.              ..|+++.+.+.+.+...+ |+|||+||......
T Consensus         1 ~~iLVtG~tGfiG~~l~~~L~~~g~~V~~~~r~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~-d~vih~aa~~~~~~   79 (314)
T COG0451           1 MRILVTGGAGFIGSHLVERLLAAGHDVRGLDRLRDGLDPLLSGVEFVVLDLTDRDLVDELAKGVP-DAVIHLAAQSSVPD   79 (314)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCEEECCCCCHHHHHHHHCCCC-CEEEECCCCCCCCC
T ss_conf             96999928877799999999858997999917875431124676434225335678998854588-78998886467753


Q ss_pred             CCC-CCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC-CCCCCCCC-CCCCCCCCCHHHHHHHHHHHCCCCC-
Q ss_conf             233-2210242012221100011223333-33445532111357-55442111-1222211101245666653101222-
Q gi|254780921|r   66 AED-EPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGL-SRTPIDEF-SPTNPLNIYGKSKLAGEEKVASYTN-  140 (290)
Q Consensus        66 ~e~-~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~-~~~p~~E~-d~~~P~~~Yg~sK~~~E~~v~~~~~-  140 (290)
                      ... +|...+.+|+.++.+++++|+..++ ++||.||..+|++. ...+++|+ .+..|.++||.+|+++|+.++.+.. 
T Consensus        80 ~~~~~~~~~~~~nv~gt~~ll~aa~~~~~~~~v~~ss~~~~~~~~~~~~~~E~~~~~~p~~~Yg~sK~~~E~~~~~~~~~  159 (314)
T COG0451          80 SNASDPAEFLDVNVDGTLNLLEAARAAGVKRFVFASSVSVVYGDPPPLPIDEDLGPPRPLNPYGVSKLAAEQLLRAYARL  159 (314)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             33214788999999999999999986799879997875012788788887865578888767799999999999997663


Q ss_pred             ---CCCCCCCCCCEECCCCC-----CCCEEECCCCCCCC-EEECC--CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             ---32235554200036863-----20002011246652-15304--554544522368999999998442024433443
Q gi|254780921|r  141 ---NYVILRTAWVYSIFGSN-----FLLSMLRLAKERRE-ISVVC--DQFGTPTSALQIARAIIQIAHNLIENSDTSLRG  209 (290)
Q Consensus       141 ---~~~IlR~~~vyG~~~~~-----~v~~~l~~~~~~~~-i~~~~--d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~G  209 (290)
                         +.+|+|++++|||++..     ++..++..+..+.+ +...+  ++.+..+|++|+++++..++++....       
T Consensus       160 ~~~~~~ilR~~~vyGp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~D~~~~~~~~~~~~~~~-------  232 (314)
T COG0451         160 YGLPVVILRPFNVYGPGDKPDLSSGVVSAFIRQLLKGEPIIVIGGDGSQTRDFVYVDDVADALLLALENPDGG-------  232 (314)
T ss_pred             CCCCEEEEEECEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCCEEEEEEHHHHHHHHHHHHHCCCCC-------
T ss_conf             3995799984637888987774207899999998707885035078862242577999999999997388871-------


Q ss_pred             CEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCCCCCCCCCCCCHHHHHHHHCCCCC-CHHHHHHHHHH
Q ss_conf             13762386667889999999999997279800057628588087689975110086899996178999-98999999997
Q gi|254780921|r  210 IFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRIS-TWKEGVRNILV  288 (290)
Q Consensus       210 iyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP~~~~Ld~~K~~~~lg~~~~-~~~e~i~~~i~  288 (290)
                      +||++++....|..|+++.+.+.+......   +...+.   ...........+|++|.+..+||.|. +++++++++++
T Consensus       233 ~~ni~~~~~~~~~~e~~~~~~~~~~~~~~~---~~~~~~---~~~~~~~~~~~~~~~~~~~~lg~~p~~~~~~~i~~~~~  306 (314)
T COG0451         233 VFNIGSGTAEITVRELAEAVAEAVGSKAPL---IVYIPL---GRRGDLREGKLLDISKARAALGWEPKVSLEEGLADTLE  306 (314)
T ss_pred             EEEECCCCCCCCHHHHHHHHHHHHCCCCCC---CEECCC---CCHHHHCCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             899469877768999999999984887542---010343---22001013432687999997199788998999999999


Q ss_pred             H
Q ss_conf             1
Q gi|254780921|r  289 N  289 (290)
Q Consensus       289 ~  289 (290)
                      .
T Consensus       307 ~  307 (314)
T COG0451         307 W  307 (314)
T ss_pred             H
T ss_conf             9


No 22 
>KOG1429 consensus
Probab=100.00  E-value=7.8e-39  Score=237.80  Aligned_cols=269  Identities=18%  Similarity=0.222  Sum_probs=207.6

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHH-----H----------CCCCCHHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             94999978897889999999-649859996136-----7----------0878999999999755998999786344543
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-----D----------IDLLKPKDFASFFLSFSPDVIINPAAYTAVD   64 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-----~----------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~   64 (290)
                      |||+||||.|||||||++.| .++|+|+++|..     +          .++.-.+-+..++...  |-|+|+||...+-
T Consensus        28 lrI~itGgaGFIgSHLvdkLm~egh~Via~Dn~ftg~k~n~~~~~~~~~fel~~hdv~~pl~~ev--D~IyhLAapasp~  105 (350)
T KOG1429          28 LRILITGGAGFIGSHLVDKLMTEGHEVIALDNYFTGRKENLEHWIGHPNFELIRHDVVEPLLKEV--DQIYHLAAPASPP  105 (350)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHCCCCCCCCCEEEEEEECHHHHHHHH--HHHHHHCCCCCCC
T ss_conf             07999657405889999999746877999831345521002100367763589730024788877--7886422677875


Q ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCCHHHHHHHHHHHCCCC
Q ss_conf             2233221024201222110001122333333445532111357554421111-----22221110124566665310122
Q gi|254780921|r   65 KAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS-----PTNPLNIYGKSKLAGEEKVASYT  139 (290)
Q Consensus        65 ~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~~~~p~~E~d-----~~~P~~~Yg~sK~~~E~~v~~~~  139 (290)
                      ....+|..+...|+.++.+.+..|+..++|+++.||++||+.+...|-.|+-     |..|.+.|+.-|..+|.++.++.
T Consensus       106 ~y~~npvktIktN~igtln~lglakrv~aR~l~aSTseVYgdp~~hpq~e~ywg~vnpigpr~cydegKr~aE~L~~~y~  185 (350)
T KOG1429         106 HYKYNPVKTIKTNVIGTLNMLGLAKRVGARFLLASTSEVYGDPLVHPQVETYWGNVNPIGPRSCYDEGKRVAETLCYAYH  185 (350)
T ss_pred             CCCCCCCCEEEECCHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             52357650566522226788899987376689864000048855688855532126877872345577889999999863


Q ss_pred             CCC----CCCCCCCCEECCCC----CCCCEEECCCCCCCCEEECCC--CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             232----23555420003686----320002011246652153045--54544522368999999998442024433443
Q gi|254780921|r  140 NNY----VILRTAWVYSIFGS----NFLLSMLRLAKERREISVVCD--QFGTPTSALQIARAIIQIAHNLIENSDTSLRG  209 (290)
Q Consensus       140 ~~~----~IlR~~~vyG~~~~----~~v~~~l~~~~~~~~i~~~~d--~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~G  209 (290)
                      ...    -|.|+.+.|||...    ..+..+..++.+++++++++|  |.|+.+|+.|++++++++++.       +..+
T Consensus       186 k~~giE~rIaRifNtyGPrm~~~dgrvvsnf~~q~lr~epltv~g~G~qtRSF~yvsD~Vegll~Lm~s-------~~~~  258 (350)
T KOG1429         186 KQEGIEVRIARIFNTYGPRMHMDDGRVVSNFIAQALRGEPLTVYGDGKQTRSFQYVSDLVEGLLRLMES-------DYRG  258 (350)
T ss_pred             CCCCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCEEEEEEHHHHHHHHHHHHCC-------CCCC
T ss_conf             015827999843224377631579715689999985279869976983158778699899999998608-------8767


Q ss_pred             CEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECC-HHHHCCCCCCCCCCCCCHHHHHHHHCCCCC-CHHHHHHHHH
Q ss_conf             13762386667889999999999997279800057628-588087689975110086899996178999-9899999999
Q gi|254780921|r  210 IFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIF-TKQYPTKAHRPAYSCLDCSKLANTHNIRIS-TWKEGVRNIL  287 (290)
Q Consensus       210 iyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~-~~~~~~~a~RP~~~~Ld~~K~~~~lg~~~~-~~~e~i~~~i  287 (290)
                      -+|+++. +..|..|||+.+....    +....++-.. ..|-+.  +|    .-|++|+++.|||.|. +++|||..++
T Consensus       259 pvNiGnp-~e~Tm~elAemv~e~~----~~~s~i~~~~~~~Ddp~--kR----~pDi~~ake~LgW~Pkv~L~egL~~t~  327 (350)
T KOG1429         259 PVNIGNP-GEFTMLELAEMVKELI----GPVSEIEFVENGPDDPR--KR----KPDITKAKEQLGWEPKVSLREGLPLTV  327 (350)
T ss_pred             CCCCCCC-CCEEHHHHHHHHHHHC----CCCCCEEECCCCCCCCC--CC----CCCHHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             6426993-1221999999999971----77643022477888732--35----862789999728888772777668899


Q ss_pred             HH
Q ss_conf             71
Q gi|254780921|r  288 VN  289 (290)
Q Consensus       288 ~~  289 (290)
                      ..
T Consensus       328 ~~  329 (350)
T KOG1429         328 TY  329 (350)
T ss_pred             HH
T ss_conf             99


No 23 
>KOG1371 consensus
Probab=100.00  E-value=1.5e-37  Score=230.64  Aligned_cols=272  Identities=19%  Similarity=0.238  Sum_probs=208.1

Q ss_pred             CEEEEECCCCHHHHHHH-HHHHCCCEEEEECH------------------------HHCCCCCHHHHHHHHHHCCCCEEE
Q ss_conf             94999978897889999-99964985999613------------------------670878999999999755998999
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLS-SMCVQDVEIIRVGR------------------------PDIDLLKPKDFASFFLSFSPDVII   55 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~-~~l~~~~~v~~~~r------------------------~~~D~~~~~~~~~~l~~~~pd~Vi   55 (290)
                      ++||||||+||||+|-+ ++++.|++|+++|.                        .+.|++|...++++|+..+||.|+
T Consensus         3 ~~VLVtGgaGyiGsht~l~L~~~gy~v~~vDNl~n~~~~sl~r~~~l~~~~~~v~f~~~Dl~D~~~L~kvF~~~~fd~V~   82 (343)
T KOG1371           3 KHVLVTGGAGYIGSHTVLALLKRGYGVVIVDNLNNSYLESLKRVRQLLGEGKSVFFVEGDLNDAEALEKLFSEVKFDAVM   82 (343)
T ss_pred             CEEEEECCCCCEEHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHCCCCEEE
T ss_conf             37999668763105999999867981799824332124677889986278774389981566899999998633886577


Q ss_pred             ECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCHHHHHHHHH
Q ss_conf             78634454322332210242012221100011223333-33445532111357554421111222-21110124566665
Q gi|254780921|r   56 NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTN-PLNIYGKSKLAGEE  133 (290)
Q Consensus        56 h~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~-P~~~Yg~sK~~~E~  133 (290)
                      |+||...+..+..+|...+..|..||.+|++.|++.++ .+||.||+.||+-+...|++|++++. |.++||.+|.++|+
T Consensus        83 Hfa~~~~vgeS~~~p~~Y~~nNi~gtlnlLe~~~~~~~~~~V~sssatvYG~p~~vp~te~~~t~~p~~pyg~tK~~iE~  162 (343)
T KOG1371          83 HFAALAAVGESMENPLSYYHNNIAGTLNLLEVMKAHNVKALVFSSSATVYGLPTKVPITEEDPTDQPTNPYGKTKKAIEE  162 (343)
T ss_pred             EEHHHHCCCHHHHCCHHHEEHHHHHHHHHHHHHHHCCCCEEEEECCEEEECCCCEECCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             62444133156628223100211468999999997598648884230463476432035768778888864013677999


Q ss_pred             HHCCCCCC----CCCCCCCCCEE--CCCC------CCCCEEE----CC-CCCCCCEEE--------CCCCCCCCCCHHHH
Q ss_conf             31012223----22355542000--3686------3200020----11-246652153--------04554544522368
Q gi|254780921|r  134 KVASYTNN----YVILRTAWVYS--IFGS------NFLLSML----RL-AKERREISV--------VCDQFGTPTSALQI  188 (290)
Q Consensus       134 ~v~~~~~~----~~IlR~~~vyG--~~~~------~~v~~~l----~~-~~~~~~i~~--------~~d~~~~p~~v~D~  188 (290)
                      ++..+...    ..+||..+++|  |.|.      .+.+.++    +. +.....+.+        ++|+.+..+|+.|+
T Consensus       163 i~~d~~~~~~~~~~~LRyfn~~ga~p~Gr~ge~p~~~~nnl~p~v~~vaigr~~~l~v~g~d~~t~dgt~vrdyi~v~Dl  242 (343)
T KOG1371         163 IIHDYNKAYGWKVTGLRYFNVIGAHPSGRIGEAPLGIPNNLLPYVFQVAIGRRPNLQVVGRDYTTIDGTIVRDYIHVLDL  242 (343)
T ss_pred             HHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCEEECCCCCCCCCCEEECCEEEEEH
T ss_conf             76765314560479988425567665467788876675653401330000232452540476602179711232201664


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCCCCCCC---CCCCCH
Q ss_conf             99999999844202443344313762386667889999999999997279800057628588087689975---110086
Q gi|254780921|r  189 ARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPA---YSCLDC  265 (290)
Q Consensus       189 a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP~---~~~Ld~  265 (290)
                      |+....++.+.....+   .||||++.+. .+|-.++    ...+.+..+...++.-+        .+||.   +..-+.
T Consensus       243 a~~h~~al~k~~~~~~---~~i~Nlgtg~-g~~V~~l----v~a~~k~~g~~~k~~~v--------~~R~gdv~~~ya~~  306 (343)
T KOG1371         243 ADGHVAALGKLRGAAE---FGVYNLGTGK-GSSVLEL----VTAFEKALGVKIKKKVV--------PRRNGDVAFVYANP  306 (343)
T ss_pred             HHHHHHHHHCCCCCCC---EEEEECCCCC-CCCHHHH----HHHHHHHHCCCCCCCCC--------CCCCCCCEEEEECH
T ss_conf             7788987642000000---3457604788-8229999----99999875579872003--------77899841465174


Q ss_pred             HHHHHHHCCCCC-CHHHHHHHHHH
Q ss_conf             899996178999-98999999997
Q gi|254780921|r  266 SKLANTHNIRIS-TWKEGVRNILV  288 (290)
Q Consensus       266 ~K~~~~lg~~~~-~~~e~i~~~i~  288 (290)
                      +++.+.|||++. .++|+++++.+
T Consensus       307 ~~a~~elgwk~~~~iee~c~dlw~  330 (343)
T KOG1371         307 SKAQRELGWKAKYGLQEMLKDLWR  330 (343)
T ss_pred             HHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             789998488642389999999999


No 24 
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzyme catalyzes the first step in the biosynthesis of pseudaminic acid, the conversion of UDP-N-acetylglucosamine to UDP-4-keto-6-deoxy-N-acetylglucosamine. These sequences are members of the broader pfam01073 (3-beta hydroxysteroid dehydrogenase/isomerase family) family.
Probab=100.00  E-value=2.2e-38  Score=235.30  Aligned_cols=204  Identities=22%  Similarity=0.294  Sum_probs=163.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHCC---CEEEEECHHH-------------------CCCCCHHHHHHHHHHCCCCEEEECCC
Q ss_conf             4999978897889999999649---8599961367-------------------08789999999997559989997863
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQD---VEIIRVGRPD-------------------IDLLKPKDFASFFLSFSPDVIINPAA   59 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~~---~~v~~~~r~~-------------------~D~~~~~~~~~~l~~~~pd~Vih~Aa   59 (290)
                      +||||||+||||++|++.|.+.   ..++.+++.+                   .|++|.+.+.++++.  +|+|||+||
T Consensus         6 ~ILVTGGaGfIGS~lv~~Ll~~~~~~~iii~~~de~~~~~l~~~~~~~~i~f~~gDIrD~~~l~~~~~~--vD~VfHaAA   83 (324)
T TIGR03589         6 SILITGGTGSFGKAFISRLLENYNPKKIIIYSRDELKQWEMQQKFPAPCLRFFIGDVRDKERLTRALRG--VDYVVHAAA   83 (324)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHCCCCCEEEEECCCCCHHHHHHHHCC--CCEEEECCC
T ss_conf             999907977999999999997299828999668640328898516898759996777788999976348--889999462


Q ss_pred             CCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             4454322332210242012221100011223333-334455321113575544211112222111012456666531012
Q gi|254780921|r   60 YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASY  138 (290)
Q Consensus        60 ~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~  138 (290)
                      +..|+.||.+|..+.++|+.||.||+++|.+.++ ++|++|||.+              ++|.|+||.||+++|+++...
T Consensus        84 ~khVp~se~nP~e~i~tNV~Gt~nlleaa~~~~Vkk~V~iSTDka--------------~~P~n~yGasK~~~E~l~~~~  149 (324)
T TIGR03589        84 LKQVPAAEYNPFECIRTNINGAQNVIDAAIDNGVKRVVALSTDKA--------------ANPINLYGATKLASDKLFVAA  149 (324)
T ss_pred             CCCCCHHHHCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC--------------CCCCCCCCCCHHHHHHHHHHH
T ss_conf             776726776989999999799999999988555431786226888--------------899674312367679999999


Q ss_pred             ---C----CCCCCCCCCCCEECCCCCCCCEEECCCCCC-CCEEEC-CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             ---2----232235554200036863200020112466-521530-4554544522368999999998442024433443
Q gi|254780921|r  139 ---T----NNYVILRTAWVYSIFGSNFLLSMLRLAKER-REISVV-CDQFGTPTSALQIARAIIQIAHNLIENSDTSLRG  209 (290)
Q Consensus       139 ---~----~~~~IlR~~~vyG~~~~~~v~~~l~~~~~~-~~i~~~-~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~G  209 (290)
                         .    -++.++|.++|||++|+ +++.+++++.++ +++.+- +++.|-.++++|.+++++..++....++      
T Consensus       150 ~~~~~~~~~~~~~vRygNV~gsrgS-ViP~F~~qi~~g~~~~~itd~~mtRf~mtv~dav~lV~~a~~~~~~GE------  222 (324)
T TIGR03589       150 NNISGSKGTRFSVVRYGNVVGSRGS-VVPFFKSLKEEGVTELPITDPRMTRFWITLEQGVNFVLKSLERMLGGE------  222 (324)
T ss_pred             HHHHCCCCCEEEEEEECCCCCCCCC-CHHHHHHHHHCCCCCCCCCCCCEEEEEEEHHHHHHHHHHHHHHCCCCE------
T ss_conf             9850788863788633275188866-399999999839997444999807998889999999999998288984------


Q ss_pred             CEEEECCCCCCCHHHHHHHHH
Q ss_conf             137623866678899999999
Q gi|254780921|r  210 IFHMTADGGPVSWADFAEYIF  230 (290)
Q Consensus       210 iyn~~~~~~~~s~~e~a~~I~  230 (290)
                      ||=  ..-......|+|+.+.
T Consensus       223 ifv--~k~~s~~i~dla~~~~  241 (324)
T TIGR03589       223 IFV--PKIPSMKITDLAEAMA  241 (324)
T ss_pred             EEE--CCCCCCHHHHHHHHHH
T ss_conf             998--3697025999999860


No 25 
>KOG1430 consensus
Probab=100.00  E-value=5.2e-36  Score=221.91  Aligned_cols=280  Identities=21%  Similarity=0.236  Sum_probs=200.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-C--CEEEEECHH---------------------HCCCCCHHHHHHHHHHCCCCEEEEC
Q ss_conf             499997889788999999964-9--859996136---------------------7087899999999975599899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-D--VEIIRVGRP---------------------DIDLLKPKDFASFFLSFSPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~--~~v~~~~r~---------------------~~D~~~~~~~~~~l~~~~pd~Vih~   57 (290)
                      .+|||||+||+|+||++.|.+ +  .++...|..                     +.|++|...+...+..+   .|+||
T Consensus         6 ~vlVtGG~GflG~hlv~~L~~~~~~~~irv~D~~~~~~~~~~e~~~~~~~~v~~~~~D~~~~~~i~~a~~~~---~Vvh~   82 (361)
T KOG1430           6 SVLVTGGSGFLGQHLVQALLENELKLEIRVVDKTPTQSNLPAELTGFRSGRVTVILGDLLDANSISNAFQGA---VVVHC   82 (361)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHHCCCCCCEEEEECCHHHHHHHHHHCCCC---EEEEE
T ss_conf             799989833789999999984566617999536775556514553346774368722300005566521576---07875


Q ss_pred             CCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCHHHHHHHHH
Q ss_conf             634454322332210242012221100011223333-334455321113575544211112222---1110124566665
Q gi|254780921|r   58 AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNP---LNIYGKSKLAGEE  133 (290)
Q Consensus        58 Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P---~~~Yg~sK~~~E~  133 (290)
                      ||...++.++++++..+++||.||.+++++|.+.++ ++||+||++|+.+....++.+++.+-|   .+.|+.||..+|+
T Consensus        83 aa~~~~~~~~~~~~~~~~vNV~gT~nvi~~c~~~~v~~lIYtSs~~Vvf~g~~~~n~~E~~p~p~~~~d~Y~~sKa~aE~  162 (361)
T KOG1430          83 AASPVPDFVENDRDLAMRVNVNGTLNVIEACKELGVKRLIYTSSAYVVFGGEPIINGDESLPYPLKHIDPYGESKALAEK  162 (361)
T ss_pred             CCCCCCCCCCCCHHHHEEECCHHHHHHHHHHHHHCCCEEEEECCCEEEECCEECCCCCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             16567520235612521414050899999999829878999467428868835455777878755455433258999999


Q ss_pred             HHCCCCCC----CCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCC--CCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             31012223----223555420003686320002011246652153045--545445223689999999984420244334
Q gi|254780921|r  134 KVASYTNN----YVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD--QFGTPTSALQIARAIIQIAHNLIENSDTSL  207 (290)
Q Consensus       134 ~v~~~~~~----~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d--~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~  207 (290)
                      ++++.+..    +..||++.+|||+++.++..+...++.+..+...++  .+.+.+|++.++.+.......+........
T Consensus       163 ~Vl~an~~~~l~T~aLR~~~IYGpgd~~~~~~i~~~~~~g~~~f~~g~~~~~~~~~~~~Nva~ahilA~~aL~~~~~~~~  242 (361)
T KOG1430         163 LVLEANGSDDLYTCALRPPGIYGPGDKRLLPKIVEALKNGGFLFKIGDGENLNDFTYGENVAWAHILAARALLDKSPSVN  242 (361)
T ss_pred             HHHHHCCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCEEEEECCCCCCCEEEECHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99985699871589970341117997520478999998068517860566410228802327999988998871487668


Q ss_pred             CCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHH---------HH--CCCC-CCCC-----------CCCCC
Q ss_conf             431376238666788999999999999727980005762858---------80--8768-9975-----------11008
Q gi|254780921|r  208 RGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTK---------QY--PTKA-HRPA-----------YSCLD  264 (290)
Q Consensus       208 ~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~---------~~--~~~a-~RP~-----------~~~Ld  264 (290)
                      ..+|+++.+...-+ +++...++..+   +....-....+..         ++  .... .+|.           ....+
T Consensus       243 Gq~yfI~d~~p~~~-~~~~~~l~~~l---g~~~~~~~~~p~~l~~~~~~l~e~~~~~l~p~~p~lt~~~v~~~~~~~~f~  318 (361)
T KOG1430         243 GQFYFITDDTPVRF-FDFLSPLVKAL---GYCLPSSIKLPLFLSYFLAYLLEIVYFLLRPYQPILTRFRVALLGVTRTFS  318 (361)
T ss_pred             CEEEEEECCCCCHH-HHHHHHHHHHC---CCCCCCEEECCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHEEECCCCCCC
T ss_conf             50899868981203-68889998843---999875564435899999999999998606778775766722311445507


Q ss_pred             HHHHHHHHCCCCC-CHHHHHHHHHH
Q ss_conf             6899996178999-98999999997
Q gi|254780921|r  265 CSKLANTHNIRIS-TWKEGVRNILV  288 (290)
Q Consensus       265 ~~K~~~~lg~~~~-~~~e~i~~~i~  288 (290)
                      +.|+++.+|++|. +|++++.+++.
T Consensus       319 ~~kA~~~lgY~P~~~~~e~~~~~~~  343 (361)
T KOG1430         319 IEKAKRELGYKPLVSLEEAIQRTIH  343 (361)
T ss_pred             HHHHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             8998776289986787898999999


No 26 
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated
Probab=100.00  E-value=2.4e-34  Score=212.52  Aligned_cols=282  Identities=17%  Similarity=0.161  Sum_probs=214.9

Q ss_pred             EEEEECCCCHHHHHHHHHHH--CCCEEEEECHH----------------HCCCCCHHHHHHH-HHHCCCCEEEECCCCCC
Q ss_conf             49999788978899999996--49859996136----------------7087899999999-97559989997863445
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCV--QDVEIIRVGRP----------------DIDLLKPKDFASF-FLSFSPDVIINPAAYTA   62 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~--~~~~v~~~~r~----------------~~D~~~~~~~~~~-l~~~~pd~Vih~Aa~~~   62 (290)
                      ||||+|.+||||+||.+.+.  .+++|+++|..                +.|++-...+-+. ++  ++|+|+-++|+..
T Consensus       317 ~vlilgvngfig~hl~~~~l~~~~~~v~g~d~~~~~i~~~~~~p~~~f~~gdi~~~~~wie~~ik--kcdvvlplvaiat  394 (660)
T PRK08125        317 RVLILGVNGFIGNHLTERLLRDDNYEVYGLDIGSDAISRFLGHPRFHFVEGDISIHSEWIEYHIK--KCDVVLPLVAIAT  394 (660)
T ss_pred             EEEEEECCCHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHCCCCEEEEECCCHHHHHHHHHHHH--HCCEEEEEHHHCC
T ss_conf             79998344136789999985038858998865753455753499548881561466899998875--4576732055347


Q ss_pred             CCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCC----CCHHHHHHHHHHH
Q ss_conf             4322332210242012221100011223333334455321113575544211112---22211----1012456666531
Q gi|254780921|r   63 VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSP---TNPLN----IYGKSKLAGEEKV  135 (290)
Q Consensus        63 ~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~---~~P~~----~Yg~sK~~~E~~v  135 (290)
                      |-..-+||-..|+...+.-..+.+.|.+++.|+||.||+.||+=..+..++|+..   +.|.+    .|+.||.+.|+++
T Consensus       395 p~~y~~~pl~vfeldfe~nl~ivr~c~ky~kriifpstsevygm~~d~~f~ed~s~li~gpi~~~RWiYs~sKqlldrvi  474 (660)
T PRK08125        395 PIEYTRNPLRVFELDFEENLKIIRYCVKYRKRIIFPSTSEVYGMCTDKYFDEDHSNLIVGPINKQRWIYSVSKQLLDRVI  474 (660)
T ss_pred             HHHHHCCCCEEEEECHHHCCHHHHHHHHHCCEEEECCHHHHCCCCCCCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             47763486047873267552899999974877896560551014788676855566156775554357877899988999


Q ss_pred             CCCCC----CCCCCCCCCCEECCCCC----------CCCEEECCCCCCCCEEECCC--CCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             01222----32235554200036863----------20002011246652153045--5454452236899999999844
Q gi|254780921|r  136 ASYTN----NYVILRTAWVYSIFGSN----------FLLSMLRLAKERREISVVCD--QFGTPTSALQIARAIIQIAHNL  199 (290)
Q Consensus       136 ~~~~~----~~~IlR~~~vyG~~~~~----------~v~~~l~~~~~~~~i~~~~d--~~~~p~~v~D~a~~i~~~~~~~  199 (290)
                      -+|+.    +++++|+.+-+||+-++          .+..++..+.+++++.++++  |.|+.|+++|..+++..++++-
T Consensus       475 ~Ayg~~~gL~ftlfRpFNw~GPrld~~~~~~~gs~r~itq~i~nl~~g~pi~lvdgG~QkR~Ft~I~Dgieal~~ii~n~  554 (660)
T PRK08125        475 WAYGEKEGLRFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGAQKRCFTDIRDGIEALFRIIENR  554 (660)
T ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEECCCCEEEEEEEHHHHHHHHHHHHHCC
T ss_conf             98776539946998014555888775555334775419999999976998568548730588876677999999998494


Q ss_pred             HHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCC-----CCHHEEECCHHHHCCCCC-CCCCCCCCHHHHHHHHC
Q ss_conf             202443344313762386667889999999999997279-----800057628588087689-97511008689999617
Q gi|254780921|r  200 IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-----PYSKVYRIFTKQYPTKAH-RPAYSCLDCSKLANTHN  273 (290)
Q Consensus       200 ~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~-----~~~~i~~~~~~~~~~~a~-RP~~~~Ld~~K~~~~lg  273 (290)
                      ...++   ..|||+++.....|..|+|+.++..+.....     +......+.+.+|-.+.. .-....-+++++++.|+
T Consensus       555 ~~~~~---g~I~NiGnp~n~~Si~~la~~l~~~~~~~~~~~~~~~~~~~~~~~s~~~YG~gYqDv~~R~P~i~~a~~~l~  631 (660)
T PRK08125        555 GNRCD---GQIINIGNPDNEASIRELAEMLLASFEKHPLRDHFPPFAGFRVVESSSYYGKGYQDVEHRKPSIRNARRLLD  631 (660)
T ss_pred             CCCCC---CEEEECCCCCCCEEHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCHHHHHHCCCCHHHHHHHCC
T ss_conf             55556---606875899865239999999999997385300065445536603301237742556634887778987549


Q ss_pred             CCCC-CHHHHHHHHHH
Q ss_conf             8999-98999999997
Q gi|254780921|r  274 IRIS-TWKEGVRNILV  288 (290)
Q Consensus       274 ~~~~-~~~e~i~~~i~  288 (290)
                      |+|. +++++|+++|+
T Consensus       632 w~P~~~~~~~i~~tl~  647 (660)
T PRK08125        632 WEPKIAMQETIDETLD  647 (660)
T ss_pred             CCCCCCHHHHHHHHHH
T ss_conf             9877728999999999


No 27 
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=100.00  E-value=2.6e-33  Score=206.69  Aligned_cols=211  Identities=24%  Similarity=0.294  Sum_probs=168.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-C-CEEEEECHHH-----------------------CCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             499997889788999999964-9-8599961367-----------------------08789999999997559989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-D-VEIIRVGRPD-----------------------IDLLKPKDFASFFLSFSPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~-~~v~~~~r~~-----------------------~D~~~~~~~~~~l~~~~pd~Vih   56 (290)
                      +||||||+|-+|+++++++.+ + .+++-++|+|                       .|++|.+.+++++++++||+|+|
T Consensus       252 ~vLVTGagGSiGsel~~qil~~~p~~i~l~~~~E~~~~~i~~el~~~~~~~~~~~~igdVrD~~~~~~~~~~~kvd~VfH  331 (588)
T COG1086         252 TVLVTGGGGSIGSELCRQILKFNPKEIILFSRDEYKLYLIDMELREKFPELKLRFYIGDVRDRDRVERAMEGHKVDIVFH  331 (588)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEE
T ss_conf             89996898736799999998549878999617637799999999862787516899635346899999986388866887


Q ss_pred             CCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             8634454322332210242012221100011223333-334455321113575544211112222111012456666531
Q gi|254780921|r   57 PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKV  135 (290)
Q Consensus        57 ~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v  135 (290)
                      +||+-.|..||.||.++.+.|+.||.|++++|.++++ ++|.+|||              -.++|+|.||.||+.+|+++
T Consensus       332 AAA~KHVPl~E~nP~Eai~tNV~GT~nv~~aa~~~~V~~~V~iSTD--------------KAV~PtNvmGaTKr~aE~~~  397 (588)
T COG1086         332 AAALKHVPLVEYNPEEAIKTNVLGTENVAEAAIKNGVKKFVLISTD--------------KAVNPTNVMGATKRLAEKLF  397 (588)
T ss_pred             HHHHCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECC--------------CCCCCCHHHHHHHHHHHHHH
T ss_conf             5555368631018899998721738999999998397789997058--------------66688417668899999999


Q ss_pred             CCCCC-------CCCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECC-CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             01222-------322355542000368632000201124665215304-5545445223689999999984420244334
Q gi|254780921|r  136 ASYTN-------NYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC-DQFGTPTSALQIARAIIQIAHNLIENSDTSL  207 (290)
Q Consensus       136 ~~~~~-------~~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~-d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~  207 (290)
                      .++..       ++..+|+++|.|.+|+ .++-+.+++++|+++++-+ |..|-...+.+.++.+++....   ....  
T Consensus       398 ~a~~~~~~~~~T~f~~VRFGNVlGSrGS-ViPlFk~QI~~GgplTvTdp~mtRyfMTI~EAv~LVlqA~a~---~~gG--  471 (588)
T COG1086         398 QAANRNVSGTGTRFCVVRFGNVLGSRGS-VIPLFKKQIAEGGPLTVTDPDMTRFFMTIPEAVQLVLQAGAI---AKGG--  471 (588)
T ss_pred             HHHHHCCCCCCCEEEEEEECCEECCCCC-CHHHHHHHHHCCCCCCCCCCCCEEEEEEHHHHHHHHHHHHHH---CCCC--
T ss_conf             9974104888857999982545458877-778899999759984546867056788899999999998750---6898--


Q ss_pred             CCCEEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             431376238666788999999999999
Q gi|254780921|r  208 RGIFHMTADGGPVSWADFAEYIFWESA  234 (290)
Q Consensus       208 ~Giyn~~~~~~~~s~~e~a~~I~~~~~  234 (290)
                       .||=+- -++++...|+|+......+
T Consensus       472 -eifvld-MGepvkI~dLAk~mi~l~g  496 (588)
T COG1086         472 -EIFVLD-MGEPVKIIDLAKAMIELAG  496 (588)
T ss_pred             -CEEEEC-CCCCEEHHHHHHHHHHHHC
T ss_conf             -589981-8997279999999999817


No 28 
>KOG1502 consensus
Probab=99.97  E-value=3.9e-30  Score=188.86  Aligned_cols=268  Identities=17%  Similarity=0.170  Sum_probs=180.2

Q ss_pred             CEEEEECCCCHHHHHHHH-HHHCCCEEEEECHHH-----------------------CCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             949999788978899999-996498599961367-----------------------08789999999997559989997
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSS-MCVQDVEIIRVGRPD-----------------------IDLLKPKDFASFFLSFSPDVIIN   56 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~-~l~~~~~v~~~~r~~-----------------------~D~~~~~~~~~~l~~~~pd~Vih   56 (290)
                      |+|+||||+||||+++++ +|.+||.|.++-|+.                       .|++|.+++.+.++.+  |.|||
T Consensus         7 ~~VcVTGAsGfIgswivk~LL~rGY~V~gtVR~~~~~k~~~~L~~l~~a~~~l~l~~aDL~d~~sf~~ai~gc--dgVfH   84 (327)
T KOG1502           7 KKVCVTGASGFIGSWIVKLLLSRGYTVRGTVRDPEDEKKTEHLRKLEGAKERLKLFKADLLDEGSFDKAIDGC--DGVFH   84 (327)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHCCCCCCCCEEEECCCCCCCHHHHHHHCC--CEEEE
T ss_conf             2799948820899999999986899899997086305658999865157544258852435513599997078--78999


Q ss_pred             CCCCCCCCCCCCCCC-EEEEECCCCCCCCCCCCCCCC-C-CCCCCCCC-CCC-CCC---CCCCCCCCCCCCC------CC
Q ss_conf             863445432233221-024201222110001122333-3-33445532-111-357---5544211112222------11
Q gi|254780921|r   57 PAAYTAVDKAEDEPE-IAFSINAEGAGAIAKAADSIG-I-PCIYISTD-YVF-DGL---SRTPIDEFSPTNP------LN  122 (290)
Q Consensus        57 ~Aa~~~~~~~e~~~~-~~~~~Nv~~~~~l~~~~~~~~-~-~~I~iSS~-~Vy-~g~---~~~p~~E~d~~~P------~~  122 (290)
                      +|+-..++..+  |+ ......+.||.|++++|++.. + |+||.||. +|. .++   .+..++|++-.++      .+
T Consensus        85 ~Asp~~~~~~~--~e~~li~pav~Gt~nVL~ac~~~~sVkrvV~TSS~aAv~~~~~~~~~~~vvdE~~wsd~~~~~~~~~  162 (327)
T KOG1502          85 TASPVDFDLED--PEKELIDPAVKGTKNVLEACKKTKSVKRVVYTSSTAAVRYNGPNIGENSVVDEESWSDLDFCRCKKL  162 (327)
T ss_pred             ECCCCCCCCCC--CHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             17667877787--4776631788889999999860587226999614787114776788885456555781888876677


Q ss_pred             CCHHHHHHHHHHHCCCCCCC----CCCCCCCCEECCCCC---CCCE-EECCCCCCCCEEECCCCCCCCCCHHHHHHHHHH
Q ss_conf             10124566665310122232----235554200036863---2000-201124665215304554544522368999999
Q gi|254780921|r  123 IYGKSKLAGEEKVASYTNNY----VILRTAWVYSIFGSN---FLLS-MLRLAKERREISVVCDQFGTPTSALQIARAIIQ  194 (290)
Q Consensus       123 ~Yg~sK~~~E~~v~~~~~~~----~IlR~~~vyG~~~~~---~v~~-~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~  194 (290)
                      .|..+|..+|+...++.++.    +.+=|+.|+||.-..   .... +++.++..  ...+.+.+.-.+||+|+|++.+.
T Consensus       163 ~Y~~sK~lAEkaAw~fa~e~~~~lv~inP~lV~GP~l~~~l~~s~~~~l~~i~G~--~~~~~n~~~~~VdVrDVA~AHv~  240 (327)
T KOG1502         163 WYALSKTLAEKAAWEFAKENGLDLVTINPGLVFGPGLQPSLNSSLNALLKLIKGL--AETYPNFWLAFVDVRDVALAHVL  240 (327)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEECCCCEECCCCCCCCCHHHHHHHHHHHCC--CCCCCCCCEEEEEHHHHHHHHHH
T ss_conf             8899999999999999985796189966871379775666550299999987065--54578774346769998999999


Q ss_pred             HHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCCCCCCCCCCCCHHHHHHHHCC
Q ss_conf             99844202443344313762386667889999999999997279800057628588087689975110086899996178
Q gi|254780921|r  195 IAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNI  274 (290)
Q Consensus       195 ~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP~~~~Ld~~K~~~~lg~  274 (290)
                      ++++.      ...|-|+.+++  ..++.|++.    .+..+..... +.....+......  +. ..++++|+++.+|+
T Consensus       241 a~E~~------~a~GRyic~~~--~~~~~ei~~----~l~~~~P~~~-ip~~~~~~~~~~~--~~-~~~~~~k~k~lg~~  304 (327)
T KOG1502         241 ALEKP------SAKGRYICVGE--VVSIKEIAD----ILRELFPDYP-IPKKNAEEHEGFL--TS-FKVSSEKLKSLGGF  304 (327)
T ss_pred             HHCCC------CCCCEEEEECC--CCCHHHHHH----HHHHHCCCCC-CCCCCCCCCCCCC--CC-CCCCCHHHHHCCCC
T ss_conf             97176------66834999527--652999999----9998688877-7877776566554--33-33340888861563


Q ss_pred             CCCCHHHHHHHHHHHC
Q ss_conf             9999899999999719
Q gi|254780921|r  275 RISTWKEGVRNILVNI  290 (290)
Q Consensus       275 ~~~~~~e~i~~~i~~l  290 (290)
                      +.++|+|.+.++++.+
T Consensus       305 ~~~~l~e~~~dt~~sl  320 (327)
T KOG1502         305 KFRPLEETLSDTVESL  320 (327)
T ss_pred             EECCHHHHHHHHHHHH
T ss_conf             1057699999999999


No 29 
>CHL00194 ycf39 Ycf39; Provisional
Probab=99.96  E-value=5.1e-29  Score=182.55  Aligned_cols=255  Identities=17%  Similarity=0.137  Sum_probs=179.8

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------CCCCCHHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             94999978897889999999-6498599961367---------------0878999999999755998999786344543
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------IDLLKPKDFASFFLSFSPDVIINPAAYTAVD   64 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~   64 (290)
                      |+||||||||++|+++++.| .+||+|.++.|+.               .|+.|++.+.+.++..  |+|||++... + 
T Consensus         1 M~ILV~GATG~lGr~vVr~Ll~~G~~Vr~lvRnp~ka~~l~~~Gve~v~gDl~dpesl~~Al~Gv--daVi~~~~~~-~-   76 (319)
T CHL00194          1 MSLLVIGATGTLGRQIVRRALDEGYQVKCLVRNLRKAAFLKEWGAELVYGDLSLPETIPPALEGI--TAIIDASTSR-P-   76 (319)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEEEEECCCCHHHHHHHHCCC--CEEEEECCCC-C-
T ss_conf             97999899858999999999968890899957867632342159679994278877899996599--6799945667-7-


Q ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCC
Q ss_conf             22332210242012221100011223333-33445532111357554421111222211101245666653101222322
Q gi|254780921|r   65 KAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYV  143 (290)
Q Consensus        65 ~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~~~~  143 (290)
                         .++...+.++.+++.+++++|+..|+ ++||+|.-    |.      +.   +|..+|..+|.++|+++++.+-+|+
T Consensus        77 ---~~~~~~~~vd~~g~~~li~AAk~aGVkr~V~lS~l----ga------~~---~~~~p~~~~K~~~E~~L~~Sgl~~T  140 (319)
T CHL00194         77 ---SDLNNAYQIDLEGKLALIEAAKAAKVKRFIFFSIL----NA------EQ---YPQVPLMKIKSDIEEKLKQSGINYT  140 (319)
T ss_pred             ---CCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCC----CC------CC---CCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             ---88620889889889999999998499889996135----66------66---8875677879999999986799859


Q ss_pred             CCCCCCCEECCCCCCCCEEECCCCCCCCEEECC-CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCH
Q ss_conf             355542000368632000201124665215304-5545445223689999999984420244334431376238666788
Q gi|254780921|r  144 ILRTAWVYSIFGSNFLLSMLRLAKERREISVVC-DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSW  222 (290)
Q Consensus       144 IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~-d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~  222 (290)
                      |+|+++.|..    ++..+......+.++.+-+ +....|++++|+|+++..++.....     ...+|.++|. ...|.
T Consensus       141 IlRPs~F~q~----l~~~~a~pi~~~~~v~~~~~~~~ia~I~~~DVA~~~a~aL~~~~~-----~gk~y~L~GP-~a~T~  210 (319)
T CHL00194        141 IFRLAGFFQG----LISQYAIPILDSQTIWITGESTPIAYIDTQDAAKFALKSLSLPET-----KNKTFPLVGP-KSWNS  210 (319)
T ss_pred             EECCHHHHHH----HHHHHHHHHHCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCC-----CCCEEEEECC-CCCCH
T ss_conf             9847399998----899876776307857766998752887799999999999589775-----8989995498-63899


Q ss_pred             HHHHHHHHHHHHHHCCCCHHEEECCHHH------------HC-CCCCCC---------CCCCCCHHHHHHHHCCCCC---
Q ss_conf             9999999999997279800057628588------------08-768997---------5110086899996178999---
Q gi|254780921|r  223 ADFAEYIFWESAERGGPYSKVYRIFTKQ------------YP-TKAHRP---------AYSCLDCSKLANTHNIRIS---  277 (290)
Q Consensus       223 ~e~a~~I~~~~~~~~~~~~~i~~~~~~~------------~~-~~a~RP---------~~~~Ld~~K~~~~lg~~~~---  277 (290)
                      .|+    .+.+.+..++..++.++|..-            |. ..+.|=         .....+.+..-+.+|+.|.   
T Consensus       211 ~EI----a~l~~~~~Gk~~~i~~vP~~~~~~~~~~~~~f~~~~~i~~rl~f~ev~~~~~~~~~~~~~~~~~~~~~~~~~~  286 (319)
T CHL00194        211 SEI----ISLCEQLSGQKAKVTRIPLFLLKLLRRITGFFEWTWNISDRLAFAEVLSEGNNFSASMADVYKIFKIDSNEIT  286 (319)
T ss_pred             HHH----HHHHHHHHCCCCCEEECCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCCCCCC
T ss_conf             999----9999998599987786898999999999987233425999999999965598657888999877188922222


Q ss_pred             CHHHHHHHHHHH
Q ss_conf             989999999971
Q gi|254780921|r  278 TWKEGVRNILVN  289 (290)
Q Consensus       278 ~~~e~i~~~i~~  289 (290)
                      ++++.+++|-..
T Consensus       287 ~le~y~~ey~~~  298 (319)
T CHL00194        287 SLEDYLQEYFGR  298 (319)
T ss_pred             CHHHHHHHHHHH
T ss_conf             189999999999


No 30 
>KOG1431 consensus
Probab=99.96  E-value=2.5e-28  Score=178.70  Aligned_cols=272  Identities=18%  Similarity=0.187  Sum_probs=188.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-C---CEEEEECHHHCCCCCHHHHHHHHHHCCCCEEEECCCCCC-CCCCCCCCCEEEE
Q ss_conf             9499997889788999999964-9---859996136708789999999997559989997863445-4322332210242
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-D---VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA-VDKAEDEPEIAFS   75 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~---~~v~~~~r~~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~-~~~~e~~~~~~~~   75 (290)
                      |||||||++|.+|+++++.+.+ +   -+.+...+.++|+++.+..+++|++.||..|||+||... ...-...+..-+.
T Consensus         2 ~kIlVtGg~GLVGsAi~~vv~~q~~~~e~wvf~~skd~DLt~~a~t~~lF~~ekPthVIhlAAmVGGlf~N~~ynldF~r   81 (315)
T KOG1431           2 KKILVTGGTGLVGSAIVKVVQEQGFDDENWVFIGSKDADLTNLADTRALFESEKPTHVIHLAAMVGGLFHNNTYNLDFIR   81 (315)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCHHHHHHHHHCCCCCEEEEHHHHHCCHHHCCCCCHHHHH
T ss_conf             55999368741789999999853888765699515544531368899998404870001067664304414778567776


Q ss_pred             ECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCC----CCCCCC-CCHHHHHHHHHHHCCC----CCCCCCC
Q ss_conf             012221100011223333-33445532111357554421111----222211-1012456666531012----2232235
Q gi|254780921|r   76 INAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFS----PTNPLN-IYGKSKLAGEEKVASY----TNNYVIL  145 (290)
Q Consensus        76 ~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d----~~~P~~-~Yg~sK~~~E~~v~~~----~~~~~Il  145 (290)
                      .|...-.|++..|-+.|+ |++++-|.|+|......|+.|+.    |+.|.| -|+..|.++.-.-++|    +..++-.
T Consensus        82 ~Nl~indNVlhsa~e~gv~K~vsclStCIfPdkt~yPIdEtmvh~gpphpsN~gYsyAKr~idv~n~aY~~qhg~~~tsv  161 (315)
T KOG1431          82 KNLQINDNVLHSAHEHGVKKVVSCLSTCIFPDKTSYPIDETMVHNGPPHPSNFGYSYAKRMIDVQNQAYRQQHGRDYTSV  161 (315)
T ss_pred             HCCEECHHHHHHHHHHCHHHHHHHCCEEECCCCCCCCCCHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             40141405878888706056444135344688888888778861599998730899999998777789999838712300


Q ss_pred             CCCCCEECCCC------CCCCEEEC---CCC-CCC-CEEECCC--CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEE
Q ss_conf             55420003686------32000201---124-665-2153045--54544522368999999998442024433443137
Q gi|254780921|r  146 RTAWVYSIFGS------NFLLSMLR---LAK-ERR-EISVVCD--QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFH  212 (290)
Q Consensus       146 R~~~vyG~~~~------~~v~~~l~---~~~-~~~-~i~~~~d--~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn  212 (290)
                      -+.++|||+++      ..++.+++   .++ ++. ++.+++-  -.|..+|++|+|++..-++.....-+.      .+
T Consensus       162 iPtNvfGphDNfnpe~sHVlPali~r~h~ak~~gtd~~~VwGsG~PlRqFiys~DLA~l~i~vlr~Y~~vEp------ii  235 (315)
T KOG1431         162 IPTNVFGPHDNFNPENSHVLPALIHRFHEAKRNGTDELTVWGSGSPLRQFIYSDDLADLFIWVLREYEGVEP------II  235 (315)
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCCCC------EE
T ss_conf             234453887778834353129999999998745884489953898078875676799999999986357554------57


Q ss_pred             EE-CCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCCCCCCCCCCCCHHHHHHHHCCCC--CCHHHHHHHHHH
Q ss_conf             62-38666788999999999999727980005762858808768997511008689999617899--998999999997
Q gi|254780921|r  213 MT-ADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRI--STWKEGVRNILV  288 (290)
Q Consensus       213 ~~-~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP~~~~Ld~~K~~~~lg~~~--~~~~e~i~~~i~  288 (290)
                      ++ ++...+|+.|.|+++.+. ..+   ..++...+++.-...     ...+|++|++.. +|.+  .+++++|.+..+
T Consensus       236 ls~ge~~EVtI~e~aeaV~ea-~~F---~G~l~~DttK~DGq~-----kKtasnsKL~sl-~pd~~ft~l~~ai~~t~~  304 (315)
T KOG1431         236 LSVGESDEVTIREAAEAVVEA-VDF---TGKLVWDTTKSDGQF-----KKTASNSKLRSL-LPDFKFTPLEQAISETVQ  304 (315)
T ss_pred             ECCCCCCEEEHHHHHHHHHHH-HCC---CCEEEEECCCCCCCC-----CCCCCHHHHHHH-CCCCCCCHHHHHHHHHHH
T ss_conf             316865336799999999998-287---752786335889871-----001355779984-898666838999999999


No 31 
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane]
Probab=99.95  E-value=1.2e-27  Score=174.86  Aligned_cols=276  Identities=21%  Similarity=0.215  Sum_probs=198.1

Q ss_pred             CE-EEEECCCCHHHHHHHHHH-HCCCEEEEECHH-------------------------HCCCCCHHHHHHHHHHCCCCE
Q ss_conf             94-999978897889999999-649859996136-------------------------708789999999997559989
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-------------------------DIDLLKPKDFASFFLSFSPDV   53 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-------------------------~~D~~~~~~~~~~l~~~~pd~   53 (290)
                      || .||||-||+-|+.|+++| ..|++|.|+.|+                         ..|++|...+.++++..+||.
T Consensus         2 ~K~ALITGITGQDGsYLa~lLLekGY~VhGi~Rrss~~n~~ri~L~~~~~~~~~~l~l~~gDLtD~~~l~r~l~~v~PdE   81 (345)
T COG1089           2 GKVALITGITGQDGSYLAELLLEKGYEVHGIKRRSSSFNTPRIHLYEDPHLNDPRLHLHYGDLTDSSNLLRILEEVQPDE   81 (345)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHCCCHH
T ss_conf             72699954458753899999985694898786033557765301111655578617999655435688999998609445


Q ss_pred             EEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             997863445432233221024201222110001122333---33344553211135755442111122221110124566
Q gi|254780921|r   54 IINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIG---IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLA  130 (290)
Q Consensus        54 Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~---~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~  130 (290)
                      |.|+||.|.|..+..+|+.+.+++..|+.+|+|+.+..+   +||.+.||+..|+...+.|-+|+.|..|.|+|+.+|+-
T Consensus        82 IYNLaAQS~V~vSFe~P~~T~~~~~iGtlrlLEaiR~~~~~~~rfYQAStSE~fG~v~~~pq~E~TPFyPrSPYAvAKlY  161 (345)
T COG1089          82 IYNLAAQSHVGVSFEQPEYTADVDAIGTLRLLEAIRILGEKKTRFYQASTSELYGLVQEIPQKETTPFYPRSPYAVAKLY  161 (345)
T ss_pred             HEECCCCCCCCCCCCCCCEEEEECHHHHHHHHHHHHHHCCCCCEEEECCCHHHHCCCCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             33034323455303586402531006788999999974876607996561776067666754468999889778899987


Q ss_pred             HHHHHCCCCCCCCCCCC-CCCE---ECC-CCCCCC-EEEC---CCCCC--CCEEECC-CCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             66531012223223555-4200---036-863200-0201---12466--5215304-5545445223689999999984
Q gi|254780921|r  131 GEEKVASYTNNYVILRT-AWVY---SIF-GSNFLL-SMLR---LAKER--REISVVC-DQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       131 ~E~~v~~~~~~~~IlR~-~~vy---G~~-~~~~v~-~~l~---~~~~~--~~i~~~~-d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      +--....|.+.|-+.-. +.+|   +|. +..|+- ++.+   .++.|  +.+.+-+ |..|.==|..|.+++++.++++
T Consensus       162 a~W~tvNYResYgl~AcnGILFNHESP~Rge~FVTRKIt~ava~Ik~G~q~~l~lGNldAkRDWG~A~DYVe~mwlmLQq  241 (345)
T COG1089         162 AYWITVNYRESYGLFACNGILFNHESPLRGETFVTRKITRAVARIKLGLQDKLYLGNLDAKRDWGHAKDYVEAMWLMLQQ  241 (345)
T ss_pred             HHHEEEEHHHHCCCEEECCEEECCCCCCCCCCEEHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             77603014763473343114433789877531033899999999870661268743633102343167899999999744


Q ss_pred             HHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCC------H--------HEEECCHHHHCCCCCCCCCC---
Q ss_conf             420244334431376238666788999999999999727980------0--------05762858808768997511---
Q gi|254780921|r  199 LIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY------S--------KVYRIFTKQYPTKAHRPAYS---  261 (290)
Q Consensus       199 ~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~------~--------~i~~~~~~~~~~~a~RP~~~---  261 (290)
                      ..       +.-|.++. +...|-.||...-+..+.....+.      .        .+..+.. .|    -||...   
T Consensus       242 ~~-------PddyViAT-g~t~sVrefv~~Af~~~g~~l~w~g~g~~e~g~da~tG~~~V~idp-~~----fRPaEVd~L  308 (345)
T COG1089         242 EE-------PDDYVIAT-GETHSVREFVELAFEMVGIDLEWEGTGVDEKGVDAKTGKIIVEIDP-RY----FRPAEVDLL  308 (345)
T ss_pred             CC-------CCCEEEEC-CCEEEHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCEEEEECC-CC----CCCHHHHHH
T ss_conf             79-------98448852-7522399999999997085588730355311312456752699870-10----683125565


Q ss_pred             CCCHHHHHHHHCCCCC-CHHHHHHHHHHH
Q ss_conf             0086899996178999-989999999971
Q gi|254780921|r  262 CLDCSKLANTHNIRIS-TWKEGVRNILVN  289 (290)
Q Consensus       262 ~Ld~~K~~~~lg~~~~-~~~e~i~~~i~~  289 (290)
                      .=|.+|+++.|||+|. +++|=++.+++.
T Consensus       309 lgdp~KA~~~LGW~~~~~~~elv~~Mv~~  337 (345)
T COG1089         309 LGDPTKAKEKLGWRPEVSLEELVREMVEA  337 (345)
T ss_pred             CCCHHHHHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             28878989970996666799999999999


No 32 
>PRK07201 short chain dehydrogenase; Provisional
Probab=99.95  E-value=5.6e-28  Score=176.69  Aligned_cols=221  Identities=19%  Similarity=0.157  Sum_probs=150.7

Q ss_pred             CEEEEECCCCHHHHHHHHHH-H-CCCEEEEECHHH---------------------CCCC------CHHHHHHHHHHCCC
Q ss_conf             94999978897889999999-6-498599961367---------------------0878------99999999975599
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-V-QDVEIIRVGRPD---------------------IDLL------KPKDFASFFLSFSP   51 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~-~~~~v~~~~r~~---------------------~D~~------~~~~~~~~l~~~~p   51 (290)
                      |++|+||+|||||++|.+.| . .+.+|+|+-|.+                     .|++      +.+.++++-++  .
T Consensus         1 mnyflTGaTGFLG~~LL~~LL~~~~a~V~cLVR~~s~~r~~~~~~~~~~~Rv~~v~GDL~~p~LGLs~~~~~~La~~--v   78 (663)
T PRK07201          1 MRYFVTGGTGFIGRRLVSRLLDRPGARVHVLVRRQSLGRFERLAEYWGVDRVVPVVGDLTAPELGLSAETIAELKGK--I   78 (663)
T ss_pred             CCEEECCCCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHCC--C
T ss_conf             93654068428899999999848999899997877499999999974898879946777876789599999999674--8


Q ss_pred             CEEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCHHH
Q ss_conf             899978634454322332210242012221100011223333-334455321113575544211112222---1110124
Q gi|254780921|r   52 DVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNP---LNIYGKS  127 (290)
Q Consensus        52 d~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P---~~~Yg~s  127 (290)
                      |+|+||||..+..   ...+.....||.||+++++.|...+. +|.|+||.+|. |.....+.|++.-.+   .+.|..|
T Consensus        79 d~I~H~aA~v~~~---~~y~~~~~~NV~GTr~vL~LA~~~~~~~~h~vST~~Va-G~~~g~~~Ed~~d~~~~l~~~Y~qS  154 (663)
T PRK07201         79 DHFFHLAAVYDLT---ADEESQRAANVEGTRAAIELAERLDAGTFHHVSSIAVA-GLFEGVFREDMFDEAQDLPTPYHRT  154 (663)
T ss_pred             CEEEECCEEECCC---CCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECEEC-CCCCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             9999898235788---99899765212999999999984799747999637453-6889875444454446689961658


Q ss_pred             HHHHHHHHCCCC-CCCCCCCCCCCEECCCCC---------CCCEEECCCCCC--CCEEECC--CCCCCCCCHHHHHHHHH
Q ss_conf             566665310122-232235554200036863---------200020112466--5215304--55454452236899999
Q gi|254780921|r  128 KLAGEEKVASYT-NNYVILRTAWVYSIFGSN---------FLLSMLRLAKER--REISVVC--DQFGTPTSALQIARAII  193 (290)
Q Consensus       128 K~~~E~~v~~~~-~~~~IlR~~~vyG~~~~~---------~v~~~l~~~~~~--~~i~~~~--d~~~~p~~v~D~a~~i~  193 (290)
                      |+.+|++|++.. -+..|.|++.|-|....+         +...+++.+...  .-+...+  .-..+.|.|+-+++++.
T Consensus       155 K~~AE~lVr~a~glP~~IyRPg~V~GdS~TG~~~k~Dgpy~~~~ll~~l~~~~p~~~P~~~~~~~~~n~vPVDfV~~Ai~  234 (663)
T PRK07201        155 KFEAEKLVREECGLPWRIYRPAVVVGDSRTGEMDKIDGPYYFFKVIQKLRAVLPSWTPMLGPEGGRTNIVPVDYVVDALD  234 (663)
T ss_pred             HHHHHHHHHHCCCCCEEEEECCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECHHHHHHHHH
T ss_conf             99999999974899879980857623665676446640789999999998636554566677777322511667999999


Q ss_pred             HHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             99984420244334431376238666788999999999999727
Q gi|254780921|r  194 QIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG  237 (290)
Q Consensus       194 ~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~  237 (290)
                      .+..+....+     .+||++. ..+.+-    +.++..+.+.+
T Consensus       235 ~Ls~~~~~~g-----~~fHL~d-P~p~~~----~~v~~~~a~~~  268 (663)
T PRK07201        235 HLAHADGRDG-----QTFHLTD-PKPYRV----GDIYNIFAEAA  268 (663)
T ss_pred             HHHCCCCCCC-----CEEEECC-CCCCCH----HHHHHHHHHHC
T ss_conf             9955988788-----6787059-998638----99999988733


No 33 
>TIGR01472 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368   This family represent GDP-mannose 4,6-dehydratase, also known as GDP-D-mannose dehydratase. This enzyme converts GDP-mannose to GDP-4-dehydro-6-deoxy-D-mannose, the first of three steps for the conversion of GDP-mannose to GDP-fucose in animals, plants, and bacteria. In bacteria, GDP-L-fucose acts as a precursor of surface antigens such as the extracellular polysaccharide colanic acid of Escherichia coli. Excluded from this family are members of the clade that are poorly related because of highly dervied (phylogenetically long-branch) sequences, e.g. Aneurinibacillus thermoaerophilus Gmd, described as a bifunctional GDP-mannose 4,6-dehydratase/GDP-6-deoxy-D-lyxo-4-hexulose reductase .; GO: 0008446 GDP-mannose 46-dehydratase activity, 0019673 GDP-mannose metabolic process, 0005622 intracellular.
Probab=99.95  E-value=7.8e-27  Score=170.25  Aligned_cols=276  Identities=20%  Similarity=0.226  Sum_probs=198.2

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------H-------CCCCCHHHHHHHHHHCCCC
Q ss_conf             999978897889999999-649859996136----------------------7-------0878999999999755998
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------D-------IDLLKPKDFASFFLSFSPD   52 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~-------~D~~~~~~~~~~l~~~~pd   52 (290)
                      -||||-||.=||.|+++| .+||+|=|+-|+                      .       .|++|...+.+++...||+
T Consensus         3 ALiTGiTGQDGSYLAE~LL~~GYeVHG~~RRSSSfNT~Ri~hiY~~~h~~~~r~A~~fLHYGDlTDs~~L~~~i~~~kP~   82 (365)
T TIGR01472         3 ALITGITGQDGSYLAEFLLEKGYEVHGLIRRSSSFNTQRIEHIYEDPHKEEKRRALMFLHYGDLTDSSNLVKLIDEIKPT   82 (365)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCC
T ss_conf             68834555767899999872696876458625542522456764053541016613542044210689999997404886


Q ss_pred             EEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCC---CCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             9997863445432233221024201222110001122---333----333445532111357554421111222211101
Q gi|254780921|r   53 VIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAAD---SIG----IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        53 ~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~---~~~----~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      -|-|+||.|.|.-|..=|+.+.++-..||-+|+||.+   -.|    +||=|.||+..||...+.|=+|+.|.+|-||||
T Consensus        83 EiYNLAAQSHV~VSFe~PeYTa~~~g~GTLrlLEA~r~hni~gl~~~~rFYQAStSElYG~v~~~PQ~E~TPF~PRSPYA  162 (365)
T TIGR01472        83 EIYNLAAQSHVKVSFEIPEYTADVDGIGTLRLLEAVRSHNILGLIKEIRFYQASTSELYGEVQEIPQNETTPFYPRSPYA  162 (365)
T ss_pred             EEECCCCCCCEEEECCCCCCHHCHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCHHHCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             34202023710354165200001244317789998742334141203025524523113655578888888768887689


Q ss_pred             HHHHHHHHHHCCCCCCCCCC-CCCCCE---EC-CCCCCCC-EEECC---CCCCCCEEEC-CC-----CCCCCCCHHHHHH
Q ss_conf             24566665310122232235-554200---03-6863200-02011---2466521530-45-----5454452236899
Q gi|254780921|r  126 KSKLAGEEKVASYTNNYVIL-RTAWVY---SI-FGSNFLL-SMLRL---AKERREISVV-CD-----QFGTPTSALQIAR  190 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~~~~Il-R~~~vy---G~-~~~~~v~-~~l~~---~~~~~~i~~~-~d-----~~~~p~~v~D~a~  190 (290)
                      .+|..|==.+-.|.+.|-.. =.|.+|   +| +|.+||- +|-++   +.-|..-.++ +|     .||   |+.|.++
T Consensus       163 aAK~yA~w~tvNYREAYgL~A~nGILFNHESP~RGetFVTRKITra~a~I~~G~~~~lyLGNLdA~RDWG---hAkDYV~  239 (365)
T TIGR01472       163 AAKLYAYWITVNYREAYGLFAVNGILFNHESPRRGETFVTRKITRAAAKIKLGLQEKLYLGNLDAKRDWG---HAKDYVE  239 (365)
T ss_pred             HHHHHHHHHEEEEECCCCCCHHCCEEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCCCC---CHHHHHH
T ss_conf             9988454310212100341000352104678877885322589999999861563111202754410665---0566999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCH----HEEECCHHH------HC--------
Q ss_conf             999999844202443344313762386667889999999999997279800----057628588------08--------
Q gi|254780921|r  191 AIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS----KVYRIFTKQ------YP--------  252 (290)
Q Consensus       191 ~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~----~i~~~~~~~------~~--------  252 (290)
                      +++.++++-.       ++=|=++ ++...|-.||.+.=|..++.......    ++-.+.+.|      ..        
T Consensus       240 aMWLMLQ~d~-------P~DYViA-TG~t~SVrefve~SF~~~G~~l~W~~~g~~E~G~~~~~dekranalklnlshlkk  311 (365)
T TIGR01472       240 AMWLMLQQDK-------PDDYVIA-TGETHSVREFVEVSFELVGITLEWKDKGIEEVGLIKETDEKRANALKLNLSHLKK  311 (365)
T ss_pred             HHHHHCCCCC-------CCCEEEE-CCCEEEHHHHHHHHHHHCCCEEEECCCCCCEECCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             9887527868-------8976887-5733338889999887409736862688202113012335557777653444137


Q ss_pred             CC-----C---CCCC--CCCC-CHHHHHHHHCCCCC-CHHHHHHHHHHH
Q ss_conf             76-----8---9975--1100-86899996178999-989999999971
Q gi|254780921|r  253 TK-----A---HRPA--YSCL-DCSKLANTHNIRIS-TWKEGVRNILVN  289 (290)
Q Consensus       253 ~~-----a---~RP~--~~~L-d~~K~~~~lg~~~~-~~~e~i~~~i~~  289 (290)
                      +.     -   -||.  |.-+ |++|+++.|||+|. ++++=+++|+++
T Consensus       312 Gk~~V~iD~rYfRPTEVDlL~GD~~KAk~~LgW~~~~~f~~Lvk~Mv~~  360 (365)
T TIGR01472       312 GKVVVEIDPRYFRPTEVDLLLGDATKAKEKLGWKPEVSFEELVKEMVEE  360 (365)
T ss_pred             CCEEEEECCCCCCCHHHHHCCCCCHHHHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             7079996486578514230178834889736882455778999999999


No 34 
>pfam07993 NAD_binding_4 Male sterility protein. This family represents the C-terminal region of the male sterility protein in a number of arabidopsis and drosophila. A sequence-related jojoba acyl CoA reductase is also included.
Probab=99.94  E-value=8.2e-28  Score=175.76  Aligned_cols=182  Identities=22%  Similarity=0.146  Sum_probs=124.0

Q ss_pred             EECCCCHHHHHHHHHHH-C--CCEEEEECHHH--------------------------------CCCC------CHHHHH
Q ss_conf             99788978899999996-4--98599961367--------------------------------0878------999999
Q gi|254780921|r    5 VIGNNGQIAQSLSSMCV-Q--DVEIIRVGRPD--------------------------------IDLL------KPKDFA   43 (290)
Q Consensus         5 VtG~~G~iG~~l~~~l~-~--~~~v~~~~r~~--------------------------------~D~~------~~~~~~   43 (290)
                      |||+|||||++|++.|. .  ..+|+++.|.+                                .|++      +.+.++
T Consensus         1 vTGaTGFlG~~ll~~Ll~~~~~~~V~~LvR~~~~~~~~~r~~~~~~~~~~~~~~~~~~ri~~v~gDl~~~~lGL~~~~~~   80 (245)
T pfam07993         1 LTGATGFLGKVLLEKLLRSCPEVKIYCLVRAKDGESALERLRQELLKYGLFDRLKALERIIPVAGDLSEPNLGLSDEDFQ   80 (245)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCCHHHCCCCEEEEECCCCCCCCCCCHHHHH
T ss_conf             93843599999999999579997899996789840589999999985675310103477799956168865798999999


Q ss_pred             HHHHHCCCCEEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCC---
Q ss_conf             99975599899978634454322332210242012221100011223333-33445532111357554421111222---
Q gi|254780921|r   44 SFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTN---  119 (290)
Q Consensus        44 ~~l~~~~pd~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~---  119 (290)
                      ++.++.  |+||||||..+..   ..++..++.|+.||.+|+++|...+. +++|+||+.|++ .......|+....   
T Consensus        81 ~l~~~v--d~IiH~Aa~v~~~---~~~~~~~~~NV~gt~~ll~~a~~~~~~~~v~vSS~~~~~-~~~~~~~~~~~~~~~~  154 (245)
T pfam07993        81 ELAEEV--DVIIHNAATVNFV---EPYSDLRATNVLGTREVLRLAKQMKKLPFHHVSTAYVNG-ERGGLLEEKPYPLDED  154 (245)
T ss_pred             HHHHCC--CEEEECCEEECCC---CCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCEECC-CCCCCCCCCCCCCCCC
T ss_conf             998359--9999874330356---888999999999999999999976998599995816506-6778766656788876


Q ss_pred             -------CCCCCHHHHHHHHHHHCCCCC--CCCCCCCCCCEECCCCC------CCCEEECCC-CCCCCEEECC--CCCCC
Q ss_conf             -------211101245666653101222--32235554200036863------200020112-4665215304--55454
Q gi|254780921|r  120 -------PLNIYGKSKLAGEEKVASYTN--NYVILRTAWVYSIFGSN------FLLSMLRLA-KERREISVVC--DQFGT  181 (290)
Q Consensus       120 -------P~~~Yg~sK~~~E~~v~~~~~--~~~IlR~~~vyG~~~~~------~v~~~l~~~-~~~~~i~~~~--d~~~~  181 (290)
                             ..+.|+.||+++|++++++..  +..|+|++.|+|+...+      +...++..+ ..+.-..+.+  +.+.+
T Consensus       155 ~~~~~~~~~~~Y~~SK~~aE~lv~~~~~gl~~~I~Rp~~v~G~s~~G~~~~~~~~~~~~~~~~~~g~~p~~~~~~~~~~d  234 (245)
T pfam07993       155 EPALLGGLPNGYTQSKWLAEQLVREAAGGLPVVIYRPSIITGESRTGWINGDDFGPRGLLGGAGLGVLPDILGDPDARLD  234 (245)
T ss_pred             CHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEE
T ss_conf             01103666882899999999999997332998999698786589888706054699999999987997624699885564


Q ss_pred             CCCHHHHHHHH
Q ss_conf             45223689999
Q gi|254780921|r  182 PTSALQIARAI  192 (290)
Q Consensus       182 p~~v~D~a~~i  192 (290)
                      .++|+++|++|
T Consensus       235 ~vpVD~va~ai  245 (245)
T pfam07993       235 LVPVDYVANAI  245 (245)
T ss_pred             EEEHHHHHHHC
T ss_conf             77399997259


No 35 
>TIGR01777 yfcH conserved hypothetical protein TIGR01777; InterPro: IPR010099   This entry represents proteins of unknown function including the Escherichia coli YfcH protein..
Probab=99.93  E-value=3.4e-26  Score=166.69  Aligned_cols=262  Identities=19%  Similarity=0.195  Sum_probs=170.8

Q ss_pred             EEEECC-CCHHHHHHHHHH-HCCCEEEEECHHHC-----------CCCCH-------HHHH-HHHHHCCCCEEEECCCCC
Q ss_conf             999978-897889999999-64985999613670-----------87899-------9999-999755998999786344
Q gi|254780921|r    3 CLVIGN-NGQIAQSLSSMC-VQDVEIIRVGRPDI-----------DLLKP-------KDFA-SFFLSFSPDVIINPAAYT   61 (290)
Q Consensus         3 iLVtG~-~G~iG~~l~~~l-~~~~~v~~~~r~~~-----------D~~~~-------~~~~-~~l~~~~pd~Vih~Aa~~   61 (290)
                      |||||| |||||++|++.| .+||+|+.++|+.-           +..+.       ..-. +.++.  .|+|||+||.+
T Consensus         1 ~litGgnTGfiG~~L~~~L~~~g~~V~~l~R~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~W~~l~~--~DaviNLAG~~   78 (307)
T TIGR01777         1 ILITGGNTGFIGRALTQRLTKSGHEVTILTRSPQAESNTKKVGYKNWLAEGKLGIVIAESGWSALEG--ADAVINLAGEP   78 (307)
T ss_pred             CEECCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCCCHHCCCCCCCCCCCCCCCCCCHHCCCCCCC--CCEEEECCCCC
T ss_conf             9641533023789999999847998999961686432000255445555221245207220566788--62798556888


Q ss_pred             CCC-C--CCCCCCEEEEECCCCCCCCCCCCCCC---CC-CCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             543-2--23322102420122211000112233---33-3344553211--13575544211112222111012456666
Q gi|254780921|r   62 AVD-K--AEDEPEIAFSINAEGAGAIAKAADSI---GI-PCIYISTDYV--FDGLSRTPIDEFSPTNPLNIYGKSKLAGE  132 (290)
Q Consensus        62 ~~~-~--~e~~~~~~~~~Nv~~~~~l~~~~~~~---~~-~~I~iSS~~V--y~g~~~~p~~E~d~~~P~~~Yg~sK~~~E  132 (290)
                      =-+ +  .++..+..++-=+..|+.|+++.++.   .. +=++||.++|  |+-..+.+|+|+++..|-+-| .++++-|
T Consensus        79 i~~P~RWt~~~K~~i~~SRi~~T~~L~~~i~~~~r~~~~P~~~isaSAvGyYG~~~~~~~tE~~~~~~~ddF-la~lc~~  157 (307)
T TIGR01777        79 IADPKRWTEERKQEIRDSRIDTTRALVEAIAAAPRAEQKPKVFISASAVGYYGHSEDRVFTEEDASGPGDDF-LAELCRD  157 (307)
T ss_pred             CCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEEEECCCCCCEEECCCCCCCCCCC-HHHHHHH
T ss_conf             577888787775756523347899999999846566788716885016663068998215116678887772-1899999


Q ss_pred             --HH---HCCCCCCCCCCCCCCCEECCCCCCCCEEECCCC--CCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             --53---101222322355542000368632000201124--66521530455454452236899999999844202443
Q gi|254780921|r  133 --EK---VASYTNNYVILRTAWVYSIFGSNFLLSMLRLAK--ERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDT  205 (290)
Q Consensus       133 --~~---v~~~~~~~~IlR~~~vyG~~~~~~v~~~l~~~~--~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~  205 (290)
                        +.   ..+..-+.+++|++.|.|+.|. ++..|+...+  -|.++ -.+.||.+=+|++|++++|..++++      .
T Consensus       158 WE~~A~~a~~~g~Rvv~~R~G~VLg~~GG-aL~~m~~pf~~glGGpl-G~G~Q~~SWIH~~D~v~~I~~~l~~------~  229 (307)
T TIGR01777       158 WEEAAQAAEQLGTRVVLLRTGIVLGPKGG-ALAKMLPPFRLGLGGPL-GSGRQWFSWIHIEDLVQLILFALEN------A  229 (307)
T ss_pred             HHHHHHHHHHCCCCEEEEEEEEEECCCCC-CHHHHHHHHHHHCCCCC-CCCCCCCCHHHHHHHHHHHHHHHHC------C
T ss_conf             99985105336873898764134708987-03454566765157423-6884145053588999999999855------8


Q ss_pred             CCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCC-CCCCCCCCCC-----HHHHHHHHCCCC--C
Q ss_conf             3443137623866678899999999999972798000576285880876-8997511008-----689999617899--9
Q gi|254780921|r  206 SLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTK-AHRPAYSCLD-----CSKLANTHNIRI--S  277 (290)
Q Consensus       206 ~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~-a~RP~~~~Ld-----~~K~~~~lg~~~--~  277 (290)
                      ...|+||+++- .+++-.||++.+...+    . .+...++|.--.... -++ ....|+     -+|+.+. ||+.  +
T Consensus       230 ~~~Gp~N~tAP-~Pv~n~~F~~~la~~l----~-RP~~~~vP~~~~~~~LGe~-a~~~L~gQrV~P~kl~~~-GF~F~Y~  301 (307)
T TIGR01777       230 SVSGPVNATAP-EPVRNKEFAKALARAL----H-RPAFLPVPAFVLRLLLGEM-ADLLLKGQRVLPEKLLEA-GFQFQYP  301 (307)
T ss_pred             CCCCCEEEECC-CCCCHHHHHHHHHHHH----C-CCCCCCCHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHC-CCEEECC
T ss_conf             99632541078-8635789999999981----8-9701011089999884255-888986578999999974-9766213


Q ss_pred             CHHHHH
Q ss_conf             989999
Q gi|254780921|r  278 TWKEGV  283 (290)
Q Consensus       278 ~~~e~i  283 (290)
                      +++++|
T Consensus       302 ~l~~AL  307 (307)
T TIGR01777       302 DLDEAL  307 (307)
T ss_pred             CCCCCC
T ss_conf             320249


No 36 
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase. Members of this protein family are L-aminoadipate-semialdehyde dehydrogenase (EC 1.2.1.31), product of the LYS2 gene. It is also called alpha-aminoadipate reductase. In fungi, lysine is synthesized via aminoadipate. Currently, all members of this family are fungal.
Probab=99.93  E-value=4.3e-25  Score=160.45  Aligned_cols=223  Identities=17%  Similarity=0.145  Sum_probs=149.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-----CCEEEEECHHH-------------------------------CCCC------CH
Q ss_conf             499997889788999999964-----98599961367-------------------------------0878------99
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-----DVEIIRVGRPD-------------------------------IDLL------KP   39 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-----~~~v~~~~r~~-------------------------------~D~~------~~   39 (290)
                      +||+||+|||+|++|.+.|.+     ..+|+|+-|..                               .|+.      +.
T Consensus       973 ~VlLTGATGFLG~~lL~~LL~~~~~~~~~v~cLVRa~~~~~a~~Rl~~~~~~y~lw~~~~~~Ri~v~~GDLs~p~LGLs~ 1052 (1389)
T TIGR03443       973 TVFLTGATGFLGSFILRDLLTRRSNSNFKVFAHVRAKSEEAGLERLRKTGTTYGIWDEEWASRIEVVLGDLSKEKFGLSD 1052 (1389)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHCCCCCHHCCCCEEEECCCCCCCCCCCCH
T ss_conf             79993876188999999998287878538999967898788999999999871886310115779981777874689699


Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC----------
Q ss_conf             9999999755998999786344543223322102420122211000112233333-34455321113575----------
Q gi|254780921|r   40 KDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIP-CIYISTDYVFDGLS----------  108 (290)
Q Consensus        40 ~~~~~~l~~~~pd~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~-~I~iSS~~Vy~g~~----------  108 (290)
                      +.+..+.+..  |+|||++|..+.-   .....-+..||.||.++++.|...+.| |-|+||..||+...          
T Consensus      1053 ~~~~~La~~v--D~IiHngA~Vn~~---~pY~~Lr~aNV~gT~elLrla~~gr~k~~h~vST~sv~~~~~~~~~~~~~~~ 1127 (1389)
T TIGR03443      1053 EKWSDLTNEV--DVIIHNGALVHWV---YPYSKLRDANVIGTINVLNLCAEGKAKQFSFVSSTSALDTEYYVNLSDELVQ 1127 (1389)
T ss_pred             HHHHHHHHHC--CEEEECCCEECCC---CCHHHHHHCCCHHHHHHHHHHHCCCCCEEEEEECHHHCCCCCCCCCCCCCCC
T ss_conf             9999998416--9999789353467---6688875442278999999985699970699712100687543443210113


Q ss_pred             --CCCCCCCCCCC--C---CCCCHHHHHHHHHHHCCCCCCC---CCCCCCCCEECCCC------CCCCEEECCC-CCCCC
Q ss_conf             --54421111222--2---1110124566665310122232---23555420003686------3200020112-46652
Q gi|254780921|r  109 --RTPIDEFSPTN--P---LNIYGKSKLAGEEKVASYTNNY---VILRTAWVYSIFGS------NFLLSMLRLA-KERRE  171 (290)
Q Consensus       109 --~~p~~E~d~~~--P---~~~Yg~sK~~~E~~v~~~~~~~---~IlR~~~vyG~~~~------~~v~~~l~~~-~~~~~  171 (290)
                        .....|+|+..  +   .+=|+.||+.+|+++++...+.   .|.|++++.|....      +|+-+|++.. +-|.-
T Consensus      1128 ~g~~~~~E~d~l~~~~~~l~~GY~qSKWvaE~lv~~A~~rGlpv~I~RpG~I~G~s~tG~~n~dDf~~r~ikg~iqlG~~ 1207 (1389)
T TIGR03443      1128 AGGAGIPESDDLMGSSKGLGTGYGQSKWVAEYIIREAGKRGLRGCIVRPGYVTGDSKTGATNTDDFLLRMLKGCIQLGLI 1207 (1389)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             57778887765545422257743888999999999999669988997775350168878877788999999999974897


Q ss_pred             EEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             15304554544522368999999998442024433443137623866678899999999999972798
Q gi|254780921|r  172 ISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP  239 (290)
Q Consensus       172 i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~  239 (290)
                      ..+  +...+.|.|+.+|++|.++..+.....   ..++||+++. ..+++.||.    ..+..++-+
T Consensus      1208 P~~--~~~~~~~PVD~va~~iv~~~~~~~~~~---~~~~~h~~~~-~~~~~~~~~----~~~~~~gy~ 1265 (1389)
T TIGR03443      1208 PNI--NNTVNMVPVDHVARVVVAAALNPPKES---ELAVAHVTGH-PRIRFNDFL----GTLKTYGYD 1265 (1389)
T ss_pred             CCC--CCCCCEEEHHHHHHHHHHHHCCCCCCC---CCEEEEECCC-CCCCHHHHH----HHHHHHCCC
T ss_conf             898--884242427689999999872898678---8428983699-975099999----999983998


No 37 
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only]
Probab=99.90  E-value=1.9e-23  Score=151.17  Aligned_cols=270  Identities=19%  Similarity=0.163  Sum_probs=168.1

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHHC----C----CCCHHHHHHHHHHCCCCEEEECCCCCCCCC--CCCCCC
Q ss_conf             999978897889999999-64985999613670----8----789999999997559989997863445432--233221
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDI----D----LLKPKDFASFFLSFSPDVIINPAAYTAVDK--AEDEPE   71 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~~----D----~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~--~e~~~~   71 (290)
                      |+|||||||||++|+..| +.+|+|+.++|+.-    +    ....+.+.+.... .+|+|||+|+.+--++  .++..+
T Consensus         1 IliTGgTGlIG~~L~~~L~~~gh~v~iltR~~~~~~~~~~~~v~~~~~~~~~~~~-~~DavINLAG~~I~~rrWt~~~K~   79 (297)
T COG1090           1 ILITGGTGLIGRALTARLRKGGHQVTILTRRPPKASQNLHPNVTLWEGLADALTL-GIDAVINLAGEPIAERRWTEKQKE   79 (297)
T ss_pred             CEEECCCCCHHHHHHHHHHHCCCEEEEEECCCCCHHHHCCCCCCCCCHHHHCCCC-CCCEEEECCCCCCCCCCCCHHHHH
T ss_conf             9573566501689999998489869999747850233247653343012440367-877899888981544657889999


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCC-CCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCC---CCCCCCCC
Q ss_conf             02420122211000112233333-3445532--111357554421111222211101245666653101---22232235
Q gi|254780921|r   72 IAFSINAEGAGAIAKAADSIGIP-CIYISTD--YVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVAS---YTNNYVIL  145 (290)
Q Consensus        72 ~~~~~Nv~~~~~l~~~~~~~~~~-~I~iSS~--~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~---~~~~~~Il  145 (290)
                      ...+.-+..|+.|.++..+...+ -++||.+  ..|+-..+..++|++++. .++-+..=.+=|+..+.   ..-+.+++
T Consensus        80 ~i~~SRi~~T~~L~e~I~~~~~~P~~~isaSAvGyYG~~~~~~~tE~~~~g-~~Fla~lc~~WE~~a~~a~~~gtRvvll  158 (297)
T COG1090          80 EIRQSRINTTEKLVELIAASETKPKVLISASAVGYYGHSGDRVVTEESPPG-DDFLAQLCQDWEEEALQAQQLGTRVVLL  158 (297)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCEEEECCEEEEECCCCCEEEECCCCCC-CCHHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             999977689999999998526798089852457775588864641578887-7759999999999986664068469999


Q ss_pred             CCCCCEECCCCCCCCEEECCCCC--CCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHH
Q ss_conf             55420003686320002011246--6521530455454452236899999999844202443344313762386667889
Q gi|254780921|r  146 RTAWVYSIFGSNFLLSMLRLAKE--RREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWA  223 (290)
Q Consensus       146 R~~~vyG~~~~~~v~~~l~~~~~--~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~  223 (290)
                      |++.|.|+.|. ++..|+...+-  +.++ -.+.||.+=+|++|++++|..++++      ....|.||+++. .+++..
T Consensus       159 RtGvVLs~~GG-aL~~m~~~fk~glGG~~-GsGrQ~~SWIhieD~v~~I~fll~~------~~lsGp~N~taP-~PV~~~  229 (297)
T COG1090         159 RTGVVLSPDGG-ALGKMLPLFKLGLGGKL-GSGRQWFSWIHIEDLVNAILFLLEN------EQLSGPFNLTAP-NPVRNK  229 (297)
T ss_pred             EEEEEECCCCC-CHHHHCCHHHHCCCCCC-CCCCCEEEEEEHHHHHHHHHHHHHC------CCCCCCCCCCCC-CCCCHH
T ss_conf             88778617886-03431013552257715-8987303433299999999999847------577775103589-867289


Q ss_pred             HHHHHHHHHHHHHCCCCHHEEECCHHHHCCCCCCCCCCCCC-----HHHHHHHHCCCC--CCHHHHHHHHHHH
Q ss_conf             99999999999727980005762858808768997511008-----689999617899--9989999999971
Q gi|254780921|r  224 DFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLD-----CSKLANTHNIRI--STWKEGVRNILVN  289 (290)
Q Consensus       224 e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP~~~~Ld-----~~K~~~~lg~~~--~~~~e~i~~~i~~  289 (290)
                      +|++.+...+.     .+...++++--....--+-.+..|+     -+|+.+. ||+.  ++++++|+++|++
T Consensus       230 ~F~~al~r~l~-----RP~~~~vP~~~~rl~LGe~a~~lL~gQrvlP~kl~~a-GF~F~y~dl~~AL~~il~~  296 (297)
T COG1090         230 EFAHALGRALH-----RPAILPVPSFALRLLLGEMADLLLGGQRVLPKKLEAA-GFQFQYPDLEEALADILKR  296 (297)
T ss_pred             HHHHHHHHHHC-----CCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHC-CCEEECCCHHHHHHHHHHC
T ss_conf             99999999867-----9953569389999985225898863603447999877-9816657799999999726


No 38 
>TIGR01746 Thioester-redct thioester reductase domain; InterPro: IPR010080   This domain includes the C-terminal domain from the fungal alpha aminoadipate reductase enzyme (also known as aminoadipate semialdehyde dehydrogenase) which is involved in the biosynthesis of lysine , as well as the reductase-containing component of the myxochelin biosynthetic gene cluster, MxcG . The mechanism of reduction involves activation of the substrate by adenylation and transfer to a covalently-linked pantetheine cofactor as a thioester. This thioester is then reduced to give an aldehyde (thus releasing the product) and a regenerated pantetheine thiol ; in myxochelin biosynthesis this aldehyde is further reduced to an alcohol or converted to an amine by an aminotransferase. This is a fundamentally different reaction than beta-ketoreductase domains of polyketide synthases which act at a carbonyl two carbons removed from the thioester and forms an alcohol as a product. The majority of bacterial sequences containing this domain are non-ribosomal peptide synthetases in which this domain is similarly located proximal to a thiolation domain (IPR006163 from INTERPRO). In some cases this domain is found at the end of a polyketide synthetase enzyme, but is unlike ketoreductase domains which are found before the thiolase domains. Exceptions to this observed relationship with the thiolase domain include three proteins which consist of stand-alone reductase domains (from Mycobacterium leprae, Anabaena and from Streptomyces coelicolor) and one protein (from Nostoc) which contains N-terminal homology with a small group of hypothetical proteins but no evidence of a thiolation domain next to the putative reductase domain.; GO: 0004043 L-aminoadipate-semialdehyde dehydrogenase activity.
Probab=99.89  E-value=5.2e-23  Score=148.73  Aligned_cols=224  Identities=20%  Similarity=0.194  Sum_probs=147.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HC----CCEEEEECH-HHC-----------------------------------CCC---
Q ss_conf             4999978897889999999-64----985999613-670-----------------------------------878---
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQ----DVEIIRVGR-PDI-----------------------------------DLL---   37 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~----~~~v~~~~r-~~~-----------------------------------D~~---   37 (290)
                      +||+||||||+|.+|.+.| ..    ...|+|+-| .+-                                   |+.   
T Consensus         1 ~vlLTGAtGfLG~~ll~~Ll~~~~s~~~~v~CLVRva~~~~~A~~RL~~~~~Gd~~~l~~~~~~~~~Ri~~~~GDl~~p~   80 (405)
T TIGR01746         1 TVLLTGATGFLGAYLLEELLRRNDSTEAKVICLVRVAKSEEHAMERLREALRGDSYRLWQEDLASIERIEVVAGDLSKPR   80 (405)
T ss_pred             CEEEECCCHHHHHHHHHHHHHCCCCCCEEEEEEEEECCCHHHHHHHHHHHCCCCHHHHHHHHHHHHCCEEEEECCCCCCC
T ss_conf             95873362678999999997204886405687775149879999999851684223322333331136058868746666


Q ss_pred             ---CHHHHHHHH-HHCCCCEEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC-CC-
Q ss_conf             ---999999999-755998999786344543223322102420122211000112233333-34455321113575-54-
Q gi|254780921|r   38 ---KPKDFASFF-LSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIP-CIYISTDYVFDGLS-RT-  110 (290)
Q Consensus        38 ---~~~~~~~~l-~~~~pd~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~-~I~iSS~~Vy~g~~-~~-  110 (290)
                         +...+..+- +....|.|||.||.+++-   .+.+.-...||.||..+++.|.....| |+|+||-.|.+-.. .. 
T Consensus        81 lGL~~~~~~~L~Gqs~~~D~i~HngA~Vn~~---~pY~~Lr~~NV~Gt~~~L~L~~~~~~kpl~yvSt~~v~~~~~~~~~  157 (405)
T TIGR01746        81 LGLSEAEWERLAGQSENVDTIVHNGALVNWV---YPYEELRAANVLGTREVLRLAASGRAKPLHYVSTISVLAAIDLSGG  157 (405)
T ss_pred             CCCCHHHHHHCCCCCEECCEEEECCEEECCC---CCHHHHHHHCCHHHHHHHHHHHCCCCCEEEEECCHHCCCCCCCCCC
T ss_conf             7887167732477730038678364142232---6826652102125999999961589851688524000253436788


Q ss_pred             ----CCCCCCCC-----CCCCCCHHHHHHHHHHHCCCCCC----C---CCCCCCCCEECCC------CCCCCEEECC-CC
Q ss_conf             ----42111122-----22111012456666531012223----2---2355542000368------6320002011-24
Q gi|254780921|r  111 ----PIDEFSPT-----NPLNIYGKSKLAGEEKVASYTNN----Y---VILRTAWVYSIFG------SNFLLSMLRL-AK  167 (290)
Q Consensus       111 ----p~~E~d~~-----~P~~~Yg~sK~~~E~~v~~~~~~----~---~IlR~~~vyG~~~------~~~v~~~l~~-~~  167 (290)
                          ...|+|+.     ...+-|+.||+.+|.+|++...+    .   .|+|+|.|.|...      .+++-.+++. +.
T Consensus       158 ~~~~d~~~~~~~~~~~~~~~~GY~~SKwvaE~lv~~A~~~~PadGl~v~i~RpG~i~g~s~~G~~n~~D~l~r~v~~~~~  237 (405)
T TIGR01746       158 KEEEDVTEDDATVTAPPGLAGGYAQSKWVAELLVREASDRLPADGLPVTIYRPGRILGDSETGAINTSDILWRMVKGCLE  237 (405)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCEECCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             76367620460012677667873034999999999988737745573579827513416336735353088899999874


Q ss_pred             CC--CCEEECCC---CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECC-CCCCCHHHHHHHH
Q ss_conf             66--52153045---545445223689999999984420244334431376238-6667889999999
Q gi|254780921|r  168 ER--REISVVCD---QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTAD-GGPVSWADFAEYI  229 (290)
Q Consensus       168 ~~--~~i~~~~d---~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~-~~~~s~~e~a~~I  229 (290)
                      -|  --...-.|   .....++|+.++++|..+..+....... ...+||+.+. ...++..+|...+
T Consensus       238 ~G~l~~P~~~~Nrqr~~~~~~pVd~~a~ai~~~~~~~~~~~~~-~~~~~~l~~~~~~~~~~~~f~~~~  304 (405)
T TIGR01746       238 LGDLAYPQLDENRQRLTEDLTPVDYVARAIVALSSQPAAEAQA-GGAVFHLVNPEPEPVSLDEFLEWL  304 (405)
T ss_pred             HHCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCHHHHHHHH
T ss_conf             4000046661101213322310999999999999876464327-721787228998565789999999


No 39 
>KOG1372 consensus
Probab=99.87  E-value=9.8e-22  Score=141.55  Aligned_cols=278  Identities=20%  Similarity=0.211  Sum_probs=189.7

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH---------------------------HCCCCCHHHHHHHHHHCCCCEE
Q ss_conf             999978897889999999-649859996136---------------------------7087899999999975599899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP---------------------------DIDLLKPKDFASFFLSFSPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~---------------------------~~D~~~~~~~~~~l~~~~pd~V   54 (290)
                      .||||.||.-|+.|+++| .+|++|-++-|+                           -.|++|...+.+++...+|+-|
T Consensus        31 ALITGItGQDGSYLaEfLL~KgYeVHGiiRRsSsFNT~RIeHlY~nP~~h~~~~mkLHYgDmTDss~L~k~I~~ikPtEi  110 (376)
T KOG1372          31 ALITGITGQDGSYLAEFLLSKGYEVHGIIRRSSSFNTARIEHLYSNPHTHNGASMKLHYGDMTDSSCLIKLISTIKPTEV  110 (376)
T ss_pred             EEEECCCCCCCHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHCCCCCCCCCEEEEEECCCCCHHHHHHHHHCCCCHHH
T ss_conf             99962368872699999870885676788604665345577764584002564047853455543889999860582554


Q ss_pred             EECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             97863445432233221024201222110001122333----33344553211135755442111122221110124566
Q gi|254780921|r   55 INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIG----IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLA  130 (290)
Q Consensus        55 ih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~----~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~  130 (290)
                      .|+||.+.|..+..=|+.+-++...||.+|+++.+.++    +||-+.||+..|+...+.|-+|..|.-|.++|+.+|..
T Consensus       111 YnLaAQSHVkvSFdlpeYTAeVdavGtLRlLdAi~~c~l~~~VrfYQAstSElyGkv~e~PQsE~TPFyPRSPYa~aKmy  190 (376)
T KOG1372         111 YNLAAQSHVKVSFDLPEYTAEVDAVGTLRLLDAIRACRLTEKVRFYQASTSELYGKVQEIPQSETTPFYPRSPYAAAKMY  190 (376)
T ss_pred             HHHHHHCCEEEEECCCHHHEECCCCCHHHHHHHHHHCCCCCCEEEEECCCHHHCCCCCCCCCCCCCCCCCCCHHHHHHHE
T ss_conf             11200032679851422100010200435898998616454526885252765466546875568888889855776441


Q ss_pred             HHHHHCCCCCCCCCCC-CCCCE---ECC-CCCCCCE-EECC-----CCCCCCEEECC-CCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             6653101222322355-54200---036-8632000-2011-----24665215304-5545445223689999999984
Q gi|254780921|r  131 GEEKVASYTNNYVILR-TAWVY---SIF-GSNFLLS-MLRL-----AKERREISVVC-DQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       131 ~E~~v~~~~~~~~IlR-~~~vy---G~~-~~~~v~~-~l~~-----~~~~~~i~~~~-d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      +--++-.+.+-|-..- -+.+|   +|+ |.||+-+ +.+.     +.+.+.+.+-+ +..+.--|..|.+++++.++++
T Consensus       191 ~~WivvNyREAYnmfAcNGILFNHESPRRGenFVTRKItRsvakI~~gqqe~~~LGNL~a~RDWGhA~dYVEAMW~mLQ~  270 (376)
T KOG1372         191 GYWIVVNYREAYNMFACNGILFNHESPRRGENFVTRKITRSVAKISLGQQEKIELGNLSALRDWGHAGDYVEAMWLMLQQ  270 (376)
T ss_pred             EEEEEEEHHHHHCCEEECCEEECCCCCCCCCCHHHHHHHHHHHHHHHCCEEEEEECCHHHHCCCCHHHHHHHHHHHHHHC
T ss_conf             05899884884120131317654778766653135788888878521322257634703420233067799999999713


Q ss_pred             HHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECC-HHH-------HCCCCCCCCC---CCCCHHH
Q ss_conf             4202443344313762386667889999999999997279800057628-588-------0876899751---1008689
Q gi|254780921|r  199 LIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIF-TKQ-------YPTKAHRPAY---SCLDCSK  267 (290)
Q Consensus       199 ~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~-~~~-------~~~~a~RP~~---~~Ld~~K  267 (290)
                      -...       -|-++ .++.-|-.||...-+..+.+......+-...- ..+       ...+--||.-   ..=|.+|
T Consensus       271 d~Pd-------DfViA-Tge~hsVrEF~~~aF~~ig~~l~Weg~gv~~~~~n~~g~v~V~v~~kYyRPtEVd~LqGdasK  342 (376)
T KOG1372         271 DSPD-------DFVIA-TGEQHSVREFCNLAFAEIGEVLNWEGEGVDEVGKNDDGVVRVKVDPKYYRPTEVDTLQGDASK  342 (376)
T ss_pred             CCCC-------CEEEE-CCCCCCHHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCEEEEEECCCCCCCHHHHHHCCCHHH
T ss_conf             7987-------65886-277541999999999863717774355542333367855999966442673022321377677


Q ss_pred             HHHHHCCCCC-CHHHHHHHHHH
Q ss_conf             9996178999-98999999997
Q gi|254780921|r  268 LANTHNIRIS-TWKEGVRNILV  288 (290)
Q Consensus       268 ~~~~lg~~~~-~~~e~i~~~i~  288 (290)
                      +++.|||+|. .+.|=+++++.
T Consensus       343 Ak~~LgW~pkv~f~eLVkeMv~  364 (376)
T KOG1372         343 AKKTLGWKPKVTFPELVKEMVA  364 (376)
T ss_pred             HHHHCCCCCCCCHHHHHHHHHH
T ss_conf             6664099875768999999998


No 40 
>pfam05368 NmrA NmrA-like family. NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA. NmrA is part of a system controlling nitrogen metabolite repression in fungi. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families.
Probab=99.87  E-value=1.8e-21  Score=140.10  Aligned_cols=199  Identities=19%  Similarity=0.172  Sum_probs=133.0

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH-----------------HCCCCCHHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             999978897889999999-649859996136-----------------70878999999999755998999786344543
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-----------------DIDLLKPKDFASFFLSFSPDVIINPAAYTAVD   64 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-----------------~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~   64 (290)
                      ||||||||++|+++++.| ++|++|.++.|+                 +.|+.|++++.+.|+..  |+|||+++...  
T Consensus         1 IlV~GatG~iG~~vv~~L~~~g~~Vr~l~R~~~~~~~~~l~~~gve~v~gD~~d~~sl~~al~gv--d~v~~~~~~~~--   76 (232)
T pfam05368         1 ILVFGATGYQGGSVVRASLKAGHPVRALVRDPKSELAKSLKAAGVELVEGDLDDHESLVEALKGV--DVVFSVTGFWL--   76 (232)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHCCCEEEEECCCCHHHHHHHHCCC--CEEEEECCCCC--
T ss_conf             09989682899999999985899389997187366566664179889990688878999996799--88999158874--


Q ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCC
Q ss_conf             22332210242012221100011223333-33445532111357554421111222211101245666653101222322
Q gi|254780921|r   65 KAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYV  143 (290)
Q Consensus        65 ~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~~~~  143 (290)
                                ..++....+++++|++.|+ ++||.|....        ..+..+..|..+|..+|.++|+.+++..-++.
T Consensus        77 ----------~~~~~~~~~~~~AA~~aGVk~~V~ss~~~~--------~~~~~~~~~~~~~~~~K~~~e~~l~~~g~~~t  138 (232)
T pfam05368        77 ----------SKEIEDGKKLADAAKEAGVKHFIPSEFGND--------VDRSNGVEPAVPHFDSKAEVERYIRALGIPYT  138 (232)
T ss_pred             ----------CHHHHHHHHHHHHHHHCCCCCEEEEEECCC--------CCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEE
T ss_conf             ----------177999999999999739983455550125--------54567666552788989999999998199859


Q ss_pred             CCCCCCCEECCCCCCCCEEECCCCCCCCEEECCC---CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCC
Q ss_conf             3555420003686320002011246652153045---5454452236899999999844202443344313762386667
Q gi|254780921|r  144 ILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD---QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPV  220 (290)
Q Consensus       144 IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d---~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~  220 (290)
                      |+|+++.++...+.+...+ ..........+..+   ....+++++|+++++..++.....     ..|.|...++ +.+
T Consensus       139 ilrp~~f~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~Dva~~~~~~l~~p~~-----~~~~~~~~~~-~~l  211 (232)
T pfam05368       139 FVYAGFFMGNFLSNLAPPG-DLAPPRDKVTLLGPGNPKAVPLDDEEDIGTYVIKILDDPRK-----LKGKYIRPPG-NIL  211 (232)
T ss_pred             EEECCCHHHHHHHHHHHHH-HCCCCCCEEEEECCCCCCEEEEEEHHHHHHHHHHHHCCHHH-----CCCEEEEECC-CCC
T ss_conf             9968425430165654432-02576536999448987611265288999999999649121-----1999998289-867


Q ss_pred             CHHHHHHHHH
Q ss_conf             8899999999
Q gi|254780921|r  221 SWADFAEYIF  230 (290)
Q Consensus       221 s~~e~a~~I~  230 (290)
                      |..|+++.+.
T Consensus       212 T~~Eia~~~~  221 (232)
T pfam05368       212 SGNEIAELWS  221 (232)
T ss_pred             CHHHHHHHHH
T ss_conf             9999999999


No 41 
>KOG2865 consensus
Probab=99.85  E-value=3.7e-21  Score=138.32  Aligned_cols=207  Identities=18%  Similarity=0.213  Sum_probs=149.3

Q ss_pred             EEEECCCCHHHHHHHHHHHC-CCEEEEECHH--------------------HCCCCCHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             99997889788999999964-9859996136--------------------70878999999999755998999786344
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRP--------------------DIDLLKPKDFASFFLSFSPDVIINPAAYT   61 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~--------------------~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~   61 (290)
                      .-|.|+|||+|+.+++.|.+ |-+++..-|.                    ++|+.|+++++++++..  ++|||+.+--
T Consensus        64 aTVFGAtGFlGryvvnklak~GSQviiPyR~d~~~~r~lkvmGdLGQvl~~~fd~~DedSIr~vvk~s--NVVINLIGrd  141 (391)
T KOG2865          64 ATVFGATGFLGRYVVNKLAKMGSQVIIPYRGDEYDPRHLKVMGDLGQVLFMKFDLRDEDSIRAVVKHS--NVVINLIGRD  141 (391)
T ss_pred             EEEECCCCCCCHHHHHHHHHCCCEEEEECCCCCCCHHHEEECCCCCCEEEECCCCCCHHHHHHHHHHC--CEEEEEECCC
T ss_conf             99852644120899998863587699853588644545000254333456416777879999998747--5799840353


Q ss_pred             CCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             54322332210242012221100011223333-33445532111357554421111222211101245666653101222
Q gi|254780921|r   62 AVDKAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus        62 ~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~  140 (290)
                          .|...-..+.+|+.+.+.|++.|++.|+ |+||+|+-    |..         ...-|.|=++|.++|..+++..+
T Consensus       142 ----~eTknf~f~Dvn~~~aerlAricke~GVerfIhvS~L----gan---------v~s~Sr~LrsK~~gE~aVrdafP  204 (391)
T KOG2865         142 ----YETKNFSFEDVNVHIAERLARICKEAGVERFIHVSCL----GAN---------VKSPSRMLRSKAAGEEAVRDAFP  204 (391)
T ss_pred             ----CCCCCCCCCCCCCHHHHHHHHHHHHHCHHHEEEHHHC----CCC---------CCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             ----4458866120014589999999986283525416545----665---------45767887765323799986387


Q ss_pred             CCCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCC---CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCC
Q ss_conf             3223555420003686320002011246652153045---5454452236899999999844202443344313762386
Q gi|254780921|r  141 NYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD---QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADG  217 (290)
Q Consensus       141 ~~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d---~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~  217 (290)
                      +.+|+|++.+||.-++ |++.+....+.=..+.+.+-   -+-.|+||-|+|.+|...++-.     ....-+|-++|. 
T Consensus       205 eAtIirPa~iyG~eDr-fln~ya~~~rk~~~~pL~~~GekT~K~PVyV~DVaa~IvnAvkDp-----~s~Gktye~vGP-  277 (391)
T KOG2865         205 EATIIRPADIYGTEDR-FLNYYASFWRKFGFLPLIGKGEKTVKQPVYVVDVAAAIVNAVKDP-----DSMGKTYEFVGP-  277 (391)
T ss_pred             CCEEECHHHHCCCCHH-HHHHHHHHHHHCCCEEEECCCCCEEECCEEEEHHHHHHHHHCCCC-----CCCCCEEEECCC-
T ss_conf             4435242551155136-778999998733734510477514634578751889999860394-----225845661387-


Q ss_pred             CCCCHHHHHHHHHHHHHH
Q ss_conf             667889999999999997
Q gi|254780921|r  218 GPVSWADFAEYIFWESAE  235 (290)
Q Consensus       218 ~~~s~~e~a~~I~~~~~~  235 (290)
                      ..-...|++..+.+.+.+
T Consensus       278 ~~yql~eLvd~my~~~~~  295 (391)
T KOG2865         278 DRYQLSELVDIMYDMARE  295 (391)
T ss_pred             CHHHHHHHHHHHHHHHHH
T ss_conf             221099999999999754


No 42 
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=99.83  E-value=3.8e-21  Score=138.23  Aligned_cols=150  Identities=22%  Similarity=0.201  Sum_probs=108.4

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HC-CCEEEEECHHH-------------------------------CCCC------CHHH
Q ss_conf             94999978897889999999-64-98599961367-------------------------------0878------9999
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQ-DVEIIRVGRPD-------------------------------IDLL------KPKD   41 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~-~~~v~~~~r~~-------------------------------~D~~------~~~~   41 (290)
                      |++|+||+|||+|.+|...| .. ...|+|+-|.+                               .|+.      +...
T Consensus         1 ~~vlLTGATGFLG~yLl~eLL~~~~~kv~cLVRA~s~E~a~~RL~~~~~~~~~~~e~~~~ri~vv~gDl~e~~lGL~~~~   80 (382)
T COG3320           1 RNVLLTGATGFLGAYLLLELLDRSDAKVICLVRAQSDEAALARLEKTFDLYRHWDELSADRVEVVAGDLAEPDLGLSERT   80 (382)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCHHH
T ss_conf             91899457027699999999716887289998227779999999997655301344302537998134445568987889


Q ss_pred             HHHHHHHCCCCEEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCC----CCCCC
Q ss_conf             99999755998999786344543223322102420122211000112233333-34455321113575544----21111
Q gi|254780921|r   42 FASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIP-CIYISTDYVFDGLSRTP----IDEFS  116 (290)
Q Consensus        42 ~~~~l~~~~pd~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~-~I~iSS~~Vy~g~~~~p----~~E~d  116 (290)
                      +.++-+..  |.|||+||..+.-   ....+-+..||.||..+++.|...+.| ++|+||.+|++......    .+|.+
T Consensus        81 ~~~La~~v--D~I~H~gA~Vn~v---~pYs~L~~~NVlGT~evlrLa~~gk~Kp~~yVSsisv~~~~~~~~~~~~~~~~~  155 (382)
T COG3320          81 WQELAENV--DLIIHNAALVNHV---FPYSELRGANVLGTAEVLRLAATGKPKPLHYVSSISVGETEYYSNFTVDFDEIS  155 (382)
T ss_pred             HHHHHHHC--CEEEECCHHHCCC---CCHHHHCCCCHHHHHHHHHHHHCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCC
T ss_conf             99986320--3577543244355---768873476457699999999617984049971001145324677753312245


Q ss_pred             CC-----CCCCCCHHHHHHHHHHHCCCCCC---CCCCCCCCCEECCC
Q ss_conf             22-----22111012456666531012223---22355542000368
Q gi|254780921|r  117 PT-----NPLNIYGKSKLAGEEKVASYTNN---YVILRTAWVYSIFG  155 (290)
Q Consensus       117 ~~-----~P~~~Yg~sK~~~E~~v~~~~~~---~~IlR~~~vyG~~~  155 (290)
                      +.     .+.+.|++||+.+|.++++..++   ..|.|++.+-|+..
T Consensus       156 ~~~~~~~~~~~GY~~SKwvaE~Lvr~A~~rGLpv~I~Rpg~I~gds~  202 (382)
T COG3320         156 PTRNVGQGLAGGYGRSKWVAEKLVREAGDRGLPVTIFRPGYITGDSR  202 (382)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCEEECCCC
T ss_conf             32245676678841238999999999866389769981672411676


No 43 
>KOG1221 consensus
Probab=99.79  E-value=2.6e-18  Score=122.32  Aligned_cols=223  Identities=21%  Similarity=0.273  Sum_probs=138.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHCC----CEEEEECHHH------------------------------------CCCCC---
Q ss_conf             4999978897889999999649----8599961367------------------------------------08789---
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQD----VEIIRVGRPD------------------------------------IDLLK---   38 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~~----~~v~~~~r~~------------------------------------~D~~~---   38 (290)
                      .|||||||||+|..+++.|..-    ..++-+-|.+                                    .|+++   
T Consensus        14 ~i~vTG~tGFlgKVliEklLr~~p~v~~IYlLiR~k~g~~~~~Rl~~~~~~~lF~~l~~~~p~~l~Kv~pi~GDi~~~~L   93 (467)
T KOG1221          14 TIFVTGATGFLGKVLIEKLLRTTPDVKRIYLLIRAKKGKAAQERLRTELKDPLFEVLKEKKPEALEKVVPIAGDISEPDL   93 (467)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEECCEECCCCCCCCCC
T ss_conf             59997276345789999998507676569999834789877899999874469999986395210200001256668666


Q ss_pred             ---HHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCC---CCC
Q ss_conf             ---9999999975599899978634454322332210242012221100011223333--33445532111357---554
Q gi|254780921|r   39 ---PKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI--PCIYISTDYVFDGL---SRT  110 (290)
Q Consensus        39 ---~~~~~~~l~~~~pd~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~--~~I~iSS~~Vy~g~---~~~  110 (290)
                         ........  ..+++|||+||.++.|.   -.+.+..+|+.||.++.+.|++...  -++|+||+++--..   .+.
T Consensus        94 Gis~~D~~~l~--~eV~ivih~AAtvrFde---~l~~al~iNt~Gt~~~l~lak~~~~l~~~vhVSTAy~n~~~~~i~E~  168 (467)
T KOG1221          94 GISESDLRTLA--DEVNIVIHSAATVRFDE---PLDVALGINTRGTRNVLQLAKEMVKLKALVHVSTAYSNCNVGHIEEK  168 (467)
T ss_pred             CCCHHHHHHHH--HCCCEEEEEEEEECCCH---HHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEHHHEECCCCCCCCC
T ss_conf             88827788887--45778999530422553---66565422227489999999985211268984212222466652102


Q ss_pred             CCCCCCCCC--------------------------CCCCCHHHHHHHHHHHCCCCCC--CCCCCCCCCEECCCCCCCCEE
Q ss_conf             421111222--------------------------2111012456666531012223--223555420003686320002
Q gi|254780921|r  111 PIDEFSPTN--------------------------PLNIYGKSKLAGEEKVASYTNN--YVILRTAWVYSIFGSNFLLSM  162 (290)
Q Consensus       111 p~~E~d~~~--------------------------P~~~Yg~sK~~~E~~v~~~~~~--~~IlR~~~vyG~~~~~~v~~~  162 (290)
                      ||.+...++                          +-|.|--||..+|+++.+...+  .+|+|++.+.+....-|..|+
T Consensus       169 ~y~~~~~~~~~~~i~~~~~~~~~~ld~~~~~l~~~~PNTYtfTKal~E~~i~~~~~~lPivIiRPsiI~st~~EP~pGWi  248 (467)
T KOG1221         169 PYPMPETCNPEKILKLDENLSDELLDQKAPKLLGGWPNTYTFTKALAEMVIQKEAENLPLVIIRPSIITSTYKEPFPGWI  248 (467)
T ss_pred             CCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCEEEHHHHHHHHHHHHCCCCCEEEECCCCEECCCCCCCCCCC
T ss_conf             56764558988887643222189998764775089998630118658999985264898699748741013337998703


Q ss_pred             ECC--------CCCCCCEEEC---CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECC-CCCCCHHHHHHHH
Q ss_conf             011--------2466521530---45545445223689999999984420244334431376238-6667889999999
Q gi|254780921|r  163 LRL--------AKERREISVV---CDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTAD-GGPVSWADFAEYI  229 (290)
Q Consensus       163 l~~--------~~~~~~i~~~---~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~-~~~~s~~e~a~~I  229 (290)
                      -..        +...+.++.+   .+.....+.++.++.+++....+..........-|||++++ ..+++|-+|....
T Consensus       249 dn~~gp~g~i~g~gkGvlr~~~~d~~~vadiIPvD~vvN~~ia~~~~~~~~~~~~~~~IY~~tss~~Np~t~~~~~e~~  327 (467)
T KOG1221         249 DNLNGPDGVIIGYGKGVLRCFLVDPKAVADIIPVDMVVNAMIASAWQHAGNSKEKTPPIYHLTSSNDNPVTWGDFIELA  327 (467)
T ss_pred             CCCCCCCEEEEEECCCEEEEEEECCCCCCCEEEHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCCCHHHHHHHH
T ss_conf             2687875478985022599998765546655128999999999999985048889986798535565761089999999


No 44 
>PRK12320 hypothetical protein; Provisional
Probab=99.70  E-value=3.2e-16  Score=110.50  Aligned_cols=230  Identities=13%  Similarity=0.181  Sum_probs=144.7

Q ss_pred             CEEEEECCCCHHHHHHHH-HHHCCCEEEEECHHH------------CCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCC
Q ss_conf             949999788978899999-996498599961367------------0878999999999755998999786344543223
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSS-MCVQDVEIIRVGRPD------------IDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAE   67 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~-~l~~~~~v~~~~r~~------------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~~e   67 (290)
                      |+|+|||++|-+|+-+.. ++.+||+|+++.|..            .|++| ..+.++...  .|+|+|||=.   +.  
T Consensus         1 M~i~VT~A~G~lGR~la~rLla~GH~V~Giar~r~~s~~~~~dFV~A~iRd-~v~~el~~~--AD~V~HlA~~---~~--   72 (699)
T PRK12320          1 MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLRN-PVLQELAGE--ADAVIHLAPV---DT--   72 (699)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCEEECHHHH-HHHHHHCCC--CCEEEEECCC---CC--
T ss_conf             947883462156778999998668724544047986667545554211230-999974045--5548882255---68--


Q ss_pred             CCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             32210242012221100011223333334455321113575544211112222111012456666531012223223555
Q gi|254780921|r   68 DEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRT  147 (290)
Q Consensus        68 ~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~~~~IlR~  147 (290)
                      .-|.   .+|..|+.|+++++.+.|.+++|+||+.   |..+             .|    .-+|+++.+.....+.+|.
T Consensus        73 ~~p~---~~~idG~a~V~~A~a~~G~R~vfvs~Aa---g~p~-------------ly----r~~E~lva~~~~~~v~iR~  129 (699)
T PRK12320         73 SAPG---GVGITGLAHVANAAARAGARLLFVSQAA---GRPE-------------LY----RQAETLVSTGWAPSLVIRI  129 (699)
T ss_pred             CCCC---CCCCHHHHHHHHHHHHHCCCEEEEECCC---CCHH-------------HC----CHHHHHHHCCCCCEEEEEE
T ss_conf             9998---5463668899999986188179860578---9803-------------31----5799998624886069996


Q ss_pred             CCCEECCCCCCCCEEECC-CCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHH
Q ss_conf             420003686320002011-2466521530455454452236899999999844202443344313762386667889999
Q gi|254780921|r  148 AWVYSIFGSNFLLSMLRL-AKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFA  226 (290)
Q Consensus       148 ~~vyG~~~~~~v~~~l~~-~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a  226 (290)
                      ..+.|.+=+|++.+++.. +..+.+     ++.-..+|.+|+.+.+...+..       .-.|+.|+..- +.++.    
T Consensus       130 A~~vGR~lD~~V~R~~A~~~~~~~S-----a~pmqVvHlDD~~R~Lv~Al~~-------~~sGvVnLAap-~~~~~----  192 (699)
T PRK12320        130 APPVGRQLDWMVCRTVATLLRSKVS-----ARPIRVLHLDDLVRFLVLALNT-------DRNGVVDLATP-DTTNV----  192 (699)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCC-----CCCEEEEEHHHHHHHHHHHHHC-------CCCCCEEECCC-CCCHH----
T ss_conf             1554531678999875323267777-----6722787577799999999824-------67774331489-85159----


Q ss_pred             HHHHHHHHHHCCCCHHEEECCHHHHCCCCCCCCCCCCCHHHHHHHHCCCCC-CHHHHHHHH
Q ss_conf             999999997279800057628588087689975110086899996178999-989999999
Q gi|254780921|r  227 EYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRIS-TWKEGVRNI  286 (290)
Q Consensus       227 ~~I~~~~~~~~~~~~~i~~~~~~~~~~~a~RP~~~~Ld~~K~~~~lg~~~~-~~~e~i~~~  286 (290)
                       .+.....+...+..+...+.+..  ..+     ..||...+++.-+|+|- .-.|+|.++
T Consensus       193 -~~a~~llr~~~P~~r~~Rv~s~a--~l~-----P~mD~a~~qe~W~F~~~W~a~eav~D~  245 (699)
T PRK12320        193 -VTAWRLLRSVDPHLRTRRVRSWE--QLI-----PEVDIAAVQEDWNFEFGWQATEAIVDT  245 (699)
T ss_pred             -HHHHHHHCCCCCCCCCCCCCCHH--HHC-----CHHHHHHHHHHHCCCCCCCHHHHHHHH
T ss_conf             -99999717778433444577577--736-----245588777864888342247788764


No 45 
>PRK05865 hypothetical protein; Provisional
Probab=99.66  E-value=8.7e-16  Score=108.07  Aligned_cols=233  Identities=16%  Similarity=0.204  Sum_probs=149.5

Q ss_pred             CEEEEECCCCHHHHHHHH-HHHCCCEEEEECHH------------HCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCC
Q ss_conf             949999788978899999-99649859996136------------70878999999999755998999786344543223
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSS-MCVQDVEIIRVGRP------------DIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAE   67 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~-~l~~~~~v~~~~r~------------~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~~e   67 (290)
                      |+|+|||++|.+|+-+.. ++.+||+|+++.|.            ..|++|...++..+...  |+|+|||=...     
T Consensus         1 M~i~VT~A~G~lGR~va~qLia~GH~V~GIAr~r~~~~~~~~DFV~A~iRd~~~~~~a~~~A--D~V~H~A~~~~-----   73 (854)
T PRK05865          1 MRIAVTGASGVLGRGLTARLLSQGHEVVGIARHRPDSWPSSADFIAADIRDATAVESAMTGA--DVVAHCAWVRG-----   73 (854)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCEEECCCCCHHHHHHHHCCC--CEEEEECCCCC-----
T ss_conf             93788336215777899999866872455405798656755666632334789998752466--54898312158-----


Q ss_pred             CCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             32210242012221100011223333334455321113575544211112222111012456666531012223223555
Q gi|254780921|r   68 DEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRT  147 (290)
Q Consensus        68 ~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~~~~IlR~  147 (290)
                        +  .-.+|..|+.|+++++.+.|.+.||+||+.      +                  +...|+++.......+.+|.
T Consensus        74 --~--~~~~~idG~a~V~~A~a~aG~r~i~~sqsa------~------------------~~~~e~~la~sg~~~v~iR~  125 (854)
T PRK05865         74 --R--NDHINIDGTANVLKAMAETGTGRIVFTSSG------H------------------QPRVEQMLADCGLEWVAVRC  125 (854)
T ss_pred             --C--CCCCCCHHHHHHHHHHHHHCCCEEEEECCC------C------------------CHHHHHHHHHCCCCEEEEEE
T ss_conf             --8--764462768899999986188369981588------8------------------56699999853897169996


Q ss_pred             CCCEECCCCCCCCEEEC--CCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHH
Q ss_conf             42000368632000201--1246652153045545445223689999999984420244334431376238666788999
Q gi|254780921|r  148 AWVYSIFGSNFLLSMLR--LAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADF  225 (290)
Q Consensus       148 ~~vyG~~~~~~v~~~l~--~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~  225 (290)
                      .-+.|.+=+|++.+.+.  .+..+-     .|+.-..+|.+|+.+.+...+..     ...-.|+.|+..- +.++..  
T Consensus       126 A~~vGR~lD~~V~R~~Al~~~~~~~-----s~~pmrVlHlDD~~R~Lv~Al~t-----~~~~sGvVdLAap-~~~~~~--  192 (854)
T PRK05865        126 ALIFGRNVDNWVQRLFALPVLPAGY-----ADRVVQVVHSDDAQRLLVRALLD-----TVIDSGPVNLAAP-GELTFR--  192 (854)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCC-----CCCCEEEEEHHHHHHHHHHHHHC-----CCCCCCCEEECCC-CCCCHH--
T ss_conf             1554531578999887664134655-----66633787577899999999732-----6666762332489-976199--


Q ss_pred             HHHHHHHHHHHCCCC--HHEEECCH-HHHCCCCCCCCCCCCCHHHHHHHHCCCCC-CHHHHHHHH
Q ss_conf             999999999727980--00576285-88087689975110086899996178999-989999999
Q gi|254780921|r  226 AEYIFWESAERGGPY--SKVYRIFT-KQYPTKAHRPAYSCLDCSKLANTHNIRIS-TWKEGVRNI  286 (290)
Q Consensus       226 a~~I~~~~~~~~~~~--~~i~~~~~-~~~~~~a~RP~~~~Ld~~K~~~~lg~~~~-~~~e~i~~~  286 (290)
                        .|...+.+-..+.  ..+..+.+ .++...-.   -..||...+++.-+|+|- .-.|+|.++
T Consensus       193 --~~a~~L~r~~~~~~~~~~~Rv~s~aqL~~~~~---~P~mD~a~~qedW~F~~~W~a~eav~D~  252 (854)
T PRK05865        193 --RIAAALGRPMVPIGSPVLRRVTSFAELELLHS---APLMDVTLLRDRWGFQPAWNAEECLEDF  252 (854)
T ss_pred             --HHHHHHCCCCCCCCCCCCCCCCCHHHHHHHCC---CCCHHHHHHHHHHCCCCCCCHHHHHHHH
T ss_conf             --99999658876446665322368898634128---8602278776764888342157888876


No 46 
>PRK07578 short chain dehydrogenase; Provisional
Probab=99.65  E-value=6.4e-16  Score=108.84  Aligned_cols=175  Identities=19%  Similarity=0.179  Sum_probs=119.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCCEEEEECHHH----CCCCCHHHHHHHHHHC-CCCEEEECCCCCCCC----CCCCCCC
Q ss_conf             949999788978899999996498599961367----0878999999999755-998999786344543----2233221
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPD----IDLLKPKDFASFFLSF-SPDVIINPAAYTAVD----KAEDEPE   71 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~~~v~~~~r~~----~D~~~~~~~~~~l~~~-~pd~Vih~Aa~~~~~----~~e~~~~   71 (290)
                      |||||||+++=||+++++.|.++++|+..+|+.    +|++|++++++++++. +.|++||+|+.....    ..+.+.+
T Consensus         1 MrVlVTGas~GIG~aia~~la~~~~vv~~~r~~~~~~~Dvtd~~~v~~~~~~~G~iD~lVnnAG~~~~~~~~~~~~e~~~   80 (199)
T PRK07578          1 MKILVIGASGTIGRAVVAELSARHEVITAGRSSGDVQVDITDPASIRALFEKVGKVDAVVSAAGKVHFAPLTEMTDEDFQ   80 (199)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCEEEECCCHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHCCHHHHH
T ss_conf             97999998748999999999679998998368677568588999999999962999899988722679894879998977


Q ss_pred             EEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCC-CCCCC
Q ss_conf             0242012221100011223---3333344553211135755442111122221110124566665310122232-23555
Q gi|254780921|r   72 IAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNY-VILRT  147 (290)
Q Consensus        72 ~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~~~-~IlR~  147 (290)
                      ..+++|+.++.++++.+..   .+-.+|.+||..-+     .|..      -...|+.+|.+.+.+.+..+... -=+|.
T Consensus        81 ~~~~~nl~g~~~l~~~~~~~l~~gGsIv~isS~~~~-----~~~~------~~~~Y~asKaal~~ltr~lA~El~~gIRV  149 (199)
T PRK07578         81 LGLQSKLMGQINLVLIGQEYLNDGGSFTLTSGILSE-----EPIP------GGASAATVNGALEGFVKAAALELPRGIRI  149 (199)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEHHEE-----CCCC------CCHHHHHHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             787200138999999999987608985688313000-----7688------81899999999999999999974879799


Q ss_pred             CCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             42000368632000201124665215304554544522368999999998
Q gi|254780921|r  148 AWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAH  197 (290)
Q Consensus       148 ~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~  197 (290)
                      ..|    .|+++.+-++.....  .+     .+.|....|+|.+.+.-.+
T Consensus       150 N~V----aPG~V~T~m~~~~~~--~~-----~~~~~~~~~~A~a~l~~~~  188 (199)
T PRK07578        150 NVV----SPTVLTESLDKYGPF--FP-----GFEPVPAADVALAYLRSVE  188 (199)
T ss_pred             EEE----ECCCCCCHHHHCCCC--CC-----CCCCCCHHHHHHHHHHHHC
T ss_conf             998----568655656655554--89-----9998799999999997422


No 47 
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family. This family consists of fungal proteins of unknown function associated with secondary metabolite biosynthesis, such as of the ergot alkaloids such as ergovaline. Nomenclature differs because gene order differs - this is EasG in Neotyphodium lolii but is designated ergot alkaloid biosynthetic protein A in several other fungi.
Probab=99.62  E-value=6.6e-15  Score=103.12  Aligned_cols=240  Identities=15%  Similarity=0.171  Sum_probs=147.1

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH------------HCCCCCHHHHHHHHHHC-----CCCEEEECCCCCCCC
Q ss_conf             999978897889999999-649859996136------------70878999999999755-----998999786344543
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP------------DIDLLKPKDFASFFLSF-----SPDVIINPAAYTAVD   64 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~------------~~D~~~~~~~~~~l~~~-----~pd~Vih~Aa~~~~~   64 (290)
                      |||||+||.+|+++++.| ..|++|....|+            ++|+.|++.+...+...     ..+.++.+.... ++
T Consensus         2 IlVtGATG~iG~~v~~~L~~~g~~v~~~~R~~~~~~~~~~~~v~~d~~d~~~~~~a~~~~d~~~~~v~~v~l~~p~~-~~   80 (285)
T TIGR03649         2 ILLTGGTGKTASRIARLLQAASVPFLVASRSSSSSAGPNEKHVKFDWLDEDTWDNPFSSDDGMEPEISAVYLVAPPI-PD   80 (285)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCC-CC
T ss_conf             89998998189999999986899789995885664666675368644481148889763532312741899838998-77


Q ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCC
Q ss_conf             22332210242012221100011223333-33445532111357554421111222211101245666653101222322
Q gi|254780921|r   65 KAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYV  143 (290)
Q Consensus        65 ~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~~~~  143 (290)
                             .     .....+++++++..|+ ++||+|...+-   ..         .|    ...+.. |.+....+-+|+
T Consensus        81 -------~-----~~~~~~~i~aA~~aGV~~iV~lS~~~~~---~~---------~~----~~~~~~-~~~~~~sg~~~t  131 (285)
T TIGR03649        81 -------L-----APPMIKFIDFARSKGVRRFVLLSASIIE---KG---------GP----AMGQVH-AHLDSLGGVEYT  131 (285)
T ss_pred             -------H-----HHHHHHHHHHHHHCCCCEEEEEECCCCC---CC---------CC----CCHHHH-HHHHHHCCCCEE
T ss_conf             -------6-----7899999999998499889998303566---79---------86----103899-999973699769


Q ss_pred             CCCCCCCEECCCCCCCCEE-ECCCCCCCCEE-ECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCC
Q ss_conf             3555420003686320002-01124665215-304554544522368999999998442024433443137623866678
Q gi|254780921|r  144 ILRTAWVYSIFGSNFLLSM-LRLAKERREIS-VVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVS  221 (290)
Q Consensus       144 IlR~~~vyG~~~~~~v~~~-l~~~~~~~~i~-~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s  221 (290)
                      |||+++.+    .||...+ ...+++...+. ..+|...+++..+|+|++...++....     ...++|.++|. +.+|
T Consensus       132 iLRp~~fm----~N~~~~~~~~~i~~~g~~~~~~gd~~~~~V~~~DiA~vaa~~L~~~~-----~~~~~~~ltGp-e~lt  201 (285)
T TIGR03649       132 VLRPTWFM----ENFSEEFHVEAIRKENKIYSATGDGKIPFVSADDIARVAYRALTDKV-----APNTDYVVLGP-ELLT  201 (285)
T ss_pred             EEECHHHH----HHHHHHHHHHHHHHCCEEECCCCCCCCCCCCHHHHHHHHHHHHCCCC-----CCCCEEEEECC-CCCC
T ss_conf             99663998----75056665899974897844478877573558789999999974977-----68977998688-6579


Q ss_pred             HHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCC---CCCCCC--------------CCC--CHHHHHHHHCCCCCCHHHH
Q ss_conf             899999999999972798000576285880876---899751--------------100--8689999617899998999
Q gi|254780921|r  222 WADFAEYIFWESAERGGPYSKVYRIFTKQYPTK---AHRPAY--------------SCL--DCSKLANTHNIRISTWKEG  282 (290)
Q Consensus       222 ~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~---a~RP~~--------------~~L--d~~K~~~~lg~~~~~~~e~  282 (290)
                      ..|+++.+    .+..++..+..+++.+++...   .-=|.+              ..+  -..-+++.+|-+|+++++=
T Consensus       202 ~~eiA~~l----s~vlGr~V~y~~v~~~~~~~~l~~~G~p~~~a~~~~~~~~~~~~G~~~~~t~~v~~l~Gr~p~s~~~f  277 (285)
T TIGR03649       202 YDDVAEIL----SRVLGRKITHVKLTEEELAQRLQSFGMPEDLARMLASLDTAVKNGAEVRLNDVVKAVTGSKPRGFRDF  277 (285)
T ss_pred             HHHHHHHH----HHHHCCCEEEEECCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCHHHH
T ss_conf             99999999----99879922788599999999998749999999999999999976987787887889749399789999


Q ss_pred             HHHH
Q ss_conf             9999
Q gi|254780921|r  283 VRNI  286 (290)
Q Consensus       283 i~~~  286 (290)
                      +++-
T Consensus       278 ~~e~  281 (285)
T TIGR03649       278 AESN  281 (285)
T ss_pred             HHHH
T ss_conf             9998


No 48 
>PRK08219 short chain dehydrogenase; Provisional
Probab=99.60  E-value=2.1e-15  Score=105.94  Aligned_cols=180  Identities=17%  Similarity=0.228  Sum_probs=116.8

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHCCCEEEEECHHH----------------CCCCCHHHHHHHHHHC-CCCEEEECCCCCC
Q ss_conf             94-9999788978899999996498599961367----------------0878999999999755-9989997863445
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMCVQDVEIIRVGRPD----------------IDLLKPKDFASFFLSF-SPDVIINPAAYTA   62 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l~~~~~v~~~~r~~----------------~D~~~~~~~~~~l~~~-~pd~Vih~Aa~~~   62 (290)
                      || +|||||++=||.++++.|.+++.++.++|++                +|++|.+++++++++. +.|++||+||...
T Consensus         3 mKvalITGas~GIG~aia~~la~~g~vv~~~r~~~~l~~l~~~~~~~~~~~Dlt~~~~i~~~~~~~~~iD~lVnnAG~~~   82 (226)
T PRK08219          3 MPTALITGASRGIGAAIARALARTHTLLLAGRPSERLDAVAARLGATTWPADLTDPEAIAAAVEPLDRLDVLVHNAGVAE   82 (226)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHCCCCCEEEECCCCCC
T ss_conf             89999928464999999999996998999989889999999970993786057999999999996599889998996899


Q ss_pred             CCCC----CCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             4322----33221024201222110001122----333333445532111357554421111222211101245666653
Q gi|254780921|r   63 VDKA----EDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEK  134 (290)
Q Consensus        63 ~~~~----e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~  134 (290)
                      ....    ..+.+..+++|+.++.++++.+.    ..+-++|++||..-+   ...|        ....|+.||.+.+.+
T Consensus        83 ~~~~~~~~~~~~~~~~~vNl~~~~~l~~~~lp~m~~~~G~IV~isS~~g~---~~~~--------~~~~Y~aSKaAl~~l  151 (226)
T PRK08219         83 LGPVAESTVDEWRATLDVNVVAPAELTRLLLPALRAARGHVVFINSGAGL---NASP--------GWASYAASKFALRAL  151 (226)
T ss_pred             CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHC---CCCC--------CCHHHHHHHHHHHHH
T ss_conf             98737699999999999866999999999999999739849999476764---8899--------974799999999999


Q ss_pred             HCCCCCCC-CCCCCCCCE-ECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             10122232-235554200-03686320002011246652153045545445223689999999984
Q gi|254780921|r  135 VASYTNNY-VILRTAWVY-SIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       135 v~~~~~~~-~IlR~~~vy-G~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      .+.+.... -=+|...|. |+-+.++...+....  .+...  ...+   .--+|+|+++..++..
T Consensus       152 ~~~L~~e~~~~IrVn~I~PG~v~T~m~~~~~~~~--~~~~~--~~r~---~~PedVA~~v~fll~~  210 (226)
T PRK08219        152 ADALREEEAGNVRVTSVHPGRTATDMQRELVAQE--GREYD--PARF---LRPETVAAAVRFAVDA  210 (226)
T ss_pred             HHHHHHHCCCCEEEEEEEECCCCCCCCHHHHHHH--HCCCC--CCCC---CCHHHHHHHHHHHHCC
T ss_conf             9999986699849999970899786535567654--30378--7679---6999999999999869


No 49 
>KOG2774 consensus
Probab=99.60  E-value=7.6e-15  Score=102.77  Aligned_cols=267  Identities=18%  Similarity=0.196  Sum_probs=162.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHC--CCEEEEEC-HH-------------HCCCCCHHHHHHHHHHCCCCEEEECCCCC-CCC
Q ss_conf             499997889788999999964--98599961-36-------------70878999999999755998999786344-543
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ--DVEIIRVG-RP-------------DIDLLKPKDFASFFLSFSPDVIINPAAYT-AVD   64 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~--~~~v~~~~-r~-------------~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~-~~~   64 (290)
                      ||||||+-|.+|..++++|..  |.+.+.++ ..             -+|+.|.+.+++++-..+.|-.||..|.- .+.
T Consensus        46 rvLITG~LGQLG~~~A~LLR~~yGs~~VILSDI~KPp~~V~~~GPyIy~DILD~K~L~eIVVn~RIdWL~HfSALLSAvG  125 (366)
T KOG2774          46 RVLITGSLGQLGRGLASLLRYMYGSECVILSDIVKPPANVTDVGPYIYLDILDQKSLEEIVVNKRIDWLVHFSALLSAVG  125 (366)
T ss_pred             EEEEECCHHHHHHHHHHHHHHHHCCCCEEECCCCCCCHHHCCCCCEEEHHHHCCCCHHHHHHCCEEEEEEHHHHHHHHHC
T ss_conf             58884553677688999999984776376010358855432568754324542014788753451102111999998751


Q ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCHHHHHHHHHHHCCCCC---
Q ss_conf             223322102420122211000112233333344553211135755-4421111222211101245666653101222---
Q gi|254780921|r   65 KAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSR-TPIDEFSPTNPLNIYGKSKLAGEEKVASYTN---  140 (290)
Q Consensus        65 ~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~~~-~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~---  140 (290)
                        |.|.-.+.++|.+|..|+++.+.+++.++.-.||-.-|+-.+. .|...-.-..|.+.||.||.-+|.+-..+..   
T Consensus       126 --E~NVpLA~~VNI~GvHNil~vAa~~kL~iFVPSTIGAFGPtSPRNPTPdltIQRPRTIYGVSKVHAEL~GEy~~hrFg  203 (366)
T KOG2774         126 --ETNVPLALQVNIRGVHNILQVAAKHKLKVFVPSTIGAFGPTSPRNPTPDLTIQRPRTIYGVSKVHAELLGEYFNHRFG  203 (366)
T ss_pred             --CCCCCCEEEECCHHHHHHHHHHHHHCEEEEECCCCCCCCCCCCCCCCCCCEECCCCEEECHHHHHHHHHHHHHHHHCC
T ss_conf             --157741356510436689999987073686024334568999999899813226731203358899999999886507


Q ss_pred             -CCCCCCCCCCEEC---CCC--CC-CCEEECCCCCCCCEE-ECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEE
Q ss_conf             -3223555420003---686--32-000201124665215-304554544522368999999998442024433443137
Q gi|254780921|r  141 -NYVILRTAWVYSI---FGS--NF-LLSMLRLAKERREIS-VVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFH  212 (290)
Q Consensus       141 -~~~IlR~~~vyG~---~~~--~~-v~~~l~~~~~~~~i~-~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn  212 (290)
                       ++-.+|++.+.+.   +|.  ++ +..+..+.++++--. +-.|-.--..|..|.-.+++.++..   ..+.....+||
T Consensus       204 ~dfr~~rfPg~is~~~pgggttdya~A~f~~Al~~gk~tCylrpdtrlpmmy~~dc~~~~~~~~~a---~~~~lkrr~yn  280 (366)
T KOG2774         204 VDFRSMRFPGIISATKPGGGTTDYAIAIFYDALQKGKHTCYLRPDTRLPMMYDTDCMASVIQLLAA---DSQSLKRRTYN  280 (366)
T ss_pred             CCCEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHC---CHHHHHHHEEE
T ss_conf             540002477510268999985311455307888658866554777657400158899999999868---88875554150


Q ss_pred             EECCCCCCCHHHHHHHHHHHHHHHC-CCCHHEEECCH----HHHCCCCCCCCCCCCCHHHHHHHHCCCCC-CHHHHHHHH
Q ss_conf             6238666788999999999999727-98000576285----88087689975110086899996178999-989999999
Q gi|254780921|r  213 MTADGGPVSWADFAEYIFWESAERG-GPYSKVYRIFT----KQYPTKAHRPAYSCLDCSKLANTHNIRIS-TWKEGVRNI  286 (290)
Q Consensus       213 ~~~~~~~~s~~e~a~~I~~~~~~~~-~~~~~i~~~~~----~~~~~~a~RP~~~~Ld~~K~~~~lg~~~~-~~~e~i~~~  286 (290)
                      +++-+  .+-    ++|+..+.+.. +....-.+++.    +.||        .++|-+.++..--|+-. ++..-+.-+
T Consensus       281 vt~~s--ftp----ee~~~~~~~~~p~~~i~y~~~srq~iad~wp--------~~~dds~ar~~wh~~h~~~l~~~i~~~  346 (366)
T KOG2774         281 VTGFS--FTP----EEIADAIRRVMPGFEIDYDICTRQSIADSWP--------MSLDDSEARTEWHEKHSLHLLSIISTV  346 (366)
T ss_pred             EEEEC--CCH----HHHHHHHHHHCCCCEEEECCCHHHHHHHHCC--------CCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             00010--588----9999999722899455306415666664165--------434735665667775220499999999


Q ss_pred             H
Q ss_conf             9
Q gi|254780921|r  287 L  287 (290)
Q Consensus       287 i  287 (290)
                      +
T Consensus       347 i  347 (366)
T KOG2774         347 V  347 (366)
T ss_pred             H
T ss_conf             9


No 50 
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=99.56  E-value=4.6e-14  Score=98.36  Aligned_cols=202  Identities=16%  Similarity=0.114  Sum_probs=127.6

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHH--------------HCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             94999978897889999999-649859996136--------------708789999999997559989997863445432
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP--------------DIDLLKPKDFASFFLSFSPDVIINPAAYTAVDK   65 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~--------------~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~   65 (290)
                      |+|||||+||++|+++++.| ..+++|....|+              ..|+.+...+...++..  +.++++..... . 
T Consensus         1 ~~ilV~GatG~~G~~~~~~L~~~~~~v~~~~r~~~~~~~~~~~v~~~~~d~~~~~~l~~~~~G~--~~~~~i~~~~~-~-   76 (275)
T COG0702           1 MKILVTGATGFVGGAVVRELLARGHEVRAAVRNPEAAAALAGGVEVVLGDLRDPKSLVAGAKGV--DGVLLISGLLD-G-   76 (275)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHCCCEEEEECCCCHHHHHCCCCCEEECCCCCCCHHHHHHHCCC--EEEEEECCCCC-C-
T ss_conf             9389986777579999999997598699973682211110378528845641607799984894--17999525455-6-


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             23322102420122211000112233333344553211135755442111122221110124566665310122232235
Q gi|254780921|r   66 AEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVIL  145 (290)
Q Consensus        66 ~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~~~~Il  145 (290)
                         ++ ...........+..+.+......++++|.   +++..          ...+.|..+|..+|+.+.+....+.++
T Consensus        77 ---~~-~~~~~~~~~~~~~a~~a~~~~~~~~~~s~---~~~~~----------~~~~~~~~~~~~~e~~l~~sg~~~t~l  139 (275)
T COG0702          77 ---SD-AFRAVQVTAVVRAAEAAGAGVKHGVSLSV---LGADA----------ASPSALARAKAAVEAALRSSGIPYTTL  139 (275)
T ss_pred             ---CC-CHHHHHHHHHHHHHHHCCCCCCCEEEEEE---CCCCC----------CCCHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             ---63-01200367899999862744243268750---23566----------880678999999999998569862035


Q ss_pred             CCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHH
Q ss_conf             55420003686320002011246652153045545445223689999999984420244334431376238666788999
Q gi|254780921|r  146 RTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADF  225 (290)
Q Consensus       146 R~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~  225 (290)
                      |.++.|......++   ......+..+........+|+..+|++..+...+....     ....+|.+++. ...+..+.
T Consensus       140 r~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~i~~~d~a~~~~~~l~~~~-----~~~~~~~l~g~-~~~~~~~~  210 (275)
T COG0702         140 RRAAFYLGAGAAFI---EAAEAAGLPVIPRGIGRLSPIAVDDVAEALAAALDAPA-----TAGRTYELAGP-EALTLAEL  210 (275)
T ss_pred             CCCCEECCCCHHHH---HHHHHCCCCEEECCCCCCCCEEHHHHHHHHHHHHCCCC-----CCCCEEEEECC-CCCCHHHH
T ss_conf             56300115305679---99984588514125665471456567999998714853-----34867999574-00355689


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254780921|r  226 AEYIFWE  232 (290)
Q Consensus       226 a~~I~~~  232 (290)
                      +..+...
T Consensus       211 ~~~l~~~  217 (275)
T COG0702         211 ASGLDYT  217 (275)
T ss_pred             HHHHHHH
T ss_conf             8778998


No 51 
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=99.54  E-value=1.2e-14  Score=101.64  Aligned_cols=179  Identities=13%  Similarity=0.150  Sum_probs=117.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||+|-||.++++.| .+|++|+.++|++                     +|++|++.++++++..     ++|++
T Consensus         7 v~lITGgs~GIG~a~a~~la~~G~~V~~~~r~~~~l~~~~~~~~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~g~iDil   86 (246)
T PRK05653          7 TALVTGASRGIGRAIALRLAADGARVVIYDSNEEAAEALAEELRAAGGEAALLVFDVTDEAAVRALIEAAVERFGGLDVL   86 (246)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             89993897589999999999879999999799999999999999659948999972899999999999999974998699


Q ss_pred             EECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             9786344543----2233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||+||+....    ..+.+.+..+++|+.++.++++.+.    +.+ -++|++||..-+-+   .|        ....|+
T Consensus        87 vnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~~~~~---~~--------~~~~Y~  155 (246)
T PRK05653         87 VNNAGITRDALLPRMSEEDWDRVIDTNLTGTFNVCRAALPPMRKARYGRIVNISSVSGVAG---NP--------GQTNYA  155 (246)
T ss_pred             EECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCHHHCCC---CC--------CCHHHH
T ss_conf             9899999998801399999999999860889999999999999846997899836554678---99--------966689


Q ss_pred             HHHHHHHHHHCCCCCCC-------CCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             24566665310122232-------23555420003686320002011246652153045545445223689999999984
Q gi|254780921|r  126 KSKLAGEEKVASYTNNY-------VILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~~~-------~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      .+|.+.+.+.+..+..+       ..+.|+++-.+...++.....+...+..++.    ++   ...+|+|+++..++..
T Consensus       156 asKaal~~lt~~la~e~~~~~IrvN~I~PG~i~T~~~~~~~~~~~~~~~~~~Pl~----R~---~~p~dia~~v~fL~S~  228 (246)
T PRK05653        156 AAKAGVIGLTKALALELASRGITVNAVAPGFIDTDMTRALPEEVKEALLKQIPLG----RL---GTPEEVANAVAFLASD  228 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCC----CC---CCHHHHHHHHHHHHCC
T ss_conf             9999999999999999504393999996388877231116899999998479989----98---3999999999999687


No 52 
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.53  E-value=1.5e-14  Score=101.06  Aligned_cols=179  Identities=15%  Similarity=0.152  Sum_probs=118.5

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             4999978897889999999-649859996136----------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      .+|||||++-||.++++.| .+|++|+.++|+                      .+|+++++++++++++.     ++|+
T Consensus         9 ~~lITGas~GIG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~g~iDi   88 (250)
T PRK12825          9 VALVTGAARGIGRAIALRLAAAGADVIVHPPSDEAAAEETVAAVEALGRRAQAVQADVTDAAALEAAVEELVERFGAIDI   88 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             89993895589999999999879989999798878999999999853994899994189999999999999997699989


Q ss_pred             EEECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             997863445432----233221024201222110001122----333-33344553211135755442111122221110
Q gi|254780921|r   54 IINPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        54 Vih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      +||+|++.....    .+.+.+..+++|+.++.++++++.    +.+ -++|++||...+.+   .|        ....|
T Consensus        89 lInnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~~~~~---~~--------~~~~Y  157 (250)
T PRK12825         89 LVNNAGITGDGRLWEMSDDEWERVIDVNLTGVFNVLRAVVPPMIEAGGGRIVNISSVAGLKG---NP--------GQVNY  157 (250)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCC---CC--------CCHHH
T ss_conf             99899889998902399999999999851899999999899999749973999914555578---99--------96778


Q ss_pred             HHHHHHHHHHHCCCCCCC-------CCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             124566665310122232-------2355542000368632000201124665215304554544522368999999998
Q gi|254780921|r  125 GKSKLAGEEKVASYTNNY-------VILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAH  197 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~~~-------~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~  197 (290)
                      +.+|.+.+.+.+..+..+       ..+.|+++-.+....+.....+......++.    ++   ...+|+|+++..++.
T Consensus       158 ~~sK~Al~~l~~~la~e~~~~gIrvN~I~PG~v~T~~~~~~~~~~~~~~~~~~p~~----R~---~~pedva~~v~fL~s  230 (250)
T PRK12825        158 AAAKAGLVGLTKALARELAERGIRVNAVAPGAIDTEMIEATIEEAREAILKLIPLG----RL---GTPEEIADAVAFLAS  230 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCC----CC---CCHHHHHHHHHHHHC
T ss_conf             99999999999999998604292999997288877032125888999998269989----98---399999999999968


Q ss_pred             H
Q ss_conf             4
Q gi|254780921|r  198 N  198 (290)
Q Consensus       198 ~  198 (290)
                      .
T Consensus       231 ~  231 (250)
T PRK12825        231 D  231 (250)
T ss_pred             C
T ss_conf             6


No 53 
>PRK08267 short chain dehydrogenase; Provisional
Probab=99.53  E-value=4.2e-14  Score=98.61  Aligned_cols=128  Identities=18%  Similarity=0.199  Sum_probs=94.2

Q ss_pred             CE-EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------------CCCCCHHHHHHHHHH------CCCCE
Q ss_conf             94-999978897889999999-6498599961367-------------------087899999999975------59989
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------------IDLLKPKDFASFFLS------FSPDV   53 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------------~D~~~~~~~~~~l~~------~~pd~   53 (290)
                      || +|||||++=||.++++.| .+|++|+.++|++                   +|++|.+++++.+++      -++|+
T Consensus         1 MK~vlITGassGIG~a~A~~~a~~G~~V~~~~r~~~~l~~~~~~l~~~~~~~~~~Dvtd~~~v~~~~~~~~~~~~G~iDi   80 (258)
T PRK08267          1 MKSIFITGAASGIGRATARLFAARGWRVGAYDINEDGLAALAAELGAERAWTGALDVTDRAAWDAALADFCAATGGRLDV   80 (258)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCE
T ss_conf             99899907226899999999998799999998889999999998369967999911799999999999999995899868


Q ss_pred             EEECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99786344543----2233221024201222110001122----33-333344553211135755442111122221110
Q gi|254780921|r   54 IINPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SI-GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        54 Vih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~-~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      +||+||+....    ....+.+..+++|+.|+.++++++.    +. +..+|.+||..-+   ...|        -.+.|
T Consensus        81 LVNNAGi~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~m~~~~~g~IvnisS~~g~---~~~p--------~~~~Y  149 (258)
T PRK08267         81 LFNNAGILRGGPFEDIPLEAHDRVIDINVKGVLNGAYAALPYLKATPGARVINTSSASAI---YGQP--------QLAVY  149 (258)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHC---CCCC--------CCCHH
T ss_conf             998887799988244999999999999739999999999999997799279999065446---7999--------98669


Q ss_pred             HHHHHHHHHHHCCCC
Q ss_conf             124566665310122
Q gi|254780921|r  125 GKSKLAGEEKVASYT  139 (290)
Q Consensus       125 g~sK~~~E~~v~~~~  139 (290)
                      +.||.+...+.+...
T Consensus       150 ~aSK~av~~lt~sla  164 (258)
T PRK08267        150 SATKFAVRGLTEALD  164 (258)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 54 
>PRK10538 3-hydroxy acid dehydrogenase; Provisional
Probab=99.51  E-value=7e-14  Score=97.36  Aligned_cols=129  Identities=19%  Similarity=0.260  Sum_probs=95.4

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEEE
Q ss_conf             94999978897889999999-6498599961367------------------0878999999999755-----9989997
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVIIN   56 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vih   56 (290)
                      |-+||||+++=||.++++.| .+|++|+.++|++                  +|++|.+++++++++.     ++|++||
T Consensus         1 mVvlVTGassGIG~a~A~~la~~Ga~Vv~~~r~~~~l~~l~~~lg~~~~~~~~Dvsd~~~v~~~~~~~~~~~g~iDiLVn   80 (248)
T PRK10538          1 MIVLVTGATAGFGECITRRFIQNGHKVIATGRRQERLQELKDELGDNLYIAQLDVRNRAAIEEMLASLPAEWRNIDILVN   80 (248)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             99999888669999999999987999999989999999999984886799997348889999999999997099759997


Q ss_pred             CCCCCC-CC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             863445-43----2233221024201222110001122----333-3334455321113575544211112222111012
Q gi|254780921|r   57 PAAYTA-VD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        57 ~Aa~~~-~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      +||+.. .+    ....+.+..+++|+.++.++++++.    +.+ -++|++||..   |..  |+.      ....|+.
T Consensus        81 NAG~~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~a---g~~--~~~------~~~~Y~a  149 (248)
T PRK10538         81 NAGLALGLEPAHKASVEDWETMIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTA---GSW--PYA------GGNVYGA  149 (248)
T ss_pred             CCCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEECCC---CCC--CCC------CCHHHHH
T ss_conf             78546788863768999998777524131999999986766635995899993600---078--899------9688999


Q ss_pred             HHHHHHHHHCCCCC
Q ss_conf             45666653101222
Q gi|254780921|r  127 SKLAGEEKVASYTN  140 (290)
Q Consensus       127 sK~~~E~~v~~~~~  140 (290)
                      ||.+.+.+.+....
T Consensus       150 sKaal~~~t~~La~  163 (248)
T PRK10538        150 TKAFVRQFSLNLRT  163 (248)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999


No 55 
>PRK06180 short chain dehydrogenase; Provisional
Probab=99.49  E-value=6.4e-14  Score=97.56  Aligned_cols=128  Identities=21%  Similarity=0.207  Sum_probs=96.1

Q ss_pred             CE-EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             94-999978897889999999-6498599961367------------------0878999999999755-----998999
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      || +||||+++=||.++++.| .+|++|+.++|++                  +|++|.+++++++++.     +.|++|
T Consensus         4 ~KvvlITGassGIG~aiA~~l~~~G~~Vi~~~R~~~~l~~l~~~~~~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDvLV   83 (277)
T PRK06180          4 MKTWLITGVSSGFGRALAQAALAAGHRVVGTVRSAAARRDFEALHPGRALARVLDVTDFDAIDGVVADAEATVGPIDVLV   83 (277)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             98899917873999999999998799999998999999999986799579999837999999999999999819986999


Q ss_pred             ECCCCCCCCCC----CCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             78634454322----33221024201222110001122----333-3334455321113575544211112222111012
Q gi|254780921|r   56 NPAAYTAVDKA----EDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        56 h~Aa~~~~~~~----e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      |+||+......    +.+.+..+++|+.|+.++++++.    +.+ -++|.+||..-+   ...|.        .+.|+.
T Consensus        84 NNAG~~~~~~~e~~~~~~~~~~~~vN~~g~~~~~~a~lp~m~~~~~G~IvnisS~ag~---~~~p~--------~~~Y~a  152 (277)
T PRK06180         84 NNAGYGHEGAIEESPLAEMRRQFEVNVFGAVAMIKAVLPGMRARRRGHIVNITSMGGL---ITMPG--------IAYYCG  152 (277)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHCCCCEEEEECCHHHC---CCCCC--------CHHHHH
T ss_conf             8997788886333999999999988537765442004888896589657753546652---57999--------827999


Q ss_pred             HHHHHHHHHCCCC
Q ss_conf             4566665310122
Q gi|254780921|r  127 SKLAGEEKVASYT  139 (290)
Q Consensus       127 sK~~~E~~v~~~~  139 (290)
                      ||.+.+.+.+...
T Consensus       153 SK~Al~~lt~sLa  165 (277)
T PRK06180        153 SKFALEGISEALA  165 (277)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999999


No 56 
>PRK05693 short chain dehydrogenase; Provisional
Probab=99.48  E-value=5e-14  Score=98.19  Aligned_cols=127  Identities=21%  Similarity=0.218  Sum_probs=94.8

Q ss_pred             CE-EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------CCCCCHHHHHHHHHH-----CCCCEEEECC
Q ss_conf             94-999978897889999999-6498599961367---------------087899999999975-----5998999786
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------IDLLKPKDFASFFLS-----FSPDVIINPA   58 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------~D~~~~~~~~~~l~~-----~~pd~Vih~A   58 (290)
                      || +||||+++=||.++++.| .+|++|+.++|++               +|++|.+++++++++     .++|++||+|
T Consensus         1 MKvvlITGassGIG~alA~~la~~G~~V~~~~R~~~~l~~l~~~~~~~~~~Dvtd~~~i~~~~~~~~~~~g~iDiLVNNA   80 (274)
T PRK05693          1 MPVVLITGCSSGIGRALADAFKAAGYEVWATARKAEDVEALAAAGFTAVQLDVNDGAALARLAEELEAEHQGLDVLINNA   80 (274)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99899948885899999999998799999997999999999848991899846998999999999999729976899888


Q ss_pred             CCCCCCCC----CCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             34454322----33221024201222110001122----33333344553211135755442111122221110124566
Q gi|254780921|r   59 AYTAVDKA----EDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLA  130 (290)
Q Consensus        59 a~~~~~~~----e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~  130 (290)
                      |+......    ..+.+..+++|+.|+..+++++.    +.+-++|.+||..   |....|+        .+.|+.||.+
T Consensus        81 G~~~~g~~~~~~~~~~~~~~~vN~~g~~~~~~~~lP~m~~~~G~IVnisS~a---g~~~~p~--------~~~Y~aSK~A  149 (274)
T PRK05693         81 GYGAMGPLLDGGVEAMRRQFETNVFAVVGVTRALFPLLRRSRGLVVNIGSVS---GVLVTPF--------AGAYCASKAA  149 (274)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCH---HCCCCCC--------CHHHHHHHHH
T ss_conf             6778875898768999999999819999999999999975896799981405---3268999--------7379999999


Q ss_pred             HHHHHCCC
Q ss_conf             66531012
Q gi|254780921|r  131 GEEKVASY  138 (290)
Q Consensus       131 ~E~~v~~~  138 (290)
                      .|-+....
T Consensus       150 l~~~s~sL  157 (274)
T PRK05693        150 VHALSDAL  157 (274)
T ss_pred             HHHHHHHH
T ss_conf             99999999


No 57 
>PRK06953 short chain dehydrogenase; Provisional
Probab=99.48  E-value=2.1e-13  Score=94.68  Aligned_cols=178  Identities=12%  Similarity=0.114  Sum_probs=112.2

Q ss_pred             CE-EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------CCCCCHHHHHHHHHH---CCCCEEEECCCC
Q ss_conf             94-999978897889999999-6498599961367---------------087899999999975---599899978634
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------IDLLKPKDFASFFLS---FSPDVIINPAAY   60 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------~D~~~~~~~~~~l~~---~~pd~Vih~Aa~   60 (290)
                      || +||||++.=||.++++.| .+|++|+.+.|++               +|++|+++++.+.++   .++|++||+|+.
T Consensus         1 MK~~LVTGas~GIG~a~a~~la~~G~~V~~~~R~~~~l~~l~~~~~~~~~~Dv~d~~~v~~~~~~~~~~~ldili~nAGi   80 (222)
T PRK06953          1 MKTVLIVGASRGIGLEFVRQYRADGWRVIATARDAAGLAALRALGAEALALDVADPESIAGLGWKLDGEALDAAVYVAGV   80 (222)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             99999947572999999999998889999996888889998842151777405899999999986236776789981665


Q ss_pred             CCC--CC----CCCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             454--32----233221024201222110001122----33333344553211135755442111122221110124566
Q gi|254780921|r   61 TAV--DK----AEDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLA  130 (290)
Q Consensus        61 ~~~--~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~  130 (290)
                      ..+  ..    .+.+.+..+++|+.++.++++++.    ..+.++|.+||..   |.-..     .+......|+.||.+
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~vN~~g~~~l~~~~lP~l~~~~g~ii~iSS~~---gs~~~-----~~~~~~~~Y~aSKaA  152 (222)
T PRK06953         81 YGPRTEGVEPITREDFDAVMHTNVLGPMQLLPILLPLVEAAGGVLAVLSSRM---GSIGE-----ATGTTGWLYRASKAA  152 (222)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEECCCE---EEECC-----CCCCCHHHHHHHHHH
T ss_conf             5678765466899999999987119999999999999985799852456776---43137-----888632878999999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             6653101222322355542000368632000201124665215304554544522368999999998442024
Q gi|254780921|r  131 GEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENS  203 (290)
Q Consensus       131 ~E~~v~~~~~~~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~  203 (290)
                      .+.+.+.....+-=+|.. ...   |+++.+=+.  ...           .+...+..|+.++.++.......
T Consensus       153 l~~~~~~la~e~~~i~v~-ai~---PG~v~T~m~--~~~-----------a~~~~e~~a~~~~~~~~~~~~~~  208 (222)
T PRK06953        153 LNDALRIASLQARHAACI-ALH---PGWVRTDMG--GAQ-----------AALDPQQSVAGMRRVIAGDTRRD  208 (222)
T ss_pred             HHHHHHHHHHHCCCCEEE-EEE---CCCCCCCCC--CCC-----------CCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             999999998654798899-994---678257999--999-----------89499999999999996399899


No 58 
>PRK05650 short chain dehydrogenase; Provisional
Probab=99.47  E-value=1.4e-13  Score=95.59  Aligned_cols=183  Identities=16%  Similarity=0.137  Sum_probs=112.9

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      ||||||+++=||.++++.| .+|++|+.++|++                     +|++|+++++++++..     ++|++
T Consensus         2 rVlITGassGIG~alA~~la~~G~~V~l~~r~~~~l~~~~~~l~~~g~~~~~~~~Dvt~~~~~~~~~~~v~~~~g~iDiL   81 (270)
T PRK05650          2 RVMITGAASGLGRAIALRWAREGWRLALADVNEEGGEETLKELREAGGDGFYQRCDVRDYSQLTALAQACEEKWGGIDVI   81 (270)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             79998876499999999999889989999798899999999998449928999845899999999999999983997789


Q ss_pred             EECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             97863445432----23322102420122211000112----2333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAA----DSIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~----~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||.||+.....    ...+.+..+++|+.|+.++++++    ++.+ -++|.+||.+-+   ...|.        .+.|+
T Consensus        82 VNNAGi~~~g~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~m~~~~~G~IvnisS~ag~---~~~p~--------~~~Y~  150 (270)
T PRK05650         82 VNNAGVASGGFFEELSLEDWDWQIAINLMGVVKGCKAFLPLFKEQGKGRIVNIASMAGL---MQGPA--------MSSYN  150 (270)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC---CCCCC--------CHHHH
T ss_conf             62476679986201999999999999659999999999976755699589998585552---89999--------66799


Q ss_pred             HHHHHHHHHHCCCCC---CCCCCCCCCCE-ECCCCCCCCEEECCC-CCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             245666653101222---32235554200-036863200020112-46652153045545445223689999999984
Q gi|254780921|r  126 KSKLAGEEKVASYTN---NYVILRTAWVY-SIFGSNFLLSMLRLA-KERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~---~~~IlR~~~vy-G~~~~~~v~~~l~~~-~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      .||.+...+......   ++- +|.+.|. |.-..+|...+-... ..+..+.  .-...+|+..+++|+.++..+++
T Consensus       151 asK~av~~~tesL~~El~~~g-I~V~~v~PG~v~T~~~~~~~~~~~~~~~~~~--~~~~~~~~~~e~vA~~i~~~i~~  225 (270)
T PRK05650        151 VAKAGVVALSETLLVELADDE-IGVHVVCPSFFQTNLLDSFRGPNPAMKAQVG--KLLEKSPITAADIADYIYQQVAK  225 (270)
T ss_pred             HHHHHHHHHHHHHHHHHCCCC-CEEEEEECCCCCCCCCCCCCCCCCHHHHHHH--HHHHCCCCCHHHHHHHHHHHHHC
T ss_conf             999999999999999853219-6899997388986656577888804678887--66414899999999999999975


No 59 
>PRK09009 C factor cell-cell signaling protein; Provisional
Probab=99.46  E-value=2.9e-13  Score=93.87  Aligned_cols=175  Identities=15%  Similarity=0.116  Sum_probs=104.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-CC--EEEEECHH-------------HCCCCCHHHHHHHHHHC-CCCEEEECCCCCC-
Q ss_conf             9499997889788999999964-98--59996136-------------70878999999999755-9989997863445-
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-DV--EIIRVGRP-------------DIDLLKPKDFASFFLSF-SPDVIINPAAYTA-   62 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~~--~v~~~~r~-------------~~D~~~~~~~~~~l~~~-~pd~Vih~Aa~~~-   62 (290)
                      |+||||||++=||.++++.|.+ +.  .+.+..+.             ++|++|.++++++.++. +.|++||+||+.. 
T Consensus         1 mnVLITGas~GIG~aia~~l~~~~~~~~v~~~~~~~~~~~~~~~v~~~~~Dvt~~~~i~~~~~~~~~iD~linnAGi~~~   80 (235)
T PRK09009          1 MNILIVGGSGGIGKAMVKQLLETYPDATVHATYRHHKPDFRHDNVQWHALDVTDEAEIKQLSEQFTQLDWLINCVGMLHT   80 (235)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             97999755639999999999856998099997377654445798389987479999999999870877899976752446


Q ss_pred             ----CCC--CCCC---CCEEEEECCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             ----432--2332---2102420122211000112----233-3333445532111357554421111222211101245
Q gi|254780921|r   63 ----VDK--AEDE---PEIAFSINAEGAGAIAKAA----DSI-GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        63 ----~~~--~e~~---~~~~~~~Nv~~~~~l~~~~----~~~-~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
                          ++.  .+.+   .+..+++|+.++..+++.+    ++. +.+++.+||..   |.-.     ..+......|+.||
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~l~~~~~~~iv~isS~~---g~i~-----~~~~~g~~~Y~aSK  152 (235)
T PRK09009         81 QDKGPEKSLQSLDSDFFLQNITLNTLPSLLLAKHFTPLLKQSESARFAVISAKV---GSIS-----DNRLGGWYSYRASK  152 (235)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEE---CCCC-----CCCCCCCHHHHHHH
T ss_conf             777764686778999999999886199999999999999860787640122234---1577-----88888623669999


Q ss_pred             HHHHHHHCCCCCC------CC---CCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             6666531012223------22---3555420003686320002011246652153045545445223689999999984
Q gi|254780921|r  129 LAGEEKVASYTNN------YV---ILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       129 ~~~E~~v~~~~~~------~~---IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      .+...+.+..+..      .+   .+.|+++--+        |-+...++.+.       +....-+|+|+++..++..
T Consensus       153 aAl~~lt~~la~E~~~~~~~i~V~~i~PG~v~T~--------m~~~~~~~~p~-------~r~~~PeeiA~~i~~L~s~  216 (235)
T PRK09009        153 AALNMFLKTLSIEWQRSLKHGVVLALHPGTTDTP--------LSKPFQQNVPK-------GKLFTPEYVAQCLLGIIAN  216 (235)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCC--------CCCHHHHCCCC-------CCCCCHHHHHHHHHHHHCC
T ss_conf             9999999999999764269968999814865671--------23067857998-------8882999999999999716


No 60 
>PRK07454 short chain dehydrogenase; Provisional
Probab=99.45  E-value=2.5e-13  Score=94.27  Aligned_cols=177  Identities=19%  Similarity=0.165  Sum_probs=113.5

Q ss_pred             CE-EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCC
Q ss_conf             94-999978897889999999-6498599961367---------------------0878999999999755-----998
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPD   52 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd   52 (290)
                      || +||||+++=||.++++.| .+|++|+.++|++                     +|++|++++++++++.     ++|
T Consensus         6 mKvalITGas~GIG~a~A~~la~~G~~V~l~~R~~~~l~~~~~e~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~G~iD   85 (241)
T PRK07454          6 MPTALITGASRGIGKATALAFAKAGWDLALVARSQDALEALAEELRSTGVKVAAYSIDLSNPEAIAPGIAELLEQFGCPS   85 (241)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCC
T ss_conf             98899917587899999999998799899998999999999999996599289999518999999999999999759988


Q ss_pred             EEEECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             999786344543----2233221024201222110001122----333-3334455321113575544211112222111
Q gi|254780921|r   53 VIINPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        53 ~Vih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      ++||+||.....    ....+.+..+++|+.++..+++++.    +.+ -++|.+||..   |....|.        ...
T Consensus        86 iLVnNAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IinisS~a---g~~~~~~--------~~~  154 (241)
T PRK07454         86 VLINNAGAAYTGPLLEMPLSDWQWVIQLNLTSVFQCCSAVLPGMRARGGGLIINVSSHA---ARNAFPQ--------WGA  154 (241)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHH---HCCCCCC--------CHH
T ss_conf             99988988999992669999999999998699999999999999973998999983565---4477899--------757


Q ss_pred             CHHHHHHHHHHHCCCCCC---CCCCCCCCCEECCCCCCCCE-EECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             012456666531012223---22355542000368632000-2011246652153045545445223689999999984
Q gi|254780921|r  124 YGKSKLAGEEKVASYTNN---YVILRTAWVYSIFGSNFLLS-MLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~~~---~~IlR~~~vyG~~~~~~v~~-~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      |+.||.+...+.+.....   +- +|...|. |+   ++.+ |+.    .+.+.-.-+ ......-+|+|++++.++..
T Consensus       155 Y~aSK~al~~lt~~la~E~~~~g-IrVn~V~-PG---~v~T~m~~----~~~~~~~~~-~~~~l~PedVA~~v~flas~  223 (241)
T PRK07454        155 YCVSKAALAAFTKCLAEEERSHG-IRVCTLT-LG---AVNTPLWD----SETVQADFD-RSAMLSPEQVAQTILYLAQL  223 (241)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCC-CEEEEEE-EC---CCCCCCCC----CCCCCCCCC-CCCCCCHHHHHHHHHHHHCC
T ss_conf             99999999999999999838459-3899997-38---89889888----633335545-56899999999999999769


No 61 
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=99.44  E-value=2.2e-13  Score=94.60  Aligned_cols=179  Identities=16%  Similarity=0.131  Sum_probs=113.7

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             4999978897889999999-649859996136----------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      .+|||||++-||.++++.| .+|++|+..+|+                      ++|+++.++++++++..     ++|+
T Consensus         7 ~~lITGgs~GIG~aia~~la~~G~~Vii~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dlt~~~~v~~~~~~~~~~~g~iD~   86 (248)
T PRK05557          7 VALVTGASRGIGRAIAERLAAQGANVVLNYASSEAGAEALVAEIGALGGKALAVQGDVADAESIERAVDEAKAEFGGVDI   86 (248)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             89994897689999999999879989999698565899999999963995899990389999999999999998299719


Q ss_pred             EEECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             997863445432----233221024201222110001122----333-33344553211135755442111122221110
Q gi|254780921|r   54 IINPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        54 Vih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      +||+|+......    ...+.+..+++|+.++.++++.+.    +.+ -++|++||....-+   .|        ....|
T Consensus        87 linnAg~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~m~~~~~G~IVnisS~~~~~~---~~--------~~~~Y  155 (248)
T PRK05557         87 LVNNAGITRDNLLMRMKEEDWDRVIDTNLTGVFNLTKAVARPMMKQRSGRIINISSVVGLMG---NP--------GQANY  155 (248)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CC--------CCHHH
T ss_conf             99899779999915599999999998783049999999999999706971899804665678---99--------95556


Q ss_pred             HHHHHHHHHHHCCCCCCC---CC----CCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             124566665310122232---23----55542000368632000201124665215304554544522368999999998
Q gi|254780921|r  125 GKSKLAGEEKVASYTNNY---VI----LRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAH  197 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~~~---~I----lR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~  197 (290)
                      +.+|.+.+.+.+..+..+   -|    +.|+++-.+--..+.....+...+..++.       .....+|+|+++..++.
T Consensus       156 ~asKaal~~lt~~lA~e~~~~gIrvN~V~PG~i~T~~~~~~~~~~~~~~~~~~pl~-------R~~~p~dva~~v~fL~S  228 (248)
T PRK05557        156 AASKAGVIGFTKSLARELASRGITVNAVAPGFIETDMTDALPEDVKEAILAQIPLG-------RLGQPEEIASAVAFLAS  228 (248)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCC-------CCCCHHHHHHHHHHHHC
T ss_conf             99999999999999998533194999997488877542117999999998579999-------98099999999999968


Q ss_pred             H
Q ss_conf             4
Q gi|254780921|r  198 N  198 (290)
Q Consensus       198 ~  198 (290)
                      .
T Consensus       229 ~  229 (248)
T PRK05557        229 D  229 (248)
T ss_pred             C
T ss_conf             7


No 62 
>PRK05872 short chain dehydrogenase; Provisional
Probab=99.44  E-value=4.8e-13  Score=92.66  Aligned_cols=183  Identities=14%  Similarity=0.096  Sum_probs=116.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEEEC
Q ss_conf             4999978897889999999-6498599961367------------------0878999999999755-----99899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vih~   57 (290)
                      .+|||||++=||.++++.| .+|.+|+.++|++                  +|++|.+++++++++.     ++|++||.
T Consensus        11 valITGassGIG~aiA~~la~~Ga~Vvl~dr~~~~l~~~~~~lg~~~~~~~~DVtd~~~v~~~v~~i~~~~G~iDiLVnN   90 (296)
T PRK05872         11 VVFVTGAARGVGAELARRLHARGAKVALVDLEEAELAALAAELGDRVLTVVADVTDLAAMQAAAEEAVERFGGIDVVVAN   90 (296)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             79992710589999999999879989999899999999999838873899982799999999999999971998787655


Q ss_pred             CCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             63445432----233221024201222110001122----3333334455321113575544211112222111012456
Q gi|254780921|r   58 AAYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        58 Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~  129 (290)
                      ||+.....    ...+.+..+++|+.|+.++++++.    +.+-.+|.+||-.-+-   ..|.        .+.|+.||.
T Consensus        91 AGi~~~~~~~~~~~e~~~~v~dVNl~G~~~~~ra~lp~m~~~~G~IVnisS~ag~~---~~p~--------~~aY~ASKa  159 (296)
T PRK05872         91 AGIASYGSVLQVDPAAFRRVIDVNLLGVFHTVRATLPAVIERRGYVLQVSSLAAFA---AAPG--------MAPYCASKA  159 (296)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHC---CCCC--------CCHHHHHHH
T ss_conf             62579976421998997258424459999999999999997799899996054324---5899--------807999999


Q ss_pred             HHHHHHCCCCCCC--CCCCCCCCE-ECCCCCCCCEE------ECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             6665310122232--235554200-03686320002------01124665215304554544522368999999998442
Q gi|254780921|r  130 AGEEKVASYTNNY--VILRTAWVY-SIFGSNFLLSM------LRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLI  200 (290)
Q Consensus       130 ~~E~~v~~~~~~~--~IlR~~~vy-G~~~~~~v~~~------l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~  200 (290)
                      +.+.+.+......  .=+|.+.|+ |.-+..++...      .+.+..+-+-.     ....+..+++|++|+..+++..
T Consensus       160 av~~~t~sLa~Ela~~GIrVn~V~PG~V~T~m~r~a~~~~~~~~~~~~~~p~p-----~~~~~~~~~~a~~i~~~i~r~~  234 (296)
T PRK05872        160 GVEAFANALRLEVAHRGVSVGSAYLSWIDTDLVRDADADLPAFRELRARLPWP-----LNRTTSVEKCAAAFVDGIERRA  234 (296)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHCCCCCC-----CCCCCCHHHHHHHHHHHHHCCC
T ss_conf             99999999999840019389999708897756747664575567886128998-----7886599999999999984488


No 63 
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.43  E-value=2.5e-13  Score=94.27  Aligned_cols=179  Identities=15%  Similarity=0.205  Sum_probs=111.7

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEE-CHH---------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             4999978897889999999-649859996-136---------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRV-GRP---------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~-~r~---------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      .+|||||++=||.++++.| .+|++|+.. +++                     .+|++|+++++++++..     ++|+
T Consensus         7 ~vlITGgs~GIG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~g~iD~   86 (247)
T PRK05565          7 VAIVTGASGGIGRAIAELLAKEGAKVVIAYDKNEEAANELLEEIKEVGGDAIAVKADVSSEDDVENLVEQIVEKFGKIDI   86 (247)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             89993784589999999999879989998179989999999999963990899983589999999999999998099849


Q ss_pred             EEECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             997863445432----233221024201222110001122----333-33344553211135755442111122221110
Q gi|254780921|r   54 IINPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        54 Vih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      +||+||......    ...+.+..+++|+.++.++++++.    +.+ -++|++||...+-+   .|        ....|
T Consensus        87 lVnnAg~~~~~~~~~~~~~~~~~~~~~Nl~~~~~~~~~~~~~m~~~~~G~II~isS~~~~~~---~~--------~~~~Y  155 (247)
T PRK05565         87 LVNNAGISKFGLVTDMTDEEWDRVINVNLTGVMRLTRYALPIMIKRGSGVIVNISSIWGLIG---AS--------CEVLY  155 (247)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CC--------CCHHH
T ss_conf             99899878999915599999999999854789999998579887569975999735122578---99--------83388


Q ss_pred             HHHHHHHHHHHCCCCCCC---C----CCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             124566665310122232---2----355542000368632000201124665215304554544522368999999998
Q gi|254780921|r  125 GKSKLAGEEKVASYTNNY---V----ILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAH  197 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~~~---~----IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~  197 (290)
                      +.+|.+.+.+.+..+..+   -    .+.|+++-.+....+...-.+...+..++.    .+   ...+|+|+++..++.
T Consensus       156 ~asKaal~~ltr~lA~e~~~~gIrvN~V~PG~~~T~~~~~~~~~~~~~~~~~~p~~----R~---~~p~dva~~v~fL~s  228 (247)
T PRK05565        156 SASKGAVNAFTKALAKELAPSGIRVNAIAPGAIETEMNSSFSEEDKEGLAEEIPLG----RL---GEPEEIAKVVLFLAS  228 (247)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCC----CC---CCHHHHHHHHHHHHC
T ss_conf             99999999999999999543094999996098957421004977899998559988----99---399999999999968


Q ss_pred             H
Q ss_conf             4
Q gi|254780921|r  198 N  198 (290)
Q Consensus       198 ~  198 (290)
                      .
T Consensus       229 ~  229 (247)
T PRK05565        229 D  229 (247)
T ss_pred             C
T ss_conf             6


No 64 
>PRK08017 short chain dehydrogenase; Provisional
Probab=99.43  E-value=1.5e-12  Score=89.88  Aligned_cols=129  Identities=22%  Similarity=0.133  Sum_probs=92.4

Q ss_pred             CE--EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------CCCCCHHHHHHHHHH------CCCCEEEE
Q ss_conf             94--999978897889999999-6498599961367---------------087899999999975------59989997
Q gi|254780921|r    1 MK--CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------IDLLKPKDFASFFLS------FSPDVIIN   56 (290)
Q Consensus         1 Mk--iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------~D~~~~~~~~~~l~~------~~pd~Vih   56 (290)
                      ||  ||||||++=||.++++.| .+|++|+..+|+.               +|++|.+++++.+.+      .+.|++||
T Consensus         1 M~K~vlITGassGIG~a~A~~la~~G~~V~~~~r~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~~~g~id~lin   80 (256)
T PRK08017          1 MQKSVLITGCSSGIGLESALELKRQGFRVLAGCRKPDDVARMNSMGFTGVLIDLDSPESVDRAADEVIALTDNRLYGIFN   80 (256)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             99789996587689999999999879999999699899999985699469983589899999999999984897489998


Q ss_pred             CCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             86344543----2233221024201222110001122----333-33344553211135755442111122221110124
Q gi|254780921|r   57 PAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKS  127 (290)
Q Consensus        57 ~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~s  127 (290)
                      +|++....    ....+.+..+++|+.++.++++.+.    ..+ -++|++||..-+   ...|.        .+.|+.|
T Consensus        81 nAG~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IV~isS~ag~---~~~p~--------~~~Y~as  149 (256)
T PRK08017         81 NAGFGVYGPLSTISRQQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGL---ISTPG--------RGAYAAS  149 (256)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHCCHHHHHCCCCEEEEEECHHHC---CCCCC--------CHHHHHH
T ss_conf             896677888587664533467632113320276641712210489449999576664---88999--------7489999


Q ss_pred             HHHHHHHHCCCCC
Q ss_conf             5666653101222
Q gi|254780921|r  128 KLAGEEKVASYTN  140 (290)
Q Consensus       128 K~~~E~~v~~~~~  140 (290)
                      |.+.+.+.+....
T Consensus       150 Kaal~~~~~sL~~  162 (256)
T PRK08017        150 KYALEAWSDALRM  162 (256)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999999


No 65 
>PRK05993 short chain dehydrogenase; Provisional
Probab=99.41  E-value=3.6e-13  Score=93.37  Aligned_cols=125  Identities=19%  Similarity=0.206  Sum_probs=92.4

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------CCCCCHHHHHHHHHH------CCCCEEEECCCC
Q ss_conf             999978897889999999-6498599961367---------------087899999999975------599899978634
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------IDLLKPKDFASFFLS------FSPDVIINPAAY   60 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------~D~~~~~~~~~~l~~------~~pd~Vih~Aa~   60 (290)
                      |||||+++=||.++++.| .+|++|+++.|++               +|++|.+++++++++      .+.|++||.|++
T Consensus         7 vlITGassGIG~alA~~la~~G~~V~~~~R~~~~l~~l~~~~~~~~~~Dv~d~~~v~~~v~~~~~~~~g~id~lvNnAg~   86 (277)
T PRK05993          7 ILITGCSSGIGAYCAHALQKRGWRVFATCRKPEDIAALEAEGLEAFYLDYAEPESIAALVAQVLELSGGKLDALFNNGAY   86 (277)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             99925686999999999998799999997999999999848981999726677999999999999808970699966643


Q ss_pred             CCCCCCC----CCCCEEEEECCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             4543223----322102420122211000112----2333-333445532111357554421111222211101245666
Q gi|254780921|r   61 TAVDKAE----DEPEIAFSINAEGAGAIAKAA----DSIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAG  131 (290)
Q Consensus        61 ~~~~~~e----~~~~~~~~~Nv~~~~~l~~~~----~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~  131 (290)
                      .....-|    .+.+..+++|+.|+.++++++    ++.+ .++|++||-.   |....|+        .+.|+.||.+.
T Consensus        87 ~~~g~~e~~~~~~~~~~~~vN~~g~~~~~~~~lP~m~~~~~G~IVnisSi~---g~~~~p~--------~~~Y~aSK~Av  155 (277)
T PRK05993         87 GQPGAVEDLPVEALRAQFEANFFGWHDLTRRIIPVMRKQGHGRIVQCSSIL---GLVPMKY--------RGAYNASKFAI  155 (277)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHH---HCCCCCC--------CCHHHHHHHHH
T ss_conf             567708886799999998870189999999972331348983899988844---4888999--------83899999999


Q ss_pred             HHHHCCC
Q ss_conf             6531012
Q gi|254780921|r  132 EEKVASY  138 (290)
Q Consensus       132 E~~v~~~  138 (290)
                      |-+...+
T Consensus       156 ~~~~~sL  162 (277)
T PRK05993        156 EGLSDTL  162 (277)
T ss_pred             HHHHHHH
T ss_conf             9999999


No 66 
>PRK07832 short chain dehydrogenase; Provisional
Probab=99.41  E-value=1e-12  Score=90.85  Aligned_cols=126  Identities=20%  Similarity=0.221  Sum_probs=92.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------------CCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             4999978897889999999-6498599961367----------------------0878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------------IDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------------~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      ++|||||++=||.++++.| .+|++|+.++|++                      +|++|.++++++.++.     ++|+
T Consensus         2 ~alITGassGIG~a~A~~la~~Ga~v~l~~r~~~~l~~~~~~l~~~g~~~~~~~~~Dvsd~~~v~~~~~~~~~~~g~iDi   81 (272)
T PRK07832          2 RCFVTGAASGIGRATALRLAAQGAELFLTDRDADGLAQTVADARALGGTVPEHRALDISDYDAVAAFAADIHAAHPSMDV   81 (272)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             79994720199999999999889989999898899999999998458971478856689999999999999997299888


Q ss_pred             EEECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             997863445432----233221024201222110001122----33--33334455321113575544211112222111
Q gi|254780921|r   54 IINPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SI--GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        54 Vih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~--~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      +||.||+.....    ...+.+..+++|+.|+.++++++.    +.  +..+|.+||..-+   ...|.        .+.
T Consensus        82 LiNNAGi~~~g~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~~G~IVnisS~ag~---~~~p~--------~~~  150 (272)
T PRK07832         82 VMNIAGISAWGTVDRLTHEQWRRMVDINLMGPIHVIETFVPPMVAAGRGGHLVNVSSAAGL---VGLPW--------HAA  150 (272)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC---CCCCC--------CCH
T ss_conf             9987876888873458999999999987289999999999999983899689997577755---68999--------802


Q ss_pred             CHHHHHHHHHHHCCC
Q ss_conf             012456666531012
Q gi|254780921|r  124 YGKSKLAGEEKVASY  138 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~  138 (290)
                      |+.||.+..-+....
T Consensus       151 Y~ASK~av~g~~esL  165 (272)
T PRK07832        151 YSASKYGLRGLSEVL  165 (272)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 67 
>PRK06482 short chain dehydrogenase; Provisional
Probab=99.41  E-value=3.8e-13  Score=93.25  Aligned_cols=126  Identities=18%  Similarity=0.184  Sum_probs=94.4

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH------------------HCCCCCHHHHHHHHHH-----CCCCEEEECC
Q ss_conf             999978897889999999-649859996136------------------7087899999999975-----5998999786
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP------------------DIDLLKPKDFASFFLS-----FSPDVIINPA   58 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~------------------~~D~~~~~~~~~~l~~-----~~pd~Vih~A   58 (290)
                      +||||+++=||.++++.| .+|+.|+++.|+                  ++|++|.+++++++++     -++|++||.|
T Consensus         5 ~lITGaSsGiG~ala~~l~~~G~~Vi~t~R~~~~l~~l~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDvLVNNA   84 (276)
T PRK06482          5 WFITGASSGFGRGLTERLLARGDRVAATVRRPDALDDLKARYGERLWVLQLDVTDTAAVRAVVDRAFAELGRIDVVVSNA   84 (276)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99915865999999999998899899997898999999986699579999537999999999999999809987887468


Q ss_pred             CCCCCCCCC----CCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             344543223----3221024201222110001122----333-3334455321113575544211112222111012456
Q gi|254780921|r   59 AYTAVDKAE----DEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        59 a~~~~~~~e----~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~  129 (290)
                      |+......|    .+.+..+++|+.|+.++++++.    +.+ .++|.+||-.-+   ...|        -.+.|+.||.
T Consensus        85 G~~~~g~~ee~~~~~~~~~~~vN~~g~~~~~ra~lP~mr~~~~G~IinisS~~g~---~~~p--------~~~~Y~AsK~  153 (276)
T PRK06482         85 GYGLFGAAEELSDAQIRRQIDTNLTGSIQVIRAALPHLRRQGGGRIVQVSSEGGQ---IAYP--------GFSLYHASKW  153 (276)
T ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHCHHHHHCCCCEEEEECCHHHC---CCCC--------CCHHHHHHHH
T ss_conf             7778887676775779999887417799999985735575589779995452434---6899--------9768999999


Q ss_pred             HHHHHHCCCC
Q ss_conf             6665310122
Q gi|254780921|r  130 AGEEKVASYT  139 (290)
Q Consensus       130 ~~E~~v~~~~  139 (290)
                      +.|-+...+.
T Consensus       154 Al~g~tesLa  163 (276)
T PRK06482        154 GIEGFVESVR  163 (276)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999999


No 68 
>PRK12824 acetoacetyl-CoA reductase; Provisional
Probab=99.41  E-value=4e-13  Score=93.09  Aligned_cols=179  Identities=16%  Similarity=0.174  Sum_probs=112.3

Q ss_pred             CE--EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------------CCCCCHHHHHHHHHHC-----C
Q ss_conf             94--999978897889999999-6498599961367----------------------0878999999999755-----9
Q gi|254780921|r    1 MK--CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------------IDLLKPKDFASFFLSF-----S   50 (290)
Q Consensus         1 Mk--iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------------~D~~~~~~~~~~l~~~-----~   50 (290)
                      |+  +||||+++=||.++++.| .+|++|+.++|++                      +|++|++++++++++.     +
T Consensus         1 M~KvalITGas~GIG~a~a~~la~~G~~Vv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~d~~~~~~~v~~~~~~~g~   80 (245)
T PRK12824          1 MKKIALVTGAKRGIGSAIARELLADGYRVIATYFGNYDAAKDWFEEYGFTEDQVRLKSLDVTDTEECQEALARIEEEEGP   80 (245)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             98599994788889999999999879989999588077899999987404993899991389999999999999997499


Q ss_pred             CCEEEECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             989997863445432----233221024201222110001122----333-33344553211135755442111122221
Q gi|254780921|r   51 PDVIINPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPL  121 (290)
Q Consensus        51 pd~Vih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~  121 (290)
                      +|++||+|+++....    ...+.+..+++|+.++-.+++++.    +.+ -++|++||-..+-+...           .
T Consensus        81 iDiLVnnAG~~~~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IVnisS~~~~~~~~~-----------~  149 (245)
T PRK12824         81 VDILVNNAGITRDSGFKRMSHQEWNDVINTNLNSVFNVTQPLFPAMCEQGYGRIINISSVNGLKGQFG-----------Q  149 (245)
T ss_pred             CCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCC-----------C
T ss_conf             98999898889999902399999999999973415999999999999839955999746775778899-----------6


Q ss_pred             CCCHHHHHHHHHHHCCCCCC---CCC----CCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHH
Q ss_conf             11012456666531012223---223----55542000368632000201124665215304554544522368999999
Q gi|254780921|r  122 NIYGKSKLAGEEKVASYTNN---YVI----LRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQ  194 (290)
Q Consensus       122 ~~Yg~sK~~~E~~v~~~~~~---~~I----lR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~  194 (290)
                      ..|+.+|.+...+.+..+..   +-|    +-|+++-.|.-..+.....+...++.++.    .++   -.+|+|+++..
T Consensus       150 ~~Y~asKaal~~ltk~lA~E~a~~gIrvN~I~PG~i~T~~~~~~~~e~~~~~~~~~Pl~----R~g---~peevA~~v~F  222 (245)
T PRK12824        150 TNYSAAKAGMIGFTKALASEGARYGITVNCIAPGYIATPMVEQAGPEVLQSIKNQIPMK----RLG---TPEEIAAAVAF  222 (245)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCHHCCHHHHHHHHHCCCCC----CCC---CHHHHHHHHHH
T ss_conf             89999999999999999999725491999997446878210005999999998569988----987---89999999999


Q ss_pred             HHH
Q ss_conf             998
Q gi|254780921|r  195 IAH  197 (290)
Q Consensus       195 ~~~  197 (290)
                      ++.
T Consensus       223 L~S  225 (245)
T PRK12824        223 LVS  225 (245)
T ss_pred             HHC
T ss_conf             958


No 69 
>PRK07102 short chain dehydrogenase; Provisional
Probab=99.41  E-value=6.6e-13  Score=91.89  Aligned_cols=128  Identities=23%  Similarity=0.290  Sum_probs=92.3

Q ss_pred             CE-EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------------CCCCCHHHHHHHHHHC--CCCEE
Q ss_conf             94-999978897889999999-6498599961367----------------------0878999999999755--99899
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------------IDLLKPKDFASFFLSF--SPDVI   54 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------------~D~~~~~~~~~~l~~~--~pd~V   54 (290)
                      || ||||||++=||.++++.| .+|++|+.++|++                      +|++|.+++++++++.  ++|++
T Consensus         1 MK~vlITGassGIG~a~A~~la~~G~~v~l~~R~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~~d~~   80 (243)
T PRK07102          1 MKKILIIGATSDIARACARRYAAAGARLYLAARDTERLERIAADLEARGAVAVATHELDILDTARHAAFLDNLPALPDTV   80 (243)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCEE
T ss_conf             99799915745999999999998799899998988999999999985358628998434036999999999987537979


Q ss_pred             EECCCCCCCCC-CCCCC---CEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             97863445432-23322---1024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVDK-AEDEP---EIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~~-~e~~~---~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      +|+|++..... .+.++   +..+++|+.++..+++.+.    +.+ -++|.+||-.   |....|.        ...|+
T Consensus        81 v~~aG~~~~~~~~~~~~~~~~~~~~vN~~g~~~l~~~~~~~m~~~~~G~Iv~isS~a---g~~g~p~--------~~~Y~  149 (243)
T PRK07102         81 LIAVGTLGDQAACEADPALALREFRTNFEGPIALLTLLANRFEARGSGTIVGISSVA---GDRGRAS--------NYVYG  149 (243)
T ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHH---HCCCCCC--------CCHHH
T ss_conf             997303678730239999999999999899999999999998872397499982566---4778999--------82699


Q ss_pred             HHHHHHHHHHCCCC
Q ss_conf             24566665310122
Q gi|254780921|r  126 KSKLAGEEKVASYT  139 (290)
Q Consensus       126 ~sK~~~E~~v~~~~  139 (290)
                      .||.+.+.+.+...
T Consensus       150 aSKaal~~~~~sL~  163 (243)
T PRK07102        150 SAKAALTAFLSGLR  163 (243)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999


No 70 
>PRK06101 short chain dehydrogenase; Provisional
Probab=99.40  E-value=9.4e-13  Score=91.01  Aligned_cols=128  Identities=18%  Similarity=0.196  Sum_probs=92.2

Q ss_pred             CE-EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-----------------CCCCCHHHHHHHHHHC--CCCEEEECCC
Q ss_conf             94-999978897889999999-6498599961367-----------------0878999999999755--9989997863
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-----------------IDLLKPKDFASFFLSF--SPDVIINPAA   59 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-----------------~D~~~~~~~~~~l~~~--~pd~Vih~Aa   59 (290)
                      || ||||||++=||.++++.| .+|++|+.++|++                 +|++|.+++++.+++.  .+|++||+||
T Consensus         1 MktvlITGassGIG~a~A~~la~~G~~Vi~~~R~~~~l~~~~~~~~~~~~~~~Dvtd~~~~~~~~~~~~~~~d~~i~naG   80 (241)
T PRK06101          1 MTSVLITGATSGIGKQLALDYAKAGWKVIACGRNEAVLDELHDQSSNIFTLAFDVTDYEETKAALSQLPFIPELWIFNAG   80 (241)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHCCCCCEEEECCC
T ss_conf             99899922404999999999998799899998999999999973288048985226799999999971877778999886


Q ss_pred             CCCCC-CCC---CCCCEEEEECCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             44543-223---3221024201222110001122---3333334455321113575544211112222111012456666
Q gi|254780921|r   60 YTAVD-KAE---DEPEIAFSINAEGAGAIAKAAD---SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGE  132 (290)
Q Consensus        60 ~~~~~-~~e---~~~~~~~~~Nv~~~~~l~~~~~---~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E  132 (290)
                      ..... ..+   .+.+..+++|+.|+.++++++.   +.+.++|.+||-.-+   ...|.        ...|+.||.+.+
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~~p~m~~~~~iv~isS~a~~---~~~p~--------~~~Y~ASKaal~  149 (241)
T PRK06101         81 DCEYMDDGIVDAQLMARVFNVNVVGVANCIEACQPHFQRGHRVVIVGSIASE---LALPR--------AEAYGASKAAVS  149 (241)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCC---CCCCC--------CHHHHHHHHHHH
T ss_conf             6676873448999999999998899999999999998738950577540105---68898--------468899999999


Q ss_pred             HHHCCCC
Q ss_conf             5310122
Q gi|254780921|r  133 EKVASYT  139 (290)
Q Consensus       133 ~~v~~~~  139 (290)
                      .+.+...
T Consensus       150 ~~~~sLa  156 (241)
T PRK06101        150 YFARTLA  156 (241)
T ss_pred             HHHHHHH
T ss_conf             9999999


No 71 
>PRK05599 hypothetical protein; Provisional
Probab=99.40  E-value=9.3e-13  Score=91.03  Aligned_cols=169  Identities=12%  Similarity=0.166  Sum_probs=107.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCCEEEEECHHH----------------------CCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             949999788978899999996498599961367----------------------0878999999999755-----9989
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPD----------------------IDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~~~v~~~~r~~----------------------~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      |.|||||||+=||.++++.|.+|++++.+.|+.                      +|++|.+++++++++.     +.|+
T Consensus         1 MtvlITGASsGIG~a~A~~lA~G~~vvl~~R~~e~l~~l~~~l~~~g~~~v~~~~~Dvtd~~~~~~~v~~~~~~~g~id~   80 (246)
T PRK05599          1 MSILILGGTSDIAGEIATLLAHGEDVVLAARRPEAAGGLAEDLRQLGATSVHVLSFDATDLDSHRELVKQTQELAGEISL   80 (246)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             98999888689999999999859949999999999999999998625971899728999999999999999986198439


Q ss_pred             EEECCCCCCC-CCCCCCC---CEEEEECCCCCCCCCCCCC----C--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9978634454-3223322---1024201222110001122----3--333334455321113575544211112222111
Q gi|254780921|r   54 IINPAAYTAV-DKAEDEP---EIAFSINAEGAGAIAKAAD----S--IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        54 Vih~Aa~~~~-~~~e~~~---~~~~~~Nv~~~~~l~~~~~----~--~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      +|+.||+... ...+.+.   .....+|+.++..++..+.    .  .+..+|.+||-+-|   ...|.        ...
T Consensus        81 lv~naGi~~~~~~~~~d~~~~~~~~~vN~~~~~~~~~~~~~~~~~~~~~G~Iv~iSSvag~---~~~~~--------~~~  149 (246)
T PRK05599         81 AVVAFGILGDQERAETDEAHAVEIATVDYTAQVSMLTVLADELRAQTTPSTIVAFSSIAGW---RARRA--------NYV  149 (246)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHC---CCCCC--------CCH
T ss_conf             9987766787320118999999999988699999999999999854699479999676757---87888--------850


Q ss_pred             CHHHHHHHHHHHCCCCC-------CCCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             01245666653101222-------32235554200036863200020112466521530455454452236899999999
Q gi|254780921|r  124 YGKSKLAGEEKVASYTN-------NYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIA  196 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~~-------~~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~  196 (290)
                      |+.||..-+.+......       +..+++|++|-.+        |.+.. ...++.         +..+++|+.+...+
T Consensus       150 Y~ASKaal~~~~~~L~~el~~~gI~V~~v~PG~V~T~--------mt~~~-~~~p~~---------~spe~~A~~i~~~i  211 (246)
T PRK05599        150 YGSTKAGLDAFCQGLADSLHGSHVRLIIARPGFVIGS--------MTTGM-KPAPMS---------VYPRDVAAAVVSAI  211 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCC--------CCCCC-CCCCCC---------CCHHHHHHHHHHHH
T ss_conf             8699999999999999995377968999844988362--------00799-989875---------89999999999999


Q ss_pred             HH
Q ss_conf             84
Q gi|254780921|r  197 HN  198 (290)
Q Consensus       197 ~~  198 (290)
                      .+
T Consensus       212 ~~  213 (246)
T PRK05599        212 TS  213 (246)
T ss_pred             HH
T ss_conf             81


No 72 
>PRK09072 short chain dehydrogenase; Provisional
Probab=99.40  E-value=9.2e-13  Score=91.07  Aligned_cols=179  Identities=15%  Similarity=0.187  Sum_probs=109.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------------CCCCCHHHHHHHHHH----CCCCEEEEC
Q ss_conf             4999978897889999999-6498599961367-------------------087899999999975----599899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------------IDLLKPKDFASFFLS----FSPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------------~D~~~~~~~~~~l~~----~~pd~Vih~   57 (290)
                      .+||||+++=||.++++.| .+|++|+.++|++                   +|++|+++++.+.+.    .++|++||+
T Consensus         7 ~vlITGassGIG~a~A~~la~~G~~vil~~R~~~~L~~~~~~l~~~~~~~~~~Dls~~~~~~~~~~~~~~~g~iDiLInN   86 (262)
T PRK09072          7 RVLLTGASGGIGEALAEALCAAGARLLLVGRNAEKLEALAARPYPGRVRWVVADLTSEAGREAVLARAREMGGINVLINN   86 (262)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             89994862399999999999879989999898999999999845897699997179999999999999984999899989


Q ss_pred             CCCCCCCCC----CCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             634454322----33221024201222110001122----333-333445532111357554421111222211101245
Q gi|254780921|r   58 AAYTAVDKA----EDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        58 Aa~~~~~~~----e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
                      ||+......    +.+.+..+++|+.++.++++++.    +.+ .++|++||..   |....|.        .+.|+.||
T Consensus        87 AG~~~~~~~~~~~~~~~~~~~~vN~~g~~~lt~~~lp~m~~~~~G~IvnisS~a---g~~~~p~--------~~~Y~ASK  155 (262)
T PRK09072         87 AGVNHFALLDQQDPEAIDRLLALNLTAPMQLTRALLPLLRAQPSAAVVNVGSTF---GSIGYPG--------YASYCASK  155 (262)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHH---HHCCCCC--------CHHHHHHH
T ss_conf             977889863549999999999995689999999999999876994899966866---6257899--------81799999


Q ss_pred             HHHHHHHCCCCCCC--CCCCCCCCE-ECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             66665310122232--235554200-036863200020112466521530455454452236899999999844
Q gi|254780921|r  129 LAGEEKVASYTNNY--VILRTAWVY-SIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNL  199 (290)
Q Consensus       129 ~~~E~~v~~~~~~~--~IlR~~~vy-G~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~  199 (290)
                      .+.+.+........  .=+|...|. |.-..+|...-....  +...   ....   ..-+++|++++..+++.
T Consensus       156 aal~~~s~sL~~El~~~gI~V~~v~Pg~v~T~~~~~~~~~~--~~~~---~~~~---~~pe~vA~~i~~~i~~~  221 (262)
T PRK09072        156 FALRGFSEALRRELADTGVRVLYLAPRATRTAMNSAAVTAL--NAAL---GNAM---DSPEDVAAAVLQAIEQE  221 (262)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHH--HHHH---CCCC---CCHHHHHHHHHHHHHCC
T ss_conf             99999999999984622908999972899988885023454--5541---6678---99999999999999469


No 73 
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed
Probab=99.40  E-value=6.1e-13  Score=92.07  Aligned_cols=129  Identities=16%  Similarity=0.175  Sum_probs=95.1

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             999978897889999999-6498599961367---------------------0878999999999755-----998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      +|||||++-||.++++.| .+|++|+.++|++                     +|++|++++++++++.     ++|++|
T Consensus         9 alITGgs~GIG~aia~~la~~G~~V~~~~r~~~~~~~~~~~l~~~g~~~~~~~~Dl~~~~~~~~~~~~~~~~~g~iD~lv   88 (253)
T PRK12826          9 ALVTGAARGIGRAIAVRFAADGADVIVVDICGQAAAATAELVAAAGGKARAYQVDVRDRAALKALVAAGVERFGRLDILV   88 (253)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99948977899999999998799899998988999999999985099589999517999999999999999839987899


Q ss_pred             ECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             786344543----2233221024201222110001122----333-3334455321113575544211112222111012
Q gi|254780921|r   56 NPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        56 h~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      |+|++....    ..+.+.+..+++|+.++.++++.+.    +.+ -++|++||..   |. ..|+.      ....|+.
T Consensus        89 nnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~---g~-~~~~~------~~~~Y~a  158 (253)
T PRK12826         89 ANAGIFPLTPFAELDDEDWDRVIDVNLTGTFLLTQAALPALKRAGGGRIVLTSSVA---GP-RVGYP------GLAHYAA  158 (253)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHH---HH-CCCCC------CCHHHHH
T ss_conf             89988999981559999999999987566643378746999976997699995256---41-56899------7388999


Q ss_pred             HHHHHHHHHCCCCCC
Q ss_conf             456666531012223
Q gi|254780921|r  127 SKLAGEEKVASYTNN  141 (290)
Q Consensus       127 sK~~~E~~v~~~~~~  141 (290)
                      +|.+.+.+.+..+..
T Consensus       159 sKaal~~ltk~lA~e  173 (253)
T PRK12826        159 SKAGVVGFTRALALE  173 (253)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999998


No 74 
>PRK06182 short chain dehydrogenase; Validated
Probab=99.39  E-value=4.4e-13  Score=92.88  Aligned_cols=126  Identities=21%  Similarity=0.243  Sum_probs=93.5

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------CCCCCHHHHHHHHHHC-----CCCEEEECCCCC
Q ss_conf             999978897889999999-6498599961367---------------0878999999999755-----998999786344
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------IDLLKPKDFASFFLSF-----SPDVIINPAAYT   61 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------~D~~~~~~~~~~l~~~-----~pd~Vih~Aa~~   61 (290)
                      +|||||++=||.++++.| .+|++|+.++|+.               +|++|.+++++++++.     +.|++||+||+.
T Consensus         6 ~lITGassGIG~a~a~~la~~G~~V~~~~r~~~~l~~l~~~~~~~~~~Dvt~~~~v~~~~~~i~~~~g~iDiLVNNAG~~   85 (273)
T PRK06182          6 ALVTGASSGIGKATARKLIAEGFTVYGAARRVDKMEDLASLGIHPLALDVTDEASMKAAVATILAEEGRIDVLVNNAGYG   85 (273)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             99906320999999999998799899997989999999967997999858999999999999999839988775058677


Q ss_pred             CCCC----CCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             5432----233221024201222110001122----333-3334455321113575544211112222111012456666
Q gi|254780921|r   62 AVDK----AEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGE  132 (290)
Q Consensus        62 ~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E  132 (290)
                      ....    ...+.+..+++|+.|+.++++++.    +.+ -++|.+||-.   |....|.        .+.|+.||.+.+
T Consensus        86 ~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IvnisS~a---g~~~~p~--------~~~Y~asK~av~  154 (273)
T PRK06182         86 SYGAIEDVPIDEARAQFEVNLFGAARLTQLVLPHMRAQRSGRIINITSMG---GKIYTPL--------GAWYHATKFALE  154 (273)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHH---HCCCCCC--------CCHHHHHHHHHH
T ss_conf             78748873199999999988699999999853342148995899986844---4077999--------757999999999


Q ss_pred             HHHCCCC
Q ss_conf             5310122
Q gi|254780921|r  133 EKVASYT  139 (290)
Q Consensus       133 ~~v~~~~  139 (290)
                      .+.+...
T Consensus       155 ~~t~~La  161 (273)
T PRK06182        155 GLSDALR  161 (273)
T ss_pred             HHHHHHH
T ss_conf             9999999


No 75 
>PRK06181 short chain dehydrogenase; Provisional
Probab=99.39  E-value=2.5e-12  Score=88.63  Aligned_cols=183  Identities=16%  Similarity=0.120  Sum_probs=111.3

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++=||.++++.| .+|++|+.++|++                     +|++|.+++++++++.     ++|++
T Consensus         3 v~lITGassGIG~a~A~~la~~Ga~vvl~~r~~~~l~~~~~~l~~~g~~~~~~~~Dvs~~~~~~~~~~~~~~~~G~iDiL   82 (263)
T PRK06181          3 VVIITGASEGIGRALAVRLARAGARLVLAARNEERLASLAQELANYGAEALVVATDVSDAEACERLIEAAVAHFGGIDIL   82 (263)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99995810199999999999879989999889999999999999549967999807999999999999999982996489


Q ss_pred             EECCCCCCCCCC-C----CCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             978634454322-3----3221024201222110001122----333333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVDKA-E----DEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~~~-e----~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||.||+...... +    ...+..+++|+.|+.++++++.    +.+-++|.+||-.-+   ...|.        .+.|+
T Consensus        83 VNNAGi~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~G~IvnisS~ag~---~~~p~--------~~~Y~  151 (263)
T PRK06181         83 VNNAGMTMWSRFDELTDLSVLEDVMRVNYLGAVYCTHAALPHLKASQGQIVVVSSLAGL---TGVPT--------RSGYA  151 (263)
T ss_pred             EECCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHC---CCCCC--------CHHHH
T ss_conf             98785678887232686999999999982999999999999986389379999475552---77899--------73599


Q ss_pred             HHHHHHHHHHCCCCCC---CCCCCCCCCE-ECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             2456666531012223---2235554200-03686320002011246652153045545445223689999999984
Q gi|254780921|r  126 KSKLAGEEKVASYTNN---YVILRTAWVY-SIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~~---~~IlR~~~vy-G~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      .||.+...+.+.....   +- +|...|. |.-..++....+.  ..+....-..-........+++|+.++..+++
T Consensus       152 aSK~av~~~t~~la~El~~~g-IrVn~v~PG~v~T~~~~~~~~--~~~~~~~~~~~~~~~~~~pe~vA~~i~~ai~~  225 (263)
T PRK06181        152 ASKHALHGFFDSLRIELADTG-VAVTVVCPGFVATDIRKRALD--GDGKPLGKSPMQEGKIMSAEECAEMMLPAIAR  225 (263)
T ss_pred             HHHHHHHHHHHHHHHHHCCCC-EEEEEEECCCCCCCCCHHHCC--CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             999999999999999847559-399999728898974700144--45552346744356789999999999999966


No 76 
>PRK07825 short chain dehydrogenase; Provisional
Probab=99.37  E-value=2e-12  Score=89.16  Aligned_cols=175  Identities=16%  Similarity=0.171  Sum_probs=111.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-----------------CCCCCHHHHHHHHHHC-----CCCEEEECC
Q ss_conf             4999978897889999999-6498599961367-----------------0878999999999755-----998999786
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-----------------IDLLKPKDFASFFLSF-----SPDVIINPA   58 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-----------------~D~~~~~~~~~~l~~~-----~pd~Vih~A   58 (290)
                      .+|||||++=||.++++.| .+|.+|+..+|++                 +|++|++++++++++.     +.|++||+|
T Consensus         7 vvlITGassGIG~a~A~~la~~Ga~V~i~~r~~~~l~~~~~~~~~~~~~~~DVtd~~~v~~~~~~~~~~~G~iDiLVNNA   86 (273)
T PRK07825          7 VIAITGGARGIGLATARALAALGAKVAIGDLDEALAKESAAELGLVVGGPLDVTDPASFAAFLDAVEADLGPIDVLVNNA   86 (273)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             89992623399999999999879989999799999999998607855999147999999999999999709977899878


Q ss_pred             CCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             344543----2233221024201222110001122----3333-334455321113575544211112222111012456
Q gi|254780921|r   59 AYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        59 a~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~  129 (290)
                      |+....    ..+.+.+..+++|+.|+.++++++.    +.+. ++|.+||-.-+   ...|.        .+.|+.||.
T Consensus        87 Gi~~~~~~~e~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IVnisS~ag~---~~~p~--------~~~Y~ASK~  155 (273)
T PRK07825         87 GIMPVGPFLDEPDRATRRILDVNVYGVILGSKLAAPRMVPRGRGHIVNVASLAGK---IAVPG--------MATYCASKH  155 (273)
T ss_pred             CCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEECHHHH---CCCCC--------CCHHHHHHH
T ss_conf             7789987343999999999886039999999999999997399479998476764---77999--------835999999


Q ss_pred             HHHHHHCCCCCCC--CCCCCCCCEECCCCCCCCE-EECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             6665310122232--2355542000368632000-20112466521530455454452236899999999844
Q gi|254780921|r  130 AGEEKVASYTNNY--VILRTAWVYSIFGSNFLLS-MLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNL  199 (290)
Q Consensus       130 ~~E~~v~~~~~~~--~IlR~~~vyG~~~~~~v~~-~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~  199 (290)
                      +...+.+.....+  .=+|...|. |   +++.+ |..-......+        -.+.-+|+|++|+..+++.
T Consensus       156 av~g~t~sLa~El~~~gIrVn~V~-P---G~v~T~m~~g~~~~~~~--------~~~~pe~vA~~iv~~i~~~  216 (273)
T PRK07825        156 AVVGLTDALRLELRPTGVHVSVVL-P---TFVNTELIAGTKGAKGL--------KNAEPEDVAAAIVALVAKP  216 (273)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEE-E---CCCCCCCCCCCCCCCCC--------CCCCHHHHHHHHHHHHHCC
T ss_conf             999999999998523095999997-0---99985657999876688--------9999999999999999689


No 77 
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.37  E-value=9e-13  Score=91.11  Aligned_cols=129  Identities=19%  Similarity=0.202  Sum_probs=95.5

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------------CCCCCHHHHHHHHHHC-----CCCEEEE
Q ss_conf             4999978897889999999-6498599961367-------------------0878999999999755-----9989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------------IDLLKPKDFASFFLSF-----SPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------------~D~~~~~~~~~~l~~~-----~pd~Vih   56 (290)
                      .+|||||++-||.++++.| .+|++|+.++|++                   +|++|.+++++++++.     ++|++||
T Consensus         8 ~alITGgs~GIG~aia~~la~~G~~V~i~~r~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iD~lIn   87 (250)
T PRK07231          8 VAIVTGAGSGFGEGIARRFAAEGARVVVTDRNQEAAERVAAEIRGGRAIAVAADVSDEADVRAAVEAALERFGSVDILVN   87 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             89993888689999999999879999999798899999999844996799993079999999999999998199719998


Q ss_pred             CCCCCCCC-----CCCCCCCEEEEECCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             86344543-----2233221024201222110001122----33-33334455321113575544211112222111012
Q gi|254780921|r   57 PAAYTAVD-----KAEDEPEIAFSINAEGAGAIAKAAD----SI-GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        57 ~Aa~~~~~-----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~-~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      +||+....     ..+.+.+..+++|+.++.++++++.    +. +.++|++||...+.+   .|        -...|+.
T Consensus        88 nAG~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IinisS~~~~~~---~~--------~~~~Y~a  156 (250)
T PRK07231         88 NAGTTHRNGPLLDVDEAEFDRVYAVNVKSIYLWAQAAVPAWRGEGGGAIVNVASTAGIRP---RP--------GLGWYNA  156 (250)
T ss_pred             CCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCC---CC--------CCHHHHH
T ss_conf             883378998927699999999999998999999999999999839964999944776588---99--------9627999


Q ss_pred             HHHHHHHHHCCCCCC
Q ss_conf             456666531012223
Q gi|254780921|r  127 SKLAGEEKVASYTNN  141 (290)
Q Consensus       127 sK~~~E~~v~~~~~~  141 (290)
                      +|.+.+.+.+..+..
T Consensus       157 sKaal~~lt~~lA~e  171 (250)
T PRK07231        157 SKGAVITATKSLAVE  171 (250)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 78 
>PRK08340 glucose-1-dehydrogenase; Provisional
Probab=99.36  E-value=1.3e-12  Score=90.30  Aligned_cols=129  Identities=14%  Similarity=0.142  Sum_probs=92.0

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             94999978897889999999-6498599961367--------------------0878999999999755-----99899
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      |+||||||++=||.++++.| .+|.+|+.++|++                    +|++|++++++++++.     +.|++
T Consensus         1 mnVlITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iD~L   80 (259)
T PRK08340          1 MNVLVTASSRGIGFNVARELLKKGARVVISSRNEENLEKALKELKELGEVYAIKADLSDKDDLKNLVKEAWELLGGIDAL   80 (259)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             98999758778999999999987999999979989999999998741887999963699899999999999985998889


Q ss_pred             EECCCCCCCCCC---C---CCCCEEEEECCCCCCCCCCCC-----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             978634454322---3---322102420122211000112-----233-3333445532111357554421111222211
Q gi|254780921|r   55 INPAAYTAVDKA---E---DEPEIAFSINAEGAGAIAKAA-----DSI-GIPCIYISTDYVFDGLSRTPIDEFSPTNPLN  122 (290)
Q Consensus        55 ih~Aa~~~~~~~---e---~~~~~~~~~Nv~~~~~l~~~~-----~~~-~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~  122 (290)
                      ||.|+....+.+   +   .+....+.+|+.++..+++.+     ++. +-++|++||.....+           ..+..
T Consensus        81 VnNAg~~~~~p~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~~~~~~~~G~Ii~isS~~~~~~-----------~~~~~  149 (259)
T PRK08340         81 VWNAGNVKCEPCMLHEAGYSDWLEAALLHLVAPGYLTTLLLQTWLEKKMKGVLVYLSSVSVKEP-----------MPPLL  149 (259)
T ss_pred             EECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHEEECC-----------CCCHH
T ss_conf             9857667789743354999999999998715599999999999998658864999721210255-----------78626


Q ss_pred             CCHHHHHHHHHHHCCCCC
Q ss_conf             101245666653101222
Q gi|254780921|r  123 IYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       123 ~Yg~sK~~~E~~v~~~~~  140 (290)
                      .|+.+|.+.+.+.+..+.
T Consensus       150 ~y~asKaal~~ltk~lA~  167 (259)
T PRK08340        150 LADVTRAGLVQLAKGVSR  167 (259)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             899988999999999999


No 79 
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.35  E-value=2.2e-12  Score=88.87  Aligned_cols=177  Identities=12%  Similarity=0.116  Sum_probs=106.9

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++-||+++++.| .+|.+|+.++|++                     +|++|.++++++++..     ++|++
T Consensus         7 ~~lITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~iD~l   86 (253)
T PRK08217          7 VIVITGGAQGLGRAMAEYLAQKGAKLALIDLNQEKLEEAVAQCAALGGEAEVYAANVTDEEDVEATFAQIAEDFGQLNGL   86 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89994887789999999999879989999799999999999999659948999824799999999999999983998599


Q ss_pred             EECCCCCCCC----C---------CCCCCCEEEEECCCCCCCCCCCC----CC--CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9786344543----2---------23322102420122211000112----23--3333344553211135755442111
Q gi|254780921|r   55 INPAAYTAVD----K---------AEDEPEIAFSINAEGAGAIAKAA----DS--IGIPCIYISTDYVFDGLSRTPIDEF  115 (290)
Q Consensus        55 ih~Aa~~~~~----~---------~e~~~~~~~~~Nv~~~~~l~~~~----~~--~~~~~I~iSS~~Vy~g~~~~p~~E~  115 (290)
                      ||+||+....    .         ...+.+..+++|+.++..+++.+    .+  .+..+|.+||...+ +   .+    
T Consensus        87 VnNAGi~~~~~~~~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~~g~Ii~isS~~~~-~---~~----  158 (253)
T PRK08217         87 INNAGILRDGLLVKAKDGKVTSKMSLEQFQSVIDVNLTGVFLCGREAAAKMIESGSKGVIINISSIARA-G---NM----  158 (253)
T ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHCC-C---CC----
T ss_conf             985743677664446666520119999999999998178999999999999984897279996331113-8---88----


Q ss_pred             CCCCCCCCCHHHHHHHHHHHCCCCCC---CC----CCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHH
Q ss_conf             12222111012456666531012223---22----355542000368632000201124665215304554544522368
Q gi|254780921|r  116 SPTNPLNIYGKSKLAGEEKVASYTNN---YV----ILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQI  188 (290)
Q Consensus       116 d~~~P~~~Yg~sK~~~E~~v~~~~~~---~~----IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~  188 (290)
                          ....|+.+|.+.+.+.+..+..   +-    .+-|+++-.+....+-....+...+..++       +..--.+|+
T Consensus       159 ----~~~~Y~asKaal~~ltk~lA~el~~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~pl-------~R~g~p~dv  227 (253)
T PRK08217        159 ----GQTNYSASKAGVAAMTVTWAKELARYGIRVAAIAPGVIETEMTAAMKPEALERLEKMIPV-------GRLGEPEEI  227 (253)
T ss_pred             ----CCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCC-------CCCCCHHHH
T ss_conf             ----861689999999999999999953219599999738898733111799999999857999-------998499999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999998
Q gi|254780921|r  189 ARAIIQIAH  197 (290)
Q Consensus       189 a~~i~~~~~  197 (290)
                      |+++..++.
T Consensus       228 a~~v~fL~s  236 (253)
T PRK08217        228 AHTVRFIIE  236 (253)
T ss_pred             HHHHHHHHH
T ss_conf             999999995


No 80 
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR011283   This entry represent acetoacetyl-CoA reductase, a member of the family short-chain-alcohol dehydrogenases. Note that, despite the precision implied by the enzyme name, the reaction of 1.1.1.36 from EC is defined more generally as (R)-3-hydroxyacyl-CoA + NADP+ = 3-oxoacyl-CoA + NADPH. Members of this family may act in the biosynthesis of poly-beta-hydroxybutyrate (e.g. Rhizobium meliloti) and related poly-beta-hydroxyalkanoates. Note that the member of this family from Azospirillum brasilense, designated NodG, appears to lack acetoacetyl-CoA reductase activity and to act instead in the production of nodulation factor. ; GO: 0018454 acetoacetyl-CoA reductase activity, 0042619 poly-hydroxybutyrate biosynthetic process, 0005737 cytoplasm.
Probab=99.35  E-value=1.4e-12  Score=89.99  Aligned_cols=104  Identities=20%  Similarity=0.220  Sum_probs=78.1

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH-----------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             999978897889999999-649859996136-----------------------70878999999999755-----9989
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-----------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-----------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      -|||||.|=||+++++.| ++||.|++.-++                       +.|+.+.++..+.+++.     ..|+
T Consensus         3 ALVTGg~GGIGtAIC~rL~~dG~~V~An~~p~N~~~a~~W~~~~~~~g~~~~~~~~DV~~~e~c~~~v~~v~a~lGpvDv   82 (244)
T TIGR01829         3 ALVTGGTGGIGTAICTRLAKDGYRVAANYVPSNEERAEAWLQEQGAQGFDFAVVEGDVSSFEDCKAAVAKVEAELGPVDV   82 (244)
T ss_pred             EEEECCCCCHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEE
T ss_conf             78857877446899999987598898817898258999999862698514789872767778999999999971195368


Q ss_pred             EEECCCCCCCCCCC-----CCCCEEEEECCCC----CCCCCCCCCCCCC-CCCCCCCCCCCCCCCCC
Q ss_conf             99786344543223-----3221024201222----1100011223333-33445532111357554
Q gi|254780921|r   54 IINPAAYTAVDKAE-----DEPEIAFSINAEG----AGAIAKAADSIGI-PCIYISTDYVFDGLSRT  110 (290)
Q Consensus        54 Vih~Aa~~~~~~~e-----~~~~~~~~~Nv~~----~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~  110 (290)
                      +||+|++|+ |...     .+.+....+|..+    |+.|.+.+.++|- |+|.|||-.   |.|..
T Consensus        83 LVNNAGITR-D~~F~KM~~~qW~~VI~TNL~SvFNVT~pV~~gM~eRGwGRIiNISSvN---G~KGQ  145 (244)
T TIGR01829        83 LVNNAGITR-DKTFKKMTYEQWSEVIDTNLNSVFNVTRPVIEGMRERGWGRIINISSVN---GQKGQ  145 (244)
T ss_pred             EEECCCCCC-CHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCEEEEEEEC---CCCCC
T ss_conf             986886440-3031249984688898631324415540014766216884168841214---77565


No 81 
>PRK09186 flagellin modification protein A; Provisional
Probab=99.35  E-value=1.9e-12  Score=89.28  Aligned_cols=185  Identities=15%  Similarity=0.086  Sum_probs=110.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             4999978897889999999-649859996136----------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      .+|||||+|=||.++++.| .+|.+|+.++++                      ++|++|+++++++++..     ++|+
T Consensus         6 ~~lVTGgs~GIG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~l~~~~~~~v~~~~~Dvt~~~~v~~~~~~~~~~~g~id~   85 (255)
T PRK09186          6 TILITGAGGLIGSALVKAILEAGGIVIAADINKEALNKLLESLGTIEKTKLTLVELDITDQESLEEFLSKSQERYGKIDG   85 (255)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89997958689999999999879999999698899999999998705980799984689999999999999998199778


Q ss_pred             EEECCCCCCC-------CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9978634454-------32233221024201222110001122----333-33344553211135755442111122221
Q gi|254780921|r   54 IINPAAYTAV-------DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPL  121 (290)
Q Consensus        54 Vih~Aa~~~~-------~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~  121 (290)
                      +||+|+.+..       +..+.+.+..+++|+.++-.+++.+.    +.+ -++|.+||-.-.-+++-..|.-.....| 
T Consensus        86 lVnnA~~~~~~~~~~~~~~~~~~~~~~~~vnl~~~~~~~~~~~~~m~~~~~G~IVnisSi~g~~~~~~~~~~g~~~~~~-  164 (255)
T PRK09186         86 AVNCAYPRNKQYGKKFFDVSLDDFNENLSLHLGSSFLFSQQFAKYFKKQGGGSLVNISSIYGVVAPKFEIYEGTSMTSP-  164 (255)
T ss_pred             EEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCHHHHCCCCCCCCCCCCCCCH-
T ss_conf             9975766787677770109999999999998399999999999988742897389956678734764211268765446-


Q ss_pred             CCCHHHHHHHHHHHCCCCCCC---CC----CCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHH
Q ss_conf             110124566665310122232---23----55542000368632000201124665215304554544522368999999
Q gi|254780921|r  122 NIYGKSKLAGEEKVASYTNNY---VI----LRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQ  194 (290)
Q Consensus       122 ~~Yg~sK~~~E~~v~~~~~~~---~I----lR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~  194 (290)
                      -.|+.+|.+.+.+.+..+..+   -|    +-|+.+...    ....+.+...+..+.       ..+...+|+|.++..
T Consensus       165 ~~Y~asKaal~~ltr~lA~e~a~~gIrVN~VaPG~i~~~----~~~~~~~~~~~~~~~-------~~~~~p~dia~~v~f  233 (255)
T PRK09186        165 VEYAAIKSGIIHLTKYLAKYFKDSNIRVNCVSPGGILDN----QPEAFLNAYKKSCNG-------KGMLDPEDICGSLVF  233 (255)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCC----CCHHHHHHHHHHCCC-------CCCCCHHHHHHHHHH
T ss_conf             767998899999999999996758989999855768899----989999999863557-------799899999999999


Q ss_pred             HHHH
Q ss_conf             9984
Q gi|254780921|r  195 IAHN  198 (290)
Q Consensus       195 ~~~~  198 (290)
                      ++..
T Consensus       234 L~Sd  237 (255)
T PRK09186        234 LLSD  237 (255)
T ss_pred             HHCC
T ss_conf             9570


No 82 
>PRK12827 short chain dehydrogenase; Provisional
Probab=99.35  E-value=1.4e-12  Score=89.94  Aligned_cols=128  Identities=16%  Similarity=0.158  Sum_probs=94.5

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH-------------------------HCCCCCHHHHHHHHHHC-----C
Q ss_conf             4999978897889999999-649859996136-------------------------70878999999999755-----9
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-------------------------DIDLLKPKDFASFFLSF-----S   50 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-------------------------~~D~~~~~~~~~~l~~~-----~   50 (290)
                      .+|||||++=||.++++.| .+|.+|+.+++.                         ++|++|++++++++++.     +
T Consensus         8 valVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~   87 (251)
T PRK12827          8 RVLITGGSGGLGRAIAVRLAADGADVIVLDIHPMRGRAEAEAVAALIEAAGGKALGLAFDVRDFAATRAALDAGVEEFGR   87 (251)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             89996825589999999999879989998488853289999999999964984999990389999999999999998399


Q ss_pred             CCEEEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC-----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9899978634454----32233221024201222110001122-----33-33334455321113575544211112222
Q gi|254780921|r   51 PDVIINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD-----SI-GIPCIYISTDYVFDGLSRTPIDEFSPTNP  120 (290)
Q Consensus        51 pd~Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~-----~~-~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P  120 (290)
                      +|++||+|++...    +..+.+.+..+++|+.++-.+++++.     .. +-++|.+||..-.-|   .|        .
T Consensus        88 iDiLVNnAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~~G~IInisS~~~~~~---~~--------~  156 (251)
T PRK12827         88 LDILVNNAGIATDAAFAELSIEEWDDVIDVNLDGFFNVTQAALPPMIRARRGGRIVNIASVAGVRG---NR--------G  156 (251)
T ss_pred             CCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCC---CC--------C
T ss_conf             979998998899999034999999999999859999999999999998389946999825333557---89--------8


Q ss_pred             CCCCHHHHHHHHHHHCCCCC
Q ss_conf             11101245666653101222
Q gi|254780921|r  121 LNIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       121 ~~~Yg~sK~~~E~~v~~~~~  140 (290)
                      ...|+.+|.+...+.+..+.
T Consensus       157 ~~~Y~asKaav~~lTr~lA~  176 (251)
T PRK12827        157 QVNYAASKAGLIGLTKTLAN  176 (251)
T ss_pred             CHHHHHHHHHHHHHHHHHHH
T ss_conf             68899999999999999999


No 83 
>PRK07024 short chain dehydrogenase; Provisional
Probab=99.35  E-value=2.2e-12  Score=88.98  Aligned_cols=171  Identities=18%  Similarity=0.155  Sum_probs=106.7

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------------CCCCCHHHHHHHHHH-----CCCCEEEE
Q ss_conf             4999978897889999999-6498599961367-------------------087899999999975-----59989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------------IDLLKPKDFASFFLS-----FSPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------------~D~~~~~~~~~~l~~-----~~pd~Vih   56 (290)
                      ||||||+++=||.++++.| .+|++|+.++|++                   +|++|.+++++++++     ..+|++||
T Consensus         4 ~VlITGassGIG~a~A~~la~~G~~v~l~~R~~~~L~~~~~~~~~~~~~~~~~Dv~d~~~~~~~~~~~~~~~g~iDilin   83 (256)
T PRK07024          4 KVFITGASSGIGQALAREYARQGATLGLVARRTDALQAFAARLPKARVSVYAADVRDADALAAAAADFIAAHGCPDVVIA   83 (256)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             89998460299999999999889989999898899999999767997699981179999999999999998399879998


Q ss_pred             CCCCCCCCCC-C-CC---CCEEEEECCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             8634454322-3-32---2102420122211000112----2333-3334455321113575544211112222111012
Q gi|254780921|r   57 PAAYTAVDKA-E-DE---PEIAFSINAEGAGAIAKAA----DSIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        57 ~Aa~~~~~~~-e-~~---~~~~~~~Nv~~~~~l~~~~----~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      +||+...... + .|   .+..+++|+.|+.++++..    ...+ .++|.+||-.-|   ...|.        .+.|+.
T Consensus        84 NAGi~~~~~~~~~~d~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~Iv~isS~ag~---~g~p~--------~~~Y~A  152 (256)
T PRK07024         84 NAGISVGTLTGEGEDLAVFREVMDTNYYGMVATFEPFIAPMRAARRGTLVGIASVAGV---RGLPG--------AGAYSA  152 (256)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHC---CCCCC--------CCHHHH
T ss_conf             8855678864453789999999999999999999987687502689349984354541---68999--------707999


Q ss_pred             HHHHHHHHHCCCCCC---CCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCC--CCHHHHHHHHHHHHHH
Q ss_conf             456666531012223---22355542000368632000201124665215304554544--5223689999999984
Q gi|254780921|r  127 SKLAGEEKVASYTNN---YVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP--TSALQIARAIIQIAHN  198 (290)
Q Consensus       127 sK~~~E~~v~~~~~~---~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p--~~v~D~a~~i~~~~~~  198 (290)
                      ||.+...+.......   +- +|...| -   ++|+.+=+.   ++..       +.-|  +..+++|+.|...+++
T Consensus       153 SKaal~~~~esL~~el~~~g-I~V~~i-~---PG~v~T~m~---~~~~-------~~~p~~~~pe~vA~~i~~ai~~  214 (256)
T PRK07024        153 SKAAAIKYLESLRVELRPAG-VRVVTI-A---PGYIRTPMT---AHNP-------YPMPFLMDADRFAARAARAIAR  214 (256)
T ss_pred             HHHHHHHHHHHHHHHHCCCC-EEEEEE-E---ECCCCCCCC---CCCC-------CCCCCCCCHHHHHHHHHHHHHC
T ss_conf             99999999999999865779-489999-7---189958877---7799-------9998768999999999999975


No 84 
>PRK09730 hypothetical protein; Provisional
Probab=99.35  E-value=1.3e-12  Score=90.14  Aligned_cols=180  Identities=16%  Similarity=0.155  Sum_probs=109.4

Q ss_pred             CEE-EEECCCCHHHHHHHHHH-HCCCEEEEECH-H---------------------HCCCCCHHHHHHHHHHC-----CC
Q ss_conf             949-99978897889999999-64985999613-6---------------------70878999999999755-----99
Q gi|254780921|r    1 MKC-LVIGNNGQIAQSLSSMC-VQDVEIIRVGR-P---------------------DIDLLKPKDFASFFLSF-----SP   51 (290)
Q Consensus         1 Mki-LVtG~~G~iG~~l~~~l-~~~~~v~~~~r-~---------------------~~D~~~~~~~~~~l~~~-----~p   51 (290)
                      ||| |||||++=||.++++.| .+|++|+...+ +                     ++|++|++++++++++.     ++
T Consensus         1 mKValITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~i~~~~g~i   80 (247)
T PRK09730          1 MAIALVTGGSRGIGRATALLLAQEGYTVAVNYQQNLHAAQEVVNLITQAGGKAFVLQADISDENQVVAMFTAIDQHDEPL   80 (247)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             97999906226999999999998799999966998789999999999749928999825899999999999999975995


Q ss_pred             CEEEECCCCCCC----C-CCCCCCCEEEEECCCCCCCCCCCCCC--------CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             899978634454----3-22332210242012221100011223--------3333344553211135755442111122
Q gi|254780921|r   52 DVIINPAAYTAV----D-KAEDEPEIAFSINAEGAGAIAKAADS--------IGIPCIYISTDYVFDGLSRTPIDEFSPT  118 (290)
Q Consensus        52 d~Vih~Aa~~~~----~-~~e~~~~~~~~~Nv~~~~~l~~~~~~--------~~~~~I~iSS~~Vy~g~~~~p~~E~d~~  118 (290)
                      |++||.||+...    + ..+.+.+..+++|+.++-.+++++..        .+..+|.+||..-+-|   .|       
T Consensus        81 d~LVNNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~~~m~~~~~~~~g~IVnisS~~~~~g---~~-------  150 (247)
T PRK09730         81 AALVNNAGILFTQCTVENLTAERINRVLSTNVTGYFLCCREAVKRMALKNGGSGGAIVNVSSVASRLG---SP-------  150 (247)
T ss_pred             EEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEHHHCCC---CC-------
T ss_conf             59998986356899813399999999999973899999999999999962899976999812654658---98-------


Q ss_pred             CCCCCCHHHHHHHHHHHCCCCCC---CCC----CCCCCCEECCCCC-CCCEEECCCCCCCCEEECCCCCCCCCCHHHHHH
Q ss_conf             22111012456666531012223---223----5554200036863-200020112466521530455454452236899
Q gi|254780921|r  119 NPLNIYGKSKLAGEEKVASYTNN---YVI----LRTAWVYSIFGSN-FLLSMLRLAKERREISVVCDQFGTPTSALQIAR  190 (290)
Q Consensus       119 ~P~~~Yg~sK~~~E~~v~~~~~~---~~I----lR~~~vyG~~~~~-~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~  190 (290)
                      .....|+.+|.+.+.+.+..+..   +-|    +-|+++..+-... .-...++......++.    .+   ...+|+|+
T Consensus       151 ~~~~~Y~asKaav~~ltk~lA~ela~~gIrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~Pl~----R~---g~pedia~  223 (247)
T PRK09730        151 GEYVDYAASKGAIDTLTTGLSLEVAAQGIRVNCVRPGFIYTEMHASGGEPGRVDRVKSNIPMQ----RG---GQAEEVAQ  223 (247)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCC----CC---CCHHHHHH
T ss_conf             412777999999999999999997054928999977889785432349969999998579989----98---49999999


Q ss_pred             HHHHHHH
Q ss_conf             9999998
Q gi|254780921|r  191 AIIQIAH  197 (290)
Q Consensus       191 ~i~~~~~  197 (290)
                      ++..|+.
T Consensus       224 ~v~fL~S  230 (247)
T PRK09730        224 AIVWLLS  230 (247)
T ss_pred             HHHHHHC
T ss_conf             9999968


No 85 
>PRK06179 short chain dehydrogenase; Provisional
Probab=99.34  E-value=1.6e-12  Score=89.70  Aligned_cols=126  Identities=21%  Similarity=0.232  Sum_probs=93.4

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------CCCCCHHHHHHHHHHC-----CCCEEEECCCCCCC
Q ss_conf             999978897889999999-6498599961367-------------0878999999999755-----99899978634454
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------IDLLKPKDFASFFLSF-----SPDVIINPAAYTAV   63 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------~D~~~~~~~~~~l~~~-----~pd~Vih~Aa~~~~   63 (290)
                      +||||+++=||.++++.| .+|++|+.++|+.             +|++|.+++++++++.     +.|++||.||+...
T Consensus         7 alITGassGIG~a~A~~la~~G~~V~~~~r~~~~~~~~~~~~~~~~Dvtd~~~v~~~~~~~~~~~g~iDiLVNNAGi~~~   86 (270)
T PRK06179          7 ALVTGASSGIGRATAEALARAGYRVFGTSRNPARATPIPGVELLELDVTDDASVQAAVQEVIARAGRIDVLVNNAGVGLL   86 (270)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             99907246999999999998799999996897773054897899910799999999999999983998889989866678


Q ss_pred             CCC----CCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             322----33221024201222110001122----333-333445532111357554421111222211101245666653
Q gi|254780921|r   64 DKA----EDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEK  134 (290)
Q Consensus        64 ~~~----e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~  134 (290)
                      ...    ..+.+..+++|+.|+.++++++.    +.+ -++|.+||..-+   ...|.        .+.|+.||.+.+.+
T Consensus        87 ~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IvnisS~~g~---~~~p~--------~~~Y~aSK~al~~~  155 (270)
T PRK06179         87 GAAEETSIAQAQALFDTNVFGILRMTNAVLPHMRAQGSGRIINISSVLGF---LPAPY--------MALYAASKHAVEGY  155 (270)
T ss_pred             CCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHH---CCCCC--------CCHHHHHHHHHHHH
T ss_conf             87575989999999887448999999874202201799589998685662---77899--------70799999999999


Q ss_pred             HCCCC
Q ss_conf             10122
Q gi|254780921|r  135 VASYT  139 (290)
Q Consensus       135 v~~~~  139 (290)
                      .+...
T Consensus       156 t~sla  160 (270)
T PRK06179        156 SESLD  160 (270)
T ss_pred             HHHHH
T ss_conf             99999


No 86 
>PRK08263 short chain dehydrogenase; Provisional
Probab=99.34  E-value=1.9e-12  Score=89.24  Aligned_cols=127  Identities=19%  Similarity=0.187  Sum_probs=94.8

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEEECC
Q ss_conf             999978897889999999-6498599961367------------------0878999999999755-----998999786
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVIINPA   58 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vih~A   58 (290)
                      +||||+++=||.++++.| .+|++|+.++|+.                  +|++|.+++++++++.     ++|++||+|
T Consensus         6 ~lITGassGIG~a~A~~la~~G~~Vv~~~R~~~~l~~l~~~~~~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDiLVNNA   85 (275)
T PRK08263          6 WFITGASRGFGREWTEAALERGDRVVATARDTATLADLAERYGDALLPLALDVTDRAAVFAAVEQAVKHFGRLDIVVNNA   85 (275)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             99946743999999999998799899997989999999997599679999648999999999999999849987899888


Q ss_pred             CCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             3445432----233221024201222110001122----333-3334455321113575544211112222111012456
Q gi|254780921|r   59 AYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        59 a~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~  129 (290)
                      |+.....    .+.+.+..+++|+.|+.++++++.    +.+ -++|.+||-.-+   ...|.        .+.|+.||.
T Consensus        86 G~~~~~~~~e~~~~~~~~~~~vNl~g~~~~~~a~lp~m~~~~~G~IvnisS~ag~---~~~p~--------~~~Y~ASK~  154 (275)
T PRK08263         86 GYGLFGMIEEVTESEARAQIDTNVFGALWVTQAVLPYLRAQRSGHIIQISSIGGI---SAFPM--------VGIYHASKW  154 (275)
T ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCEEEEECCHHHC---CCCCC--------CCHHHHHHH
T ss_conf             6678887476999999999998619999987642613351699779994570105---67999--------707999999


Q ss_pred             HHHHHHCCCCC
Q ss_conf             66653101222
Q gi|254780921|r  130 AGEEKVASYTN  140 (290)
Q Consensus       130 ~~E~~v~~~~~  140 (290)
                      +.+.+.+....
T Consensus       155 Al~~lt~sLa~  165 (275)
T PRK08263        155 ALEGFSEALAQ  165 (275)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 87 
>PRK07326 short chain dehydrogenase; Provisional
Probab=99.34  E-value=3.4e-12  Score=87.89  Aligned_cols=175  Identities=16%  Similarity=0.093  Sum_probs=111.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------------CCCCCHHHHHHHHHHC-----CCCEEEE
Q ss_conf             4999978897889999999-6498599961367-------------------0878999999999755-----9989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------------IDLLKPKDFASFFLSF-----SPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------------~D~~~~~~~~~~l~~~-----~pd~Vih   56 (290)
                      .+|||||++=||.++++.| .+|++|+.++|++                   +|++|.+++++++++.     +.|++||
T Consensus         7 valITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~~Dv~d~~~v~~~v~~~~~~~G~iDiLVN   86 (235)
T PRK07326          7 AALVTGGSKGIGFAVAEALAAAGYRVAICARDESELEAAAQELGKRNVLGLACDVRDEADVRQAVDAHVEAFGGLDILVN   86 (235)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             99993826799999999999879999999898899999999842398699996389999999999999998299669998


Q ss_pred             CCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             86344543----2233221024201222110001122----333-33344553211135755442111122221110124
Q gi|254780921|r   57 PAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKS  127 (290)
Q Consensus        57 ~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~s  127 (290)
                      .||+....    ....+.+..+++|+.|+.++++++.    +.+ -++|.+||..-+   ...|        ....|+.|
T Consensus        87 NAGi~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IinisS~ag~---~~~~--------~~~~Y~as  155 (235)
T PRK07326         87 NAGVGHFAPVEELTLEEWRLVIDTNLTGAFYTIKAAVPALLKRGGGYIVNISSLAGK---NPFA--------GGAAYNAS  155 (235)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHH---CCCC--------CCHHHHHH
T ss_conf             887789988265999999999999879999999999999997199889998365550---7589--------98369999


Q ss_pred             HHHHHHHHCCCCCCC--CCCCCCCCE-ECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             566665310122232--235554200-036863200020112466521530455454452236899999999844
Q gi|254780921|r  128 KLAGEEKVASYTNNY--VILRTAWVY-SIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNL  199 (290)
Q Consensus       128 K~~~E~~v~~~~~~~--~IlR~~~vy-G~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~  199 (290)
                      |.+.+.+.+.....+  .=+|...|. |.-...|....    ....      +.  ....-+|+|+++..++.+.
T Consensus       156 K~al~~lt~~la~El~~~gIrVn~v~PG~v~T~~~~~~----~~~~------~~--~~l~PedVA~av~flls~P  218 (235)
T PRK07326        156 KFGLLGLSEALMLDLRDYDVRVSTIMPGSVATHFNGHP----PGED------DA--WKIQPEDVAQAVLDLLRMP  218 (235)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEEECCEECCCCCCC----CCCC------CC--CCCCHHHHHHHHHHHHCCC
T ss_conf             99999999999998474694999998058907888999----8622------11--3799999999999998498


No 88 
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.34  E-value=3.9e-12  Score=87.51  Aligned_cols=174  Identities=17%  Similarity=0.144  Sum_probs=112.7

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+||||+++=||.++++.| .+|.+|+.++|++                     +|++|.+++++++++.     ++|++
T Consensus         8 valITGas~GIG~aiA~~la~~Ga~V~l~~r~~~~l~~~~~~i~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDiL   87 (238)
T PRK07666          8 NALITGAGRGIGRAVAIALAKEGVNVGLLARSEENLKAVAKEVEAEGVKAVIATADVSDYEEVTTAIETLKNGLGSIDIL   87 (238)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89991637789999999999879989999899999999999999559927999930799999999999999981998789


Q ss_pred             EECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             9786344543----2233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||.||+....    ..+.+.+..+++|+.|+.++++++.    +.+ -++|.+||..-+   ...|.        ...|+
T Consensus        88 VNNAGi~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IInisS~ag~---~~~~~--------~~~Y~  156 (238)
T PRK07666         88 INNAGISKFGKFLELDVAEWEKIIQVNLMGVYYVTRAVLPSMIEQQSGDIINISSTAGQ---KGAPV--------TSAYS  156 (238)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHH---CCCCC--------CCHHH
T ss_conf             98474579998233999999999989629999999999999997499589998777770---67999--------80699


Q ss_pred             HHHHHHHHHHCCCCCC---CCCCCCCCCEECCCCCCCCE-EECCCC--CCCCEEECCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             2456666531012223---22355542000368632000-201124--66521530455454452236899999999844
Q gi|254780921|r  126 KSKLAGEEKVASYTNN---YVILRTAWVYSIFGSNFLLS-MLRLAK--ERREISVVCDQFGTPTSALQIARAIIQIAHNL  199 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~~---~~IlR~~~vyG~~~~~~v~~-~l~~~~--~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~  199 (290)
                      .||.+...+.+.....   +- +|...| .|   +++.+ |.+...  .+.     .+..   .--+|+|++++.+++..
T Consensus       157 aSK~av~glt~~la~El~~~g-IrVn~v-~P---G~v~T~m~~~~~~~~~~-----~~~~---~~PedVA~~vv~~l~~~  223 (238)
T PRK07666        157 ASKFAVLGLTESLMMEVRKHN-IRVTAL-TP---STVATDMAVDLGLTDGN-----PDKV---MQPEDLAEFIVAQLKLN  223 (238)
T ss_pred             HHHHHHHHHHHHHHHHHCCCC-EEEEEE-EE---CCCCCCCCCCCCCCCCC-----CCCC---CCHHHHHHHHHHHHCCC
T ss_conf             999999999999999854139-699999-85---88986246787778788-----3025---79999999999998399


No 89 
>PRK05875 short chain dehydrogenase; Provisional
Probab=99.33  E-value=2.1e-12  Score=89.02  Aligned_cols=128  Identities=17%  Similarity=0.145  Sum_probs=94.4

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------------CCCCCHHHHHHHHHH-----CCCC
Q ss_conf             999978897889999999-6498599961367------------------------087899999999975-----5998
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------------IDLLKPKDFASFFLS-----FSPD   52 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------------~D~~~~~~~~~~l~~-----~~pd   52 (290)
                      +|||||++=||.++++.| .+|.+|+.++|++                        +|++++++++++++.     -+.|
T Consensus        10 alVTGas~GIG~aiA~~la~~Ga~Vii~~r~~~~l~~~~~~l~~~~~~~~~v~~~~~Dvs~~~~v~~~v~~~~~~~g~iD   89 (277)
T PRK05875         10 YLVTGGGSGIGKGVAAALVAAGAAVMIVGRNPDKLAAAAEEIEALAGGAGAVRYEPADVTNEDEVARAVDAATAWHGRLH   89 (277)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCE
T ss_conf             99948874999999999998799899997988999999999996127886289995789999999999999999849953


Q ss_pred             EEEECCCCCCC-----CCCCCCCCEEEEECCCCCCCCCCCCC----C-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99978634454-----32233221024201222110001122----3-33333445532111357554421111222211
Q gi|254780921|r   53 VIINPAAYTAV-----DKAEDEPEIAFSINAEGAGAIAKAAD----S-IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN  122 (290)
Q Consensus        53 ~Vih~Aa~~~~-----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~-~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~  122 (290)
                      ++||+||....     +..+.+.+..+++|+.++-.+++.+.    + .+.++|.+||.....+     ..      ...
T Consensus        90 ~LVnnAg~~~~~~~~~~~~~e~w~~~~~iNl~g~~~~~~~~~~~m~~~~~GsIVnisS~~~~~~-----~~------~~~  158 (277)
T PRK05875         90 GVVHCAGGSETIGPITQIDSEAWRRTVDLNVNGTMYVLKHAARELVRGGGGSFVGISSIASSNT-----HR------WFG  158 (277)
T ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCC-----CC------CCH
T ss_conf             9998781367879725599999999999973889999999999998748972414753043367-----87------516


Q ss_pred             CCHHHHHHHHHHHCCCCCC
Q ss_conf             1012456666531012223
Q gi|254780921|r  123 IYGKSKLAGEEKVASYTNN  141 (290)
Q Consensus       123 ~Yg~sK~~~E~~v~~~~~~  141 (290)
                      .|+.+|.+.+.+.+..+..
T Consensus       159 ~Y~asKaal~~ltk~lA~E  177 (277)
T PRK05875        159 AYGVSKAAVDHLMKLAADE  177 (277)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             6799999999999999999


No 90 
>PRK08213 gluconate 5-dehydrogenase; Provisional
Probab=99.33  E-value=3.4e-12  Score=87.84  Aligned_cols=183  Identities=15%  Similarity=0.155  Sum_probs=112.0

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++=||.++++.| .+|.+|+.++|++                     +|++|++++++++++.     +.|++
T Consensus        14 valVTG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iDiL   93 (259)
T PRK08213         14 TALVTGGSRGLGLQIAEALGEAGARVVLSARKAEELEEAAAHLEALGIDALWLAADVADEADIERLAEETLERFGHIDIL   93 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89994877689999999999869999999798899999999999549958999826899999999999999983999899


Q ss_pred             EECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCCC-----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             978634454----322332210242012221100011223-----33-33344553211135755442111122221110
Q gi|254780921|r   55 INPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAADS-----IG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        55 ih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~~-----~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      ||.|+....    +..+.+.+..+++|+.++-.+++++..     .+ -++|.+||-+-+.|   .|..    .-+...|
T Consensus        94 VNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~~m~~~~~G~IVnisS~ag~~g---~~~~----~~~~~aY  166 (259)
T PRK08213         94 VNNAGATWGAPAEDHPVEAWDKVMNLNVRGTFLLSQAVAKRSMIPRGYGRIINVASIAGLGG---NPPG----SMDTIAY  166 (259)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEEEHHHCCC---CCCC----CCCHHHH
T ss_conf             98997788986456999999999988441199999999999998579945999935211667---8865----4134999


Q ss_pred             HHHHHHHHHHHCCCCCC---CCC----CCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             12456666531012223---223----55542000368632000201124665215304554544522368999999998
Q gi|254780921|r  125 GKSKLAGEEKVASYTNN---YVI----LRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAH  197 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~~---~~I----lR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~  197 (290)
                      +.+|.+...+.+..+..   +-|    +-|+++-.+-...+.....+......++.    .++   ..+|+|.++..|+.
T Consensus       167 ~asKaav~~ltr~lA~e~a~~gIrVNaIaPG~i~T~~~~~~~~~~~~~~~~~~Pl~----R~g---~peeia~~v~fLaS  239 (259)
T PRK08213        167 NTSKGAVINFTRALAAEWGPHGIRVNAIAPGFFPTKMTRGTLERLGEELLAHTPLG----RLG---DDEDLKGAALLLAS  239 (259)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCCC----CCC---CHHHHHHHHHHHHC
T ss_conf             99999999999999999610391999997798988552101499999998579999----991---99999999999968


Q ss_pred             H
Q ss_conf             4
Q gi|254780921|r  198 N  198 (290)
Q Consensus       198 ~  198 (290)
                      .
T Consensus       240 d  240 (259)
T PRK08213        240 D  240 (259)
T ss_pred             C
T ss_conf             2


No 91 
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase; InterPro: IPR011284   This entry represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis found in many plant and bacterial species. This enzyme is involved in type II fatty acid biosynthesis, where the individual metabolic transformations are carried out by different enzymes rather than by a single enzyme as occurs in type I fatty acid biosynthesis .   Structural studies show that the enzyme is a tetramer which forms a typical Rossman fold , . Unlike other members of the short-chain dehydrogenase/reductase superfamily, the enzyme undergoes a marked conformational change upon binding of the NADP(H)cofactor. This conformational change aligns the side chains of the catalytic triad at the active site in an active conformation and increases the affinity of the enzyme for its substrate.; GO: 0004316 3-oxoacyl-[acyl-carrier-protein] reductase activity, 0051287 NAD binding, 0006633 fatty acid biosynthetic process.
Probab=99.32  E-value=4.7e-12  Score=87.09  Aligned_cols=182  Identities=17%  Similarity=0.198  Sum_probs=117.8

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHH-----CCCCEE
Q ss_conf             999978897889999999-649859996136----------------------7087899999999975-----599899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLS-----FSPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~-----~~pd~V   54 (290)
                      .||||+|.=||+++++.| ++|.+|+..++.                      .+|++|.+++++++++     - .|++
T Consensus         1 AlVTGasRGIG~AIA~~LA~~Ga~V~i~y~~~e~~~~~~~~e~~~~G~~a~~~~~dvs~~~~~~~~~~~~~~~~G-iDiL   79 (238)
T TIGR01830         1 ALVTGASRGIGRAIALKLAKEGAKVIITYRTSEEGAEEVVEEIKELGVKAAGVVLDVSDREDVKALVEEAEEELG-IDIL   79 (238)
T ss_pred             CEECCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHHC-CEEE
T ss_conf             967167861679999999867995999659825788899999985697599996038888999999999999829-9089


Q ss_pred             EECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----C-CCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             97863445432----233221024201222110001122----3-33333445532-11135755442111122221110
Q gi|254780921|r   55 INPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----S-IGIPCIYISTD-YVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        55 ih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~-~~~~~I~iSS~-~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      ||-|++|+=..    .|.|++...++|..|+-++++++.    + +.-|+|.|||= .++++..+            ..|
T Consensus        80 VNNAGITrD~Ll~RMk~edWd~Vi~~NL~g~F~~t~~v~~~M~K~R~GrIINisSVVG~~GN~GQ------------aNY  147 (238)
T TIGR01830        80 VNNAGITRDNLLMRMKEEDWDAVINVNLKGVFNLTQAVLRPMIKQRSGRIINISSVVGLMGNAGQ------------ANY  147 (238)
T ss_pred             EECCCCCCCCHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHCCCCH------------HHH
T ss_conf             97874134301004885568999986126687888998898875067434861002000068742------------678


Q ss_pred             HHHHH----HHHHHHCCCCCCCCCCCCCCCEECCCCCCCCE-EEC--------CCCCCCCEEECCCCCCCCCCHHHHHHH
Q ss_conf             12456----66653101222322355542000368632000-201--------124665215304554544522368999
Q gi|254780921|r  125 GKSKL----AGEEKVASYTNNYVILRTAWVYSIFGSNFLLS-MLR--------LAKERREISVVCDQFGTPTSALQIARA  191 (290)
Q Consensus       125 g~sK~----~~E~~v~~~~~~~~IlR~~~vyG~~~~~~v~~-~l~--------~~~~~~~i~~~~d~~~~p~~v~D~a~~  191 (290)
                      +.||.    ...-+.++.+.+-+  |..-|    -|+|+.+ |.+        .+..+.|+.=|    +.   .+|+|.+
T Consensus       148 aASKAG~IGftKSlAkElasRnI--tVNaV----APGFI~TdMT~~L~e~~~~~~l~~IPLgR~----G~---pEeVA~~  214 (238)
T TIGR01830       148 AASKAGVIGFTKSLAKELASRNI--TVNAV----APGFIETDMTDKLSEKVKKAMLSQIPLGRF----GT---PEEVANA  214 (238)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCC--EEEEE----CCCCCCCCCCHHCCHHHHHHHHHCCCCCCC----CC---HHHHHHH
T ss_conf             88875589999999986036870--58887----489989700021698899999852772326----77---6569999


Q ss_pred             HHHHHHHHHHCCCCCCCCCEEE
Q ss_conf             9999984420244334431376
Q gi|254780921|r  192 IIQIAHNLIENSDTSLRGIFHM  213 (290)
Q Consensus       192 i~~~~~~~~~~~~~~~~Giyn~  213 (290)
                      +.-|+.-.   ..+--..++|+
T Consensus       215 v~FLASd~---AsYITGqv~~V  233 (238)
T TIGR01830       215 VAFLASDE---ASYITGQVIHV  233 (238)
T ss_pred             HHHHCCCC---CCCCCCCEEEC
T ss_conf             99732512---47425516630


No 92 
>PRK07774 short chain dehydrogenase; Provisional
Probab=99.32  E-value=3.3e-12  Score=87.95  Aligned_cols=176  Identities=14%  Similarity=0.139  Sum_probs=111.4

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH---------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-649859996136---------------------70878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP---------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~---------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++-||.++++.| .+|.+|+..+++                     ++|++|++++++++++.     +.|++
T Consensus         8 ~alVTGgs~GiG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~fG~iDil   87 (250)
T PRK07774          8 VAIVTGAAGGIGQAYAEALAREGASVVVADINAEGAERVAKQIVADGGTAIAVQVDVSDPDSAKAMADRTVSAFGGIDYL   87 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89997976889999999999869999999798899999999998559849999825899999999999999983999899


Q ss_pred             EECCCCCC---C----CCCCCCCCEEEEECCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             97863445---4----32233221024201222110001122----33-3333445532111357554421111222211
Q gi|254780921|r   55 INPAAYTA---V----DKAEDEPEIAFSINAEGAGAIAKAAD----SI-GIPCIYISTDYVFDGLSRTPIDEFSPTNPLN  122 (290)
Q Consensus        55 ih~Aa~~~---~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~-~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~  122 (290)
                      ||+|++..   .    +..+.+.+..+++|+.++-.+++++.    +. +-++|.+||...+      +        |..
T Consensus        88 VNnAg~~~~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IIn~sS~~~~------~--------~~~  153 (250)
T PRK07774         88 VNNAAIYGGMKLDLLITVPWDYYKKFMSVNLDGALVCTRAVYKHMAKRGGGAIVNQSSTAAW------L--------YSN  153 (250)
T ss_pred             EECCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC------C--------CCH
T ss_conf             98884357899974212999999999999889999999999999998299589997750045------7--------853


Q ss_pred             CCHHHHHHHHHHHCCCCCC---CC----CCCCCCCEECCCCCCC-CEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHH
Q ss_conf             1012456666531012223---22----3555420003686320-00201124665215304554544522368999999
Q gi|254780921|r  123 IYGKSKLAGEEKVASYTNN---YV----ILRTAWVYSIFGSNFL-LSMLRLAKERREISVVCDQFGTPTSALQIARAIIQ  194 (290)
Q Consensus       123 ~Yg~sK~~~E~~v~~~~~~---~~----IlR~~~vyG~~~~~~v-~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~  194 (290)
                      .|+.+|.+.+.+.+..+..   +-    .+-|+++-.+...... ..+.+.+....++.    .++   ..+|+|.++..
T Consensus       154 ~Y~asKaal~~ltk~lA~el~~~gIrVN~V~PG~i~t~~~~~~~~~~~~~~~~~~~Pl~----R~g---~pedia~~v~f  226 (250)
T PRK07774        154 FYGLAKVGINGLTQQLARELGGMNIRVNAIAPGPIDTEATRTVTPKEFVADMVKGIPLS----RMG---TPEDLVGMCLF  226 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCC----CCC---CHHHHHHHHHH
T ss_conf             89999999999999999997064948999973878772200149799999998579988----985---99999999999


Q ss_pred             HHHH
Q ss_conf             9984
Q gi|254780921|r  195 IAHN  198 (290)
Q Consensus       195 ~~~~  198 (290)
                      ++..
T Consensus       227 L~S~  230 (250)
T PRK07774        227 LLSD  230 (250)
T ss_pred             HHCC
T ss_conf             9482


No 93 
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated
Probab=99.32  E-value=2.1e-12  Score=89.00  Aligned_cols=128  Identities=17%  Similarity=0.205  Sum_probs=96.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------CCCCCHHHHHHHHHHC-----CCCEEEECCCCCC
Q ss_conf             4999978897889999999-6498599961367-------------0878999999999755-----9989997863445
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------IDLLKPKDFASFFLSF-----SPDVIINPAAYTA   62 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------~D~~~~~~~~~~l~~~-----~pd~Vih~Aa~~~   62 (290)
                      ++|||||++=||.++++.| .+|++|+.++|++             +|++|.+++++++++.     ++|++||+|++..
T Consensus        10 ~alITG~s~GIG~aia~~la~~Ga~V~~~~r~~~~l~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~iDilVnnAG~~~   89 (253)
T PRK08220         10 TVWVTGAAQGIGYAVALAFVEAGAKVIGFDQAFEQLNEQYPFATFVLDVADAAAVAQVCQRLLAETGPLDVLVNVAGVLR   89 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEECCCCCC
T ss_conf             89995885689999999999879999999788778748997799997379999999999999997399888998998789


Q ss_pred             CCC----CCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             432----233221024201222110001122----333-33344553211135755442111122221110124566665
Q gi|254780921|r   63 VDK----AEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEE  133 (290)
Q Consensus        63 ~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~  133 (290)
                      ...    .+.+.+..+++|+.++.++++.+.    +.+ .++|++||..-.     .|.      -....|+.+|.+.+.
T Consensus        90 ~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IV~isS~~~~-----~~~------~~~~~Y~asKaal~~  158 (253)
T PRK08220         90 MGATDSLSDEDWQQTFAVNAGGVFNLSRAVMPQFRRQRGGAIVTVGSNAAH-----TPR------IGMAAYGASKAALTS  158 (253)
T ss_pred             CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHH-----CCC------CCCHHHHHHHHHHHH
T ss_conf             998044999999999999746389999999987777389659999747871-----868------983889999999999


Q ss_pred             HHCCCCC
Q ss_conf             3101222
Q gi|254780921|r  134 KVASYTN  140 (290)
Q Consensus       134 ~v~~~~~  140 (290)
                      +.+..+.
T Consensus       159 lt~~lA~  165 (253)
T PRK08220        159 LTKCVGL  165 (253)
T ss_pred             HHHHHHH
T ss_conf             9999999


No 94 
>PRK06139 short chain dehydrogenase; Provisional
Probab=99.31  E-value=6.8e-12  Score=86.16  Aligned_cols=181  Identities=17%  Similarity=0.179  Sum_probs=112.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHH-----CCCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------087899999999975-----599899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLS-----FSPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~-----~~pd~V   54 (290)
                      .++|||+++=||.++++.| .+|.+|+.++|++                     +|++|.+++++++++     -++|++
T Consensus         8 vvlITGASsGIG~aiA~~~A~~Ga~Vvl~~R~~~~L~~~a~e~~~~G~~~~~v~~DVsd~~~v~~~~~~~~~~~G~IDiL   87 (324)
T PRK06139          8 VVVITGASSGIGRATAEAFARRGARLVLAARDEEALFEVAEECRALGAEVLVVPTDVTHADQVQALATQAASFLGRIDVW   87 (324)
T ss_pred             EEEEECHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             79993825499999999999879989999899999999999999549948999766788578999999999974998788


Q ss_pred             EECCCCCCCCCCC----CCCCEEEEECCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             9786344543223----322102420122211000112----2333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVDKAE----DEPEIAFSINAEGAGAIAKAA----DSIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~~~e----~~~~~~~~~Nv~~~~~l~~~~----~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||+|++......+    .+.+..+++|+.|+.++++++    ++.+ -.+|.+||..-+   ...|.        .+.|+
T Consensus        88 VNNAGi~~~g~~~e~~~e~~~~vi~vNl~G~~~~~~aalp~M~~~g~G~IINisS~ag~---~~~P~--------~saY~  156 (324)
T PRK06139         88 FNNVGVGAVGRFEETPLEAHEQVIQTNLIGYLRDAHAALPIFKAQGHGIFINMISLGGF---AAQPY--------AAAYS  156 (324)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHH---CCCCC--------CCHHH
T ss_conf             64575577775355999999999999869999999999999986599189997363241---36999--------84198


Q ss_pred             HHHHHHHHHHCCCC---CCCCCCCCCCCE-ECCCCCCCCEEECCCCCCCCEEECCCCCCCCCC-HHHHHHHHHHHHHHHH
Q ss_conf             24566665310122---232235554200-036863200020112466521530455454452-2368999999998442
Q gi|254780921|r  126 KSKLAGEEKVASYT---NNYVILRTAWVY-SIFGSNFLLSMLRLAKERREISVVCDQFGTPTS-ALQIARAIIQIAHNLI  200 (290)
Q Consensus       126 ~sK~~~E~~v~~~~---~~~~IlR~~~vy-G~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~-v~D~a~~i~~~~~~~~  200 (290)
                      .||.+.+-+.....   .++.=+|...|+ |.-+..+..+--+..  +.....     --|+| -+.+|++|+..+++..
T Consensus       157 ASK~Av~gftesLr~EL~~~~gI~Vt~V~Pg~v~TP~~~~~~~~~--~~~~~~-----~~p~~~pe~vA~ai~~~~~~~~  229 (324)
T PRK06139        157 ASKFGLRGFSEALRAELTDFPDIHVCDVYPAFVDTPGFRHGANYT--GRRLTP-----PPPMYDPRRVAKAMVRLADRPR  229 (324)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHCC--CCCCCC-----CCCCCCHHHHHHHHHHHHHCCC
T ss_conf             999999999999999837998918999857995885201435337--878899-----9998799999999999983899


No 95 
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed
Probab=99.31  E-value=5.5e-12  Score=86.70  Aligned_cols=179  Identities=15%  Similarity=0.161  Sum_probs=112.3

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH------------------HCCCCCHHHHHHHHHH-----CCCCEEEEC
Q ss_conf             4999978897889999999-649859996136------------------7087899999999975-----599899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP------------------DIDLLKPKDFASFFLS-----FSPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~------------------~~D~~~~~~~~~~l~~-----~~pd~Vih~   57 (290)
                      .+|||||++-||.++++.| .+|..|...+++                  ++|++|.++++.+++.     .++|++||+
T Consensus         8 ~alITG~s~GIG~aia~~~a~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~iDiLINn   87 (245)
T PRK12936          8 KALVTGASGGIGEEIARLLHAQGAIVGLHGTRVEKLEALAAELGERVKIFPANLSDRDEVKALGQKAEADLEGVDILVNN   87 (245)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             89992747689999999999869999998299999999999838966999913799999999999999975999699989


Q ss_pred             CCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----C-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             6344543----2233221024201222110001122----3-33333445532111357554421111222211101245
Q gi|254780921|r   58 AAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----S-IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        58 Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~-~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
                      |+.....    ..+.+.+..+.+|+.++-.+++.+.    + ..-++|.+||.+-+-|   .|        ....|+.+|
T Consensus        88 AG~~~~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~~~m~k~~~G~IInisS~a~~~~---~~--------~~~~Y~asK  156 (245)
T PRK12936         88 AGITKDGLFVRMSDEDWDAVLEVNLTAVFRLTRELTHPMMRRRYGRIINITSVVGVTG---NP--------GQANYCASK  156 (245)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CC--------CCHHHHHHH
T ss_conf             9889999812099999999999981999999999999998748855999734553568---99--------858999999


Q ss_pred             HHHHHHHCCCCCC---CCC----CCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             6666531012223---223----555420003686320002011246652153045545445223689999999984
Q gi|254780921|r  129 LAGEEKVASYTNN---YVI----LRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       129 ~~~E~~v~~~~~~---~~I----lR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      .+...+.+..+..   +-|    +-|+++-.+....+.....+......++    ..++   ..+|+|.++..++..
T Consensus       157 aai~~ltrslA~ela~~gIrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~Pl----~R~g---~p~dia~~v~fL~S~  226 (245)
T PRK12936        157 AGMIGFSKSLAQEIATRNVTVNCVAPGFIESAMTGKLNDKQKEAIMGAIPM----KRMG---TGAEVASAVAYLASD  226 (245)
T ss_pred             HHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCCCCHHHHHHHHHCCCC----CCCC---CHHHHHHHHHHHHCC
T ss_conf             999999999999970529299999757688631000399999999856998----8982---999999999999683


No 96 
>PRK07201 short chain dehydrogenase; Provisional
Probab=99.31  E-value=8.6e-12  Score=85.58  Aligned_cols=174  Identities=14%  Similarity=0.115  Sum_probs=109.7

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||+.=||.++++.| .+|.+|+.++|++                     +|++|.++++.++++.     +.|++
T Consensus       378 valITGASSGIG~A~A~~LA~~GA~Vvl~AR~~e~Le~v~~ei~~~Gg~a~~~~~DVtd~~~v~~lv~~i~~~~G~IDVL  457 (663)
T PRK07201        378 HVIITGASSGIGRATAIKVAEAGATVFALARDGEKLDELVAEIRARGGQAHAYTCDLTDSASVEHTVKDILGRHGHVDYL  457 (663)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             79993887599999999999879989999899999999999999559918999962799999999999999967998889


Q ss_pred             EECCCCCCCC---CC-C--CCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9786344543---22-3--3221024201222110001122----333-3334455321113575544211112222111
Q gi|254780921|r   55 INPAAYTAVD---KA-E--DEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        55 ih~Aa~~~~~---~~-e--~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      ||+||.+-..   .+ +  .+.+..+++|+.|+.+++++..    +.+ -.+|.+||..++   ...|        -.+.
T Consensus       458 VNNAG~si~~~~~~~~d~~~d~er~m~vN~~G~v~l~~a~lP~M~~r~~G~IVNISSiag~---~~~P--------~~sa  526 (663)
T PRK07201        458 VNNAGRSIRRSVVNSTDRFHDYERTMQLNYFGAVRLVLGLLPHMRERRFGHVVNISSIGVQ---TNAP--------RFSA  526 (663)
T ss_pred             EECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHC---CCCC--------CCHH
T ss_conf             9896446757501134549999999999749999999999998885399399997556547---7899--------8649


Q ss_pred             CHHHHHHHHHHHCCCCCCC--CCCCCCCCEECCCCCCCCE-EECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             0124566665310122232--2355542000368632000-2011246652153045545445223689999999984
Q gi|254780921|r  124 YGKSKLAGEEKVASYTNNY--VILRTAWVYSIFGSNFLLS-MLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~~~~--~IlR~~~vyG~~~~~~v~~-~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      |+.||.+.|.+.+......  .=+|...|+    +.++.+ |+.-.+.-+.+.        ...-+|+|+.|...+..
T Consensus       527 YsASKaAl~aftr~La~Ela~~GVrVttI~----PG~V~TpMiapt~~y~~~p--------~l~pe~aA~~i~~a~~~  592 (663)
T PRK07201        527 YVASKAALDAFARVAASETLSDGITFTNIH----MPLVRTPMIAPTKRYNPVP--------TLSPEEAADMVARALVE  592 (663)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEC----CCCCCCCCCCCCCCCCCCC--------CCCHHHHHHHHHHHHHC
T ss_conf             999999999999999998375782899971----5971788778752227899--------89999999999999851


No 97 
>PRK07707 consensus
Probab=99.31  E-value=3e-12  Score=88.15  Aligned_cols=179  Identities=15%  Similarity=0.116  Sum_probs=111.5

Q ss_pred             CE--EEEECCCCHHHHHHHHHH-HCCCEEEEEC-HH-------------------HCCCCCHHHHHHHHHHC--CCCEEE
Q ss_conf             94--999978897889999999-6498599961-36-------------------70878999999999755--998999
Q gi|254780921|r    1 MK--CLVIGNNGQIAQSLSSMC-VQDVEIIRVG-RP-------------------DIDLLKPKDFASFFLSF--SPDVII   55 (290)
Q Consensus         1 Mk--iLVtG~~G~iG~~l~~~l-~~~~~v~~~~-r~-------------------~~D~~~~~~~~~~l~~~--~pd~Vi   55 (290)
                      |+  +|||||++-||.++++.| .+|.+|+... ++                   +.|+++.+.+++++++.  ++|++|
T Consensus         1 M~KvalVTG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~v~~Dl~~~~~~~~~~~~~~~~iD~lV   80 (239)
T PRK07707          1 MKKYALVTGASGGIGQAISKQLAQDGYTVYLHYNNNEEKVNELQEELGEVIPVPVQADLASPDGAEKLWSQIEHPLDAIV   80 (239)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHCCCCCEEE
T ss_conf             99899996688789999999999879989998399989999999984436606999868999999999998578899999


Q ss_pred             ECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             78634454----32233221024201222110001122----333-3334455321113575544211112222111012
Q gi|254780921|r   56 NPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        56 h~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      |.|+....    +..+.+.+..+++|+.++..+++.+.    +.+ -++|.+||...+-|   .        .+...|+.
T Consensus        81 nnAG~~~~~~~~~~~~e~~~~~~~~nl~~~~~~~~~~~p~m~~~~~G~II~isS~~~~~g---~--------~~~~~Y~a  149 (239)
T PRK07707         81 YNSGKSIFGLVTDVTNDELNDMVQLHVKSPYKLLSMLLPSMIQRKSGNIVAVSSIWGQIG---A--------SCEVLYSM  149 (239)
T ss_pred             ECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---C--------CCCHHHHH
T ss_conf             899999998701099999999999998999999999989998769967999737887476---8--------75168899


Q ss_pred             HHHHHHHHHCCCCCC---CCC----CCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             456666531012223---223----55542000368632000201124665215304554544522368999999998
Q gi|254780921|r  127 SKLAGEEKVASYTNN---YVI----LRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAH  197 (290)
Q Consensus       127 sK~~~E~~v~~~~~~---~~I----lR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~  197 (290)
                      +|.+.+.+.+..+..   +-|    +-|+++-.+.-+.+.+...+.+.+..++.    .+   -..+|+|+++..++.
T Consensus       150 sKaav~~ltr~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~~~~~~~~~~~plg----R~---g~pediA~~v~FL~S  220 (239)
T PRK07707        150 VKGAQNSFVKALAKELAPSGIRVNAVAPGAIETEMLNVFSEEDKEEIAEEIPLG----RL---GLPEEVAKTVSFLLS  220 (239)
T ss_pred             HHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCHHHHHCCHHHHHHHHHCCCCC----CC---CCHHHHHHHHHHHHC
T ss_conf             999999999999999766396999997488987233313999999998569999----98---589999999999958


No 98 
>PRK07109 short chain dehydrogenase; Provisional
Probab=99.31  E-value=9.9e-12  Score=85.25  Aligned_cols=178  Identities=14%  Similarity=0.090  Sum_probs=112.6

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             999978897889999999-6498599961367---------------------0878999999999755-----998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      |+|||+++=||.++++.| .+|.+|+.++|++                     +|++|.++++++++..     ++|++|
T Consensus        11 VvITGASsGIGra~A~~fA~~Ga~Vvl~aR~~~~L~~~a~e~~~~G~~~~~~~~DVsd~~~v~~~~~~~~~~~G~IDvlV   90 (338)
T PRK07109         11 VVITGASAGVGRATARAFARRGAKVVLLARGEEGLEGLAAEIRAAGGEALAVVADVADAEAVQAAADRAEEELGPIDTWV   90 (338)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99948434999999999998799899998999999999999996398189998017999999999999999849988886


Q ss_pred             ECCCCCCCCCCC----CCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             786344543223----3221024201222110001122----333-3334455321113575544211112222111012
Q gi|254780921|r   56 NPAAYTAVDKAE----DEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        56 h~Aa~~~~~~~e----~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      |+|++......+    .+.+..+++|+.|+.++++++.    +.+ -.+|.+||..   |....|+        .+.|+.
T Consensus        91 NNAGi~~~g~~~~~~~e~~~~vi~vNl~G~v~~t~aaLp~m~~~~~G~IInvsSva---g~~~~P~--------~saY~A  159 (338)
T PRK07109         91 NNAMVTVFGPFEDVTPEEFRRVTDVTYLGVVHGTLAALRHMRPRDRGAIIQVGSAL---AYRSIPL--------QSAYCA  159 (338)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHH---HCCCCCC--------CCHHHH
T ss_conf             54666778763229999999998775189999999999999867997899988955---5457899--------817999


Q ss_pred             HHHHHHHHHCC----CCCCCCCCCCCCCE-ECCCCCCCCEEECCC-CCCCCEEECCCCCCCCCC-HHHHHHHHHHHHHHH
Q ss_conf             45666653101----22232235554200-036863200020112-466521530455454452-236899999999844
Q gi|254780921|r  127 SKLAGEEKVAS----YTNNYVILRTAWVY-SIFGSNFLLSMLRLA-KERREISVVCDQFGTPTS-ALQIARAIIQIAHNL  199 (290)
Q Consensus       127 sK~~~E~~v~~----~~~~~~IlR~~~vy-G~~~~~~v~~~l~~~-~~~~~i~~~~d~~~~p~~-v~D~a~~i~~~~~~~  199 (290)
                      ||.+..-+...    +.....=+|...|+ |.-+..|..|..+.+ .+.+++        -|+| -+.+|++|+.++++.
T Consensus       160 SK~Av~GftesLr~EL~~~~s~I~Vt~V~Pg~VdTP~f~~~~n~~~~~~~~~--------pp~~~pe~vA~ai~~~a~~p  231 (338)
T PRK07109        160 AKHAIRGFTDSLRCELLHDGSPVSVTMVQPPAVNTPQFDWARSYLPVEPQPV--------PPIYQPEVVADAILFAAEHP  231 (338)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHCCCCCCCCC--------CCCCCHHHHHHHHHHHHHCC
T ss_conf             9999999999999999867998189997579877974244452379888899--------99989899999999997489


No 99 
>PRK07479 consensus
Probab=99.31  E-value=4.6e-12  Score=87.13  Aligned_cols=129  Identities=16%  Similarity=0.181  Sum_probs=95.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++-||.++++.| .+|.+|+.++|++                     +|++|+++++++++..     ++|++
T Consensus         7 ~alITGgs~GIG~a~a~~la~~G~~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~iD~l   86 (252)
T PRK07479          7 VAIVTGAGSGFGEGIAKRFAREGAKVVVADLNAAAAERVASEIADAGGNAIAVAADVSRGADVEALVEAALEAFGRVDIV   86 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89993887689999999999879999999798999999999998539978999925899999999999999981998599


Q ss_pred             EECCCCCCCC-----CCCCCCCEEEEECCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9786344543-----223322102420122211000112----2333-33344553211135755442111122221110
Q gi|254780921|r   55 INPAAYTAVD-----KAEDEPEIAFSINAEGAGAIAKAA----DSIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        55 ih~Aa~~~~~-----~~e~~~~~~~~~Nv~~~~~l~~~~----~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      ||+|++....     ..+.+.+..+++|+.++.++++++    ++.+ -++|.+||..-+   ...|        -...|
T Consensus        87 VnnAG~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~Iv~isS~~~~---~~~~--------~~~~Y  155 (252)
T PRK07479         87 VNNAGTTHRNKPMLDVTEAEFDRVYAVNVKSIYLSTRHFVPHFRAQGGGVIINIASTAGV---RPRP--------GLTWY  155 (252)
T ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHC---CCCC--------CCCHH
T ss_conf             989976689988276999999999999863105654440498986799729998048766---8999--------97179


Q ss_pred             HHHHHHHHHHHCCCCCC
Q ss_conf             12456666531012223
Q gi|254780921|r  125 GKSKLAGEEKVASYTNN  141 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~~  141 (290)
                      +.+|.+.+.+.+..+..
T Consensus       156 ~asKaal~~ltr~lA~e  172 (252)
T PRK07479        156 NASKGAVITATKAMAAE  172 (252)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999


No 100
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated
Probab=99.31  E-value=3.4e-12  Score=87.86  Aligned_cols=128  Identities=19%  Similarity=0.188  Sum_probs=94.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH-------------------HCCCCCHHHHHHHHHHC-----CCCEEEE
Q ss_conf             4999978897889999999-649859996136-------------------70878999999999755-----9989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-------------------DIDLLKPKDFASFFLSF-----SPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-------------------~~D~~~~~~~~~~l~~~-----~pd~Vih   56 (290)
                      .+|||||++-||.++++.| .+|.+|++.++.                   ++|++|.+++++++++.     +.|++||
T Consensus        12 ~alITGas~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~v~~~~~~~~~~~G~iDilVn   91 (253)
T PRK08993         12 VAVVTGCDTGLGQGMALGLAEAGCDIVGINIVEPTETIEQVTALGRRFLSLTADLRKIDGIPALLERAVAEFGHIDILVN   91 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             89993887689999999999879999995587749999999965995799980379999999999999998499729998


Q ss_pred             CCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             8634454----322332210242012221100011223------333334455321113575544211112222111012
Q gi|254780921|r   57 PAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAADS------IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        57 ~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~~------~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      +|++...    +..+.+.+..+++|+.++..+++++..      .+.++|++||..-+.+...           ...|+.
T Consensus        92 nAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~~~~~~~~G~IvnisS~~~~~~~~~-----------~~~Y~a  160 (253)
T PRK08993         92 NAGLIRREDAIEFSEKDWDDVMNLNIKSVFFMSQAAAKHFIAQGNGGKIINIASMLSFQGGIR-----------VPSYTA  160 (253)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCC-----------CHHHHH
T ss_conf             997788998012999999999998854435667876899997277885238986100368898-----------656799


Q ss_pred             HHHHHHHHHCCCCC
Q ss_conf             45666653101222
Q gi|254780921|r  127 SKLAGEEKVASYTN  140 (290)
Q Consensus       127 sK~~~E~~v~~~~~  140 (290)
                      +|.+.+.+.+..+.
T Consensus       161 sKaal~~ltr~lA~  174 (253)
T PRK08993        161 SKSGVMGVTRLMAN  174 (253)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999


No 101
>PRK07856 short chain dehydrogenase; Provisional
Probab=99.31  E-value=3.1e-12  Score=88.10  Aligned_cols=127  Identities=20%  Similarity=0.230  Sum_probs=94.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------CCCCCHHHHHHHHHHC-----CCCEEEECCCCCCC
Q ss_conf             4999978897889999999-6498599961367------------0878999999999755-----99899978634454
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------IDLLKPKDFASFFLSF-----SPDVIINPAAYTAV   63 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------~D~~~~~~~~~~l~~~-----~pd~Vih~Aa~~~~   63 (290)
                      .+|||||++-||.++++.| .+|.+|+.++|.+            +|++|++++++++++.     ++|++||+|+....
T Consensus        10 ~alITGgs~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~iDilVnNAG~~~~   89 (254)
T PRK07856         10 VVLVTGGTRGVGAGISEAFLAAGATVVVCGRRAPEVDGRPAEFHACDIRDPDQVAALVDAIAERHGRLDVLVNNAGGSPY   89 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             89994767689999999999879999999798557489843999846999999999999999980998889988988999


Q ss_pred             ----CCCCCCCCEEEEECCCCCCCCCCCCC----CC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             ----32233221024201222110001122----33--333344553211135755442111122221110124566665
Q gi|254780921|r   64 ----DKAEDEPEIAFSINAEGAGAIAKAAD----SI--GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEE  133 (290)
Q Consensus        64 ----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~--~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~  133 (290)
                          +....+.+..+++|+.++-.+++.+.    +.  +-++|.+||....   ...|        ....|+.+|.+.+.
T Consensus        90 ~~~~~~~~~~~~~~~~vNl~~~~~l~q~~~~~m~~~~~~G~IVnisS~~~~---~~~~--------~~~~Y~asKaal~~  158 (254)
T PRK07856         90 ALAAEASPRFHEKIVELNLLAPLLVAQAANAVMQQQPGGGSIVNIGSVSGR---RPSP--------GTAAYGAAKAGLLN  158 (254)
T ss_pred             CCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHC---CCCC--------CCHHHHHHHHHHHH
T ss_conf             881349999999999998289999999999999972799789994542432---7889--------72879999999999


Q ss_pred             HHCCCC
Q ss_conf             310122
Q gi|254780921|r  134 KVASYT  139 (290)
Q Consensus       134 ~v~~~~  139 (290)
                      +.+..+
T Consensus       159 ltk~lA  164 (254)
T PRK07856        159 LTTSLA  164 (254)
T ss_pred             HHHHHH
T ss_conf             999999


No 102
>PRK07776 consensus
Probab=99.30  E-value=4.6e-12  Score=87.12  Aligned_cols=178  Identities=15%  Similarity=0.143  Sum_probs=112.3

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------------CCCCCHHHHHHHHHHC-----CCCEEEE
Q ss_conf             4999978897889999999-6498599961367-------------------0878999999999755-----9989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------------IDLLKPKDFASFFLSF-----SPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------------~D~~~~~~~~~~l~~~-----~pd~Vih   56 (290)
                      .+|||||++-||.++++.| .+|.+|+..+|++                   .|++|++.+++++++.     ++|++||
T Consensus        10 v~lITG~~~GIG~aiA~~la~~Ga~V~i~~~~~~~l~~~~~~l~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iDilVn   89 (252)
T PRK07776         10 TAIVTGASRGIGLAIAQALAAAGANVVITARKQEALDEAAAQLGAERALGVAGHAVDEEHAREAVDLTLERFGSVDILVN   89 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             89994778799999999999879989999798899999999847995799997428999999999999998499869998


Q ss_pred             CCCCCCC-----CCCCCCCCEEEEECCCCCCCCCCCCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             8634454-----322332210242012221100011223-----333334455321113575544211112222111012
Q gi|254780921|r   57 PAAYTAV-----DKAEDEPEIAFSINAEGAGAIAKAADS-----IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        57 ~Aa~~~~-----~~~e~~~~~~~~~Nv~~~~~l~~~~~~-----~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      .|+...+     +..+.+.+..+++|+.++-.+.+.+..     .+-++|.+||...+-+   .|        -...|+.
T Consensus        90 NAg~~~~~~~~~e~~~e~w~~~~~~Nl~~~~~~~~~~~~~m~~~~~G~IInisS~~~~~~---~~--------~~~~Y~a  158 (252)
T PRK07776         90 NAGTNPAYGPLIDQDLARFRKIFEVNVWAALGWTQLAWKAWMGEHGGAVVNVASIGGLHP---SP--------GIGAYGA  158 (252)
T ss_pred             CCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCC---CC--------CCHHHHH
T ss_conf             786688899813499999999999980789999999999986627964998077441157---99--------8479999


Q ss_pred             HHHHHHHHHCCCCCCCC-CCCCCCCEECC--CCCCCCEEEC----CCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             45666653101222322-35554200036--8632000201----1246652153045545445223689999999984
Q gi|254780921|r  127 SKLAGEEKVASYTNNYV-ILRTAWVYSIF--GSNFLLSMLR----LAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       127 sK~~~E~~v~~~~~~~~-IlR~~~vyG~~--~~~~v~~~l~----~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      +|.+.+.+.+..+..+- =+|...| .|+  ...+...++.    ......++    ..++   ..+|+|.++..++..
T Consensus       159 sKaav~~ltk~lA~e~a~~IrVN~V-~PG~i~T~~~~~~~~~~~~~~~~~iPl----~R~g---~p~dia~~v~fL~S~  229 (252)
T PRK07776        159 SKAALIHLTKQLALELAPRVRVNAV-APGVVRTKFAEALWEGREDEVAASYPL----GRLG---EPEDIASAVAFLVSD  229 (252)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEE-EECCCCCCCHHHHHHHHHHHHHHCCCC----CCCC---CHHHHHHHHHHHHCC
T ss_conf             9999999999999998699889999-645798854112205589999857999----9980---999999999999587


No 103
>PRK05717 oxidoreductase; Validated
Probab=99.30  E-value=7.4e-12  Score=85.98  Aligned_cols=126  Identities=13%  Similarity=0.110  Sum_probs=93.8

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHH-----CCCCEEEECC
Q ss_conf             999978897889999999-6498599961367------------------087899999999975-----5998999786
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLS-----FSPDVIINPA   58 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~-----~~pd~Vih~A   58 (290)
                      +|||||+|=||.++++.| .+|.+|+..+|++                  +|++|++++++++++     -+.|++||.|
T Consensus        13 alITG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~i~~~~~~~G~id~lvnNA   92 (255)
T PRK05717         13 ALVTGAARGIGLGIAAWLIAEGWQVVLADLDRERGAKVAKALGENAWFIAMDVADEAQVAAGVAEVLGQFGRLDALVCNA   92 (255)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             99958788899999999998799899996988999999998489758999307999999999999999829998999877


Q ss_pred             CCCCCC------CCCCCCCEEEEECCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             344543------22332210242012221100011223----33333445532111357554421111222211101245
Q gi|254780921|r   59 AYTAVD------KAEDEPEIAFSINAEGAGAIAKAADS----IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        59 a~~~~~------~~e~~~~~~~~~Nv~~~~~l~~~~~~----~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
                      |+..+.      ..+.+.+..+++|+.++..+++++..    .+-.+|.+||.....+   .|        ....|+.+|
T Consensus        93 g~~~~~~~~l~~~~~~~w~~~~~vNl~g~f~~~k~~~~~m~~~~G~IInisS~~~~~~---~~--------~~~~Y~asK  161 (255)
T PRK05717         93 AIANPHNTTLESLSLAQWNRVLAVNLGGPMLLAKHCAPYLRAHNGAIVNLASTRARQS---EP--------DTEAYAASK  161 (255)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHCHHHHHHCCCCEEEEEECCCCCC---CC--------CCHHHHHHH
T ss_conf             3057899983559999999999986042657766431988747998699976014547---89--------837679999


Q ss_pred             HHHHHHHCCCC
Q ss_conf             66665310122
Q gi|254780921|r  129 LAGEEKVASYT  139 (290)
Q Consensus       129 ~~~E~~v~~~~  139 (290)
                      .+.+.+.+..+
T Consensus       162 aal~~ltkslA  172 (255)
T PRK05717        162 GGLLALTHALA  172 (255)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 104
>pfam08659 KR KR domain. This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
Probab=99.30  E-value=2.3e-12  Score=88.81  Aligned_cols=129  Identities=13%  Similarity=0.132  Sum_probs=95.0

Q ss_pred             EEEEECCCCHHHHHHHHHHH-CCCE-EEEECHH------------------------HCCCCCHHHHHHHHHHC-----C
Q ss_conf             49999788978899999996-4985-9996136------------------------70878999999999755-----9
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCV-QDVE-IIRVGRP------------------------DIDLLKPKDFASFFLSF-----S   50 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~-~~~~-v~~~~r~------------------------~~D~~~~~~~~~~l~~~-----~   50 (290)
                      -+|||||++-||.++++.|. +|.. ++.++|+                        .+|++|++++++++++.     +
T Consensus         2 tvlITGas~GIG~aia~~la~~Ga~~vvl~~r~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~   81 (181)
T pfam08659         2 TYLVTGGLGGLGLELARWLAERGARHLVLLSRSGAPDPEAEALLAELEARGAEVTVVACDVSDRDAVAALLAEIRADGPP   81 (181)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             89996878789999999999879978999868976629999999999965996999975689999999888657987398


Q ss_pred             CCEEEECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             989997863445432----2332210242012221100011223333-33445532111357554421111222211101
Q gi|254780921|r   51 PDVIINPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        51 pd~Vih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      .|.+||+|+......    ...+.+..+++|+.++.+|.+++..... ++|++||-.-+-|   .|        ....|+
T Consensus        82 id~lvnnAG~~~~~~~~~~~~~~~~~~~~vnv~g~~~l~~~~~~~~~~~IV~iSS~ag~~g---~~--------~~~~Y~  150 (181)
T pfam08659        82 LRGVIHAAGVLRDALLANMTAEDFARVLAPKVTGAWNLHEATRDRPLDFFVLFSSIAGVLG---SP--------GQANYA  150 (181)
T ss_pred             EEEEEEECCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEECCHHHCCC---CC--------CCHHHH
T ss_conf             4899954466788568882899999999999899999999965103440002300766478---99--------948999


Q ss_pred             HHHHHHHHHHCCCCCC
Q ss_conf             2456666531012223
Q gi|254780921|r  126 KSKLAGEEKVASYTNN  141 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~~  141 (290)
                      .+|...+-+.++....
T Consensus       151 AsKa~l~~la~~l~~~  166 (181)
T pfam08659       151 AANAFLDALAHYRRAQ  166 (181)
T ss_pred             HHHHHHHHHHHHHHHC
T ss_conf             9999999999999865


No 105
>PRK08251 short chain dehydrogenase; Provisional
Probab=99.29  E-value=1.2e-11  Score=84.76  Aligned_cols=128  Identities=16%  Similarity=0.114  Sum_probs=88.7

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-----------------------CCCCCHHHHHHHHHH-----CCCC
Q ss_conf             4999978897889999999-6498599961367-----------------------087899999999975-----5998
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-----------------------IDLLKPKDFASFFLS-----FSPD   52 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-----------------------~D~~~~~~~~~~l~~-----~~pd   52 (290)
                      +||||||++=||.++++.| .+|++++.++|++                       +|++|.+++++++++     .++|
T Consensus         4 ~vlITGAssGIG~alA~~la~~G~~v~l~~r~~~~l~~~~~el~~~~~~~~v~~~~~Dvsd~~~v~~~~~~~~~~~g~iD   83 (248)
T PRK08251          4 KILITGASSGLGAGMAREFAAKGRDLALCARRTDRLEELKAELLARYPGIKVAVAALDVNDHDQVFEVFAEFSDELGGLD   83 (248)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             89994786399999999999879989999898889999999998737997399997867868999999999999809998


Q ss_pred             EEEECCCCCCCCCC-C---CCCCEEEEECCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99978634454322-3---322102420122211000112----2333-3334455321113575544211112222111
Q gi|254780921|r   53 VIINPAAYTAVDKA-E---DEPEIAFSINAEGAGAIAKAA----DSIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        53 ~Vih~Aa~~~~~~~-e---~~~~~~~~~Nv~~~~~l~~~~----~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      ++||+||+...... +   .+.+..+++|+.++..+++.+    ++.+ -++|.+||-.-+   ...|       ...+.
T Consensus        84 ~lvnNAGi~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~l~~m~~~~~G~Iv~isS~ag~---~~~p-------~~~~~  153 (248)
T PRK08251         84 RVIVNAGIGKGARLGTGKFWANKATAETNFVAALAQCEAAMEIFREQGSGHLVLISSVSAV---RGLP-------GAKTA  153 (248)
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECHHHC---CCCC-------CCCHH
T ss_conf             9998576578866555999999999999829999999999876554058729999574442---6789-------97478


Q ss_pred             CHHHHHHHHHHHCCCC
Q ss_conf             0124566665310122
Q gi|254780921|r  124 YGKSKLAGEEKVASYT  139 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~  139 (290)
                      |+.||.+...+.+...
T Consensus       154 Y~aSKaal~~~~~~L~  169 (248)
T PRK08251        154 YAASKAGLASLGEGLR  169 (248)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999


No 106
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional
Probab=99.29  E-value=7e-12  Score=86.10  Aligned_cols=128  Identities=15%  Similarity=0.091  Sum_probs=95.1

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++=||.++++.| .+|++|+.++|++                     +|+++.+++++++++.     ++|++
T Consensus         6 ~alITGas~GIG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~g~~~~~~~~D~~~~~~v~~~~~~~~~~~g~iDiL   85 (258)
T PRK12429          6 TALVTGAASGIGLEIALALAKEGAKVVIADLNDEAAAKAAEAIKKAGGKAIGVAMDVTDEEAINAGIDKVVETFGGVDIL   85 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89994887589999999999879999999798899999999998449918999835899999999999999982997099


Q ss_pred             EECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             97863445432----233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||+|++.....    .+.+.+..+++|+.++.++++.+.    +.+ -++|++||..-+   ...|        ....|+
T Consensus        86 VnnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~~G~Iv~isS~~~~---~~~~--------~~~~Y~  154 (258)
T PRK12429         86 VNNAGIQHVAPIEDFPTEKWKKMIAIMLDGAFLTTKAALPHMKAQKWGRIINMASVHGL---VGSA--------GKAAYV  154 (258)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHEEEHHHHHHHHHHCCCCEEEEECCHHHC---CCCC--------CCHHHH
T ss_conf             98998889988155999999999997623212200677776643599289998775546---6899--------975899


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+.+.+.+..+.
T Consensus       155 asKaal~~lt~~lA~  169 (258)
T PRK12429        155 SAKHGLIGLTKVVAL  169 (258)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 107
>PRK06701 short chain dehydrogenase; Provisional
Probab=99.29  E-value=7.6e-12  Score=85.90  Aligned_cols=128  Identities=19%  Similarity=0.127  Sum_probs=95.7

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             4999978897889999999-649859996136----------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      .+|||||++=||.++++.| .+|.+|..++++                      .+|++|.+++++++++.     ++|+
T Consensus        47 valVTGgs~GIG~aiA~~la~~GA~V~i~~~~~~~~a~~~~~~~~~~G~~~~~~~~Dv~d~~~v~~~v~~~~~~fG~iDi  126 (289)
T PRK06701         47 VALITGGDSGIGRAVAVAFAKEGADIAIVYLDEHEDANETKQRVEKEGVKCLLIPGDVSDEQFCKDAVEETVRELGRLDI  126 (289)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89996825799999999999879989998289467899999999963990899984789999999999999998599989


Q ss_pred             EEECCCCCCC-----CCCCCCCCEEEEECCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             9978634454-----32233221024201222110001122---333333445532111357554421111222211101
Q gi|254780921|r   54 IINPAAYTAV-----DKAEDEPEIAFSINAEGAGAIAKAAD---SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        54 Vih~Aa~~~~-----~~~e~~~~~~~~~Nv~~~~~l~~~~~---~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      +||.|+++..     +..+.+.+..+++|+.++..+++++.   +.+..+|++||..-+.|..           ....|+
T Consensus       127 LVNNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~f~~~~~~~p~m~~gg~IInisS~~~~~g~~-----------~~~~Y~  195 (289)
T PRK06701        127 LVNNAAQQYPQQSLEDITAEQLDKTFRTNIYSYFHMTKAALPHLKPGSAIINTGSITGYEGNE-----------TLIDYS  195 (289)
T ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCEECCCCC-----------CHHHHH
T ss_conf             998883467888724499999999974521789999999999973497799950121525788-----------407789


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+.+.+.+..+.
T Consensus       196 asKaav~~ltk~LA~  210 (289)
T PRK06701        196 ATKGAIHAFTRSLSQ  210 (289)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 108
>PRK06124 gluconate 5-dehydrogenase; Provisional
Probab=99.29  E-value=7.4e-12  Score=85.96  Aligned_cols=128  Identities=14%  Similarity=0.150  Sum_probs=95.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++-||.++++.| .+|.+|+.++|+.                     +|++|.+++++++++.     +.|++
T Consensus        16 ~alITGgs~GIG~~ia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~iDiL   95 (259)
T PRK06124         16 VALVTGSARGLGLEIARALAEAGAHVLVNGRNAARVEAAVAALRAAGGAAEALVFDISDEEAVAAAFARIDAEHGRLDIL   95 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             89992867489999999999879999999698899999999999659958999951799999999999999975999799


Q ss_pred             EECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             978634454----3223322102420122211000112----2333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAA----DSIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~----~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||.|+....    +..+.+.+..+++|+.++-.+++.+    ++.+ -++|++||..   +....|        -...|+
T Consensus        96 VnnAG~~~~~~~~~~~~e~~~~~~~~Nl~g~~~~~q~~~~~M~~~~~G~IInisS~~---~~~~~~--------~~~~Y~  164 (259)
T PRK06124         96 VNNVGARNRRPLAELDDAEIRALLETDLVAPILLSRLAAQRMVRQGYGRIIAITSIA---GEVARA--------GDAVYP  164 (259)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCC---CCCCCC--------CCHHHH
T ss_conf             989888999990669999999999998499999999999998776993699972330---046799--------837899


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+.+.+.+..+.
T Consensus       165 asKaal~~ltr~lA~  179 (259)
T PRK06124        165 AAKQGLTGLMRALAA  179 (259)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 109
>PRK09242 tropinone reductase; Provisional
Probab=99.28  E-value=7.4e-12  Score=85.96  Aligned_cols=128  Identities=17%  Similarity=0.147  Sum_probs=94.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-----------------------CCCCCHHHHHHHHHHC-----CCC
Q ss_conf             4999978897889999999-6498599961367-----------------------0878999999999755-----998
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-----------------------IDLLKPKDFASFFLSF-----SPD   52 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-----------------------~D~~~~~~~~~~l~~~-----~pd   52 (290)
                      ++|||||++=||.++++.| .+|.+|+.++|++                       +|++|+++++++++..     +.|
T Consensus        12 ~alITGgs~GIG~a~a~~la~~Ga~V~~~~r~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iD   91 (258)
T PRK09242         12 TALITGASKGIGLAIARELLGLGADVLIVARDADALAQARDELAEEFPERELHGLAADVSDDEDRRAILDWVEDHWDGLH   91 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEEEECCCHHHHHHHHHHHHHHCCCCC
T ss_conf             99994848689999999999879989999698899999999998644797299999307999999999999999749997


Q ss_pred             EEEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99978634454----32233221024201222110001122----33-33334455321113575544211112222111
Q gi|254780921|r   53 VIINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SI-GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        53 ~Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~-~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      ++||.|+....    +..+.+.+..+++|+.++..+++++.    +. +-++|.+||..-+   ...+        ....
T Consensus        92 iLVnnAG~~~~~~~~~~s~~~w~~~~~vNl~~~~~l~~~~~p~m~~~~~G~IInisS~~~~---~~~~--------~~~~  160 (258)
T PRK09242         92 ILVNNAGGNITKAAIDYTEDEWRGIFETNLFSAFELSRYAYPLLKRHAASSIVNIGSVSGL---THVR--------SGAP  160 (258)
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHC---CCCC--------CCHH
T ss_conf             9998998899998001999999999999819999999999999997599279999304211---6898--------7556


Q ss_pred             CHHHHHHHHHHHCCCCC
Q ss_conf             01245666653101222
Q gi|254780921|r  124 YGKSKLAGEEKVASYTN  140 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~~  140 (290)
                      |+.+|.+.+.+.+..+.
T Consensus       161 Y~asKaal~~ltr~lA~  177 (258)
T PRK09242        161 YGMTKAALQQMTRNLAV  177 (258)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             79999999999999999


No 110
>PRK07890 short chain dehydrogenase; Provisional
Probab=99.28  E-value=6.1e-12  Score=86.42  Aligned_cols=128  Identities=16%  Similarity=0.153  Sum_probs=93.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      ++|||||++-||+++++.| .+|.+|+..+|++                     +|++|.+++++++++.     +.|++
T Consensus         7 ~alVTG~s~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~fG~iDiL   86 (258)
T PRK07890          7 VVVVSGVGPGLGTTLAVRAAREGADVVLAARTAERLDEVAKQIDDLGRRALAVVTDITDEAQVANLVDAALERFGRVDVL   86 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89996856589999999999879989999798999999999999649958999816999999999999999984999899


Q ss_pred             EECCCCCCC-C----CCCCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             978634454-3----2233221024201222110001122----333333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAV-D----KAEDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~-~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||.|+.... .    ..+.+.+..+++|+.++-++++++.    +.+-++|++||...+.+   .|        ....|+
T Consensus        87 VnnAg~~~~~~~~~~~~~e~~~~~~~~nl~~~~~~~k~~~p~m~~~~G~IVnisS~~~~~~---~~--------~~~~Y~  155 (258)
T PRK07890         87 VNNAFRVPSMKPLAGADFDHWRDVIETNVLGTLRLTQAFTPALAESGGSVVMINSMVLRHS---QP--------KYGAYK  155 (258)
T ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCCC---CC--------CCHHHH
T ss_conf             9868667899980029999999999987599999999889999976985999825654888---99--------977899


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+.+.+.+..+.
T Consensus       156 ~sKaal~~ltk~lA~  170 (258)
T PRK07890        156 MAKGALLAASQSLAT  170 (258)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 111
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional
Probab=99.28  E-value=5e-12  Score=86.94  Aligned_cols=128  Identities=17%  Similarity=0.177  Sum_probs=95.1

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------CCCCCHHHHHHHHHHC-----CCCEEEECCCCCCC
Q ss_conf             4999978897889999999-6498599961367------------0878999999999755-----99899978634454
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------IDLLKPKDFASFFLSF-----SPDVIINPAAYTAV   63 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------~D~~~~~~~~~~l~~~-----~pd~Vih~Aa~~~~   63 (290)
                      .+|||||++=||.++++.| .+|.+|+.+++++            +|++|++++++++++.     +.|++||.|+++.+
T Consensus        11 valVTGgs~GIG~aia~~la~~Ga~V~~~d~~~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiLVNNAGi~~~   90 (266)
T PRK06171         11 IIIVTGGSSGIGLAIVEELLAQGANVQMVDIHGGDEKHKGYQFWPTDISSAKEVNHTVAEIIERFGRIDGLVNNAGINFP   90 (266)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             79994778789999999999879999999788535058976999816999999999999999983998899988866765


Q ss_pred             -------------CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             -------------32233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   64 -------------DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        64 -------------~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                                   +..+.+.+..+++|+.++-.+++++.    +.+ -++|.+||..-+-|   .|        ....|+
T Consensus        91 ~~~~d~~~~~~~~e~~~~~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~g~~g---~~--------~~~~Y~  159 (266)
T PRK06171         91 RLLVDEKAPAGQYELNEAAFEKMVNINQKGVFLMSQAVARQMVKQHDGVIVNMSSEAGLEG---SE--------GQSCYA  159 (266)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CC--------CCHHHH
T ss_conf             3212445766545599999999999994999999999999999839957998057775678---98--------758999


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .||.+...+.+..+.
T Consensus       160 asKaav~~ltr~lA~  174 (266)
T PRK06171        160 ATKAAVNSFTRSWAK  174 (266)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 112
>PRK07060 short chain dehydrogenase; Provisional
Probab=99.28  E-value=5.4e-12  Score=86.73  Aligned_cols=129  Identities=18%  Similarity=0.218  Sum_probs=98.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------CCCCCHHHHHHHHHHC-CCCEEEECCCCCCC
Q ss_conf             4999978897889999999-6498599961367----------------0878999999999755-99899978634454
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------IDLLKPKDFASFFLSF-SPDVIINPAAYTAV   63 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------~D~~~~~~~~~~l~~~-~pd~Vih~Aa~~~~   63 (290)
                      ++||||+++=||.++++.| .+|.+|+.++|++                +|+++.+.++++++++ +.|++||+|+.+..
T Consensus        11 ~~lVTG~~~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~g~iDilVnnAG~~~~   90 (245)
T PRK07060         11 SVLVTGASSGIGRACAVALAARGARVVAAARNQADLDRLAGETGCEPLRLDVGDDAAIRAALAGAGAFDGLVNCAGIASL   90 (245)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCEEEEEECCCHHHHHHHHHHCCCCCEEEECCCCCCC
T ss_conf             89994777689999999999879999999799899999998639879998079999999999965999899989887999


Q ss_pred             ----CCCCCCCCEEEEECCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             ----322332210242012221100011223------3333344553211135755442111122221110124566665
Q gi|254780921|r   64 ----DKAEDEPEIAFSINAEGAGAIAKAADS------IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEE  133 (290)
Q Consensus        64 ----~~~e~~~~~~~~~Nv~~~~~l~~~~~~------~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~  133 (290)
                          +..+.+.+..+++|+.++-.+++++..      .+..+|++||..-+-|   .|        -...|+.+|.+.+.
T Consensus        91 ~~~~~~~~e~~~~~~~vNl~~~~~~~k~~~~~m~~~~~~G~IInisS~~~~~~---~~--------~~~~Y~asKaav~~  159 (245)
T PRK07060         91 ESAIDMTAAGFDRVMAVNARGALLVARHVARAMIRAGRGGSIVNVSSQAALVG---LP--------DHLAYCASKAALDA  159 (245)
T ss_pred             CCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCC---CC--------CCHHHHHHHHHHHH
T ss_conf             99013999999999999709999999999999998089807999866432578---99--------74789999999999


Q ss_pred             HHCCCCCC
Q ss_conf             31012223
Q gi|254780921|r  134 KVASYTNN  141 (290)
Q Consensus       134 ~v~~~~~~  141 (290)
                      +.+..+..
T Consensus       160 ltkslA~e  167 (245)
T PRK07060        160 ATRVLCVE  167 (245)
T ss_pred             HHHHHHHH
T ss_conf             99999999


No 113
>PRK09291 short chain dehydrogenase; Provisional
Probab=99.27  E-value=9.6e-12  Score=85.33  Aligned_cols=127  Identities=19%  Similarity=0.193  Sum_probs=91.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHCCCCEEEECCC
Q ss_conf             4999978897889999999-6498599961367---------------------08789999999997559989997863
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSFSPDVIINPAA   59 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~~pd~Vih~Aa   59 (290)
                      ++||||+++=||++++..| .+|++|+.+.|.+                     +|+++........ ...+|++||+||
T Consensus         4 ~vLITGAssGIGraiA~~la~~G~~Vi~~~r~~~~l~~l~~~~~~~g~~~~~~~lDv~~~~~~~~~~-~~~iDvLVNNAG   82 (257)
T PRK09291          4 TILITGAGSGFGREVALRLARKGHRVIAGVQIAPQVTELRAEAARRGLALRVEKLDLTDAIDRARAA-EWDVDVLLNNAG   82 (257)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHC-CCCCCEEEECCC
T ss_conf             8999689858999999999987998999968789999999999852995599989889999999980-899999998985


Q ss_pred             CCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             445432----233221024201222110001122----333-33344553211135755442111122221110124566
Q gi|254780921|r   60 YTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLA  130 (290)
Q Consensus        60 ~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~  130 (290)
                      +.....    ...+.+..+++|+.|+..++++..    +.+ -++|++||..   |....|.        .+.|+.||.+
T Consensus        83 i~~~g~i~e~~~~~~~~~~~vNv~g~~~ltq~~lp~M~~~~~G~IV~isS~a---g~~~~p~--------~~~Y~aSK~A  151 (257)
T PRK09291         83 IGEAGALVDIPVELVRELFETNVFGPLELTQGVVRKMVARGKGKIVFVSSIA---GLITGPF--------TGAYCASKHA  151 (257)
T ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHH---HCCCCCC--------CCHHHHHHHH
T ss_conf             6899773449999999999999799999999978999876996899987877---6689999--------8419999999


Q ss_pred             HHHHHCCCCC
Q ss_conf             6653101222
Q gi|254780921|r  131 GEEKVASYTN  140 (290)
Q Consensus       131 ~E~~v~~~~~  140 (290)
                      .|.+.+....
T Consensus       152 l~~~t~sLa~  161 (257)
T PRK09291        152 LEAIAEAMHA  161 (257)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999999


No 114
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. Members of this protein family are the enzyme 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. The enzymatic properties were confirmed experimentally in Rhodopseudomonas palustris; the enzyme is homotetrameric, and not sensitive to oxygen. This enzyme is part of proposed pathway for degradation of benzoyl-CoA to 3-hydroxypimeloyl-CoA that differs from the analogous in Thauera aromatica. It also may occur in degradation of the non-aromatic compound cyclohexane-1-carboxylate.
Probab=99.27  E-value=6e-12  Score=86.49  Aligned_cols=129  Identities=16%  Similarity=0.147  Sum_probs=95.7

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++-||.++++.| .+|.+|+..+|++                     +|++|++++++++++.     ++|++
T Consensus         5 valITG~s~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g~~~~~~~~Dv~d~~~v~~~v~~~~~~~G~iDil   84 (250)
T TIGR03206         5 TAIVTGGGGGIGGATCRRFAEEGAKVAVFDLNREAAEKVAADIRAKGGNAQAFACDITDRDSVDTAVAAAEQALGPVDVL   84 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99996857689999999999879999999798899999999999539928999944899999999999999975999799


Q ss_pred             EECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             97863445432----233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||+||......    .+.+.+..+++|+.++-++++++.    +.+ -++|++||..-.-+   .        .+...|+
T Consensus        85 vnnAg~~~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~~~---~--------~~~~~Y~  153 (250)
T TIGR03206        85 VNNAGWDKFGPFTKTEPPLWERLIAINLTGALHMHHAVLPGMVERGAGRIVNIASDAARVG---S--------SGEAVYA  153 (250)
T ss_pred             EECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---C--------CCCHHHH
T ss_conf             9898889998903499999999999982999999999999999749917999655775768---9--------9858899


Q ss_pred             HHHHHHHHHHCCCCCC
Q ss_conf             2456666531012223
Q gi|254780921|r  126 KSKLAGEEKVASYTNN  141 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~~  141 (290)
                      .+|.+...+.+..+..
T Consensus       154 asKaav~~ltk~lA~e  169 (250)
T TIGR03206       154 ACKGGLVAFSKTMARE  169 (250)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999


No 115
>PRK07577 short chain dehydrogenase; Provisional
Probab=99.27  E-value=5.7e-12  Score=86.58  Aligned_cols=128  Identities=18%  Similarity=0.155  Sum_probs=96.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------CCCCCHHHHHHHHH----HCCCCEEEECCCCCCCCC-
Q ss_conf             4999978897889999999-6498599961367----------08789999999997----559989997863445432-
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------IDLLKPKDFASFFL----SFSPDVIINPAAYTAVDK-   65 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------~D~~~~~~~~~~l~----~~~pd~Vih~Aa~~~~~~-   65 (290)
                      ++|||||++-||.++++.| .+|++|+.+.|+.          +|++|.++++++++    ....|++||.||...+.. 
T Consensus         5 ~alITGas~GIG~aia~~la~~G~~Vv~~~r~~~~~~~~~~~~~D~~d~~~~~~~~~~~~~~~~id~LVnnAG~~~~~~~   84 (234)
T PRK07577          5 TVLVTGATKGIGLALSLRLANLGHQVIGIARSAIDDFPGELFACDLADIEQTAATLAQINEIHPVDAIVNNVGIALPQPL   84 (234)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCH
T ss_conf             89993778889999999999879999996347544789769999579999999999999976999899989988999880


Q ss_pred             ---CCCCCCEEEEECCCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             ---2332210242012221100011223----33-333445532111357554421111222211101245666653101
Q gi|254780921|r   66 ---AEDEPEIAFSINAEGAGAIAKAADS----IG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVAS  137 (290)
Q Consensus        66 ---~e~~~~~~~~~Nv~~~~~l~~~~~~----~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~  137 (290)
                         .+.+.+..+++|+.++..+++++..    .+ -++|++||-.++ |.   |        ....|+.+|.+.+.+.+.
T Consensus        85 ~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IInisS~~~~-~~---~--------~~~~Y~asKaal~~ltks  152 (234)
T PRK07577         85 GKIDLAALQDVYDLNVRAAVQVTQAFLEGMKLREQGRIVNICSRAIF-GA---L--------DRTSYSAAKSALVGCTRT  152 (234)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECHHCC-CC---C--------CCHHHHHHHHHHHHHHHH
T ss_conf             55999999999999979999999999999887489867999601102-78---8--------747789999999999999


Q ss_pred             CCCC
Q ss_conf             2223
Q gi|254780921|r  138 YTNN  141 (290)
Q Consensus       138 ~~~~  141 (290)
                      .+..
T Consensus       153 lA~e  156 (234)
T PRK07577        153 WALE  156 (234)
T ss_pred             HHHH
T ss_conf             9999


No 116
>PRK07023 short chain dehydrogenase; Provisional
Probab=99.27  E-value=6.1e-12  Score=86.44  Aligned_cols=130  Identities=16%  Similarity=0.201  Sum_probs=91.5

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------CCCCCHHHHHHHHH---------HCCCCEE
Q ss_conf             94999978897889999999-6498599961367----------------08789999999997---------5599899
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------IDLLKPKDFASFFL---------SFSPDVI   54 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------~D~~~~~~~~~~l~---------~~~pd~V   54 (290)
                      ||.||||+++=||.++++.| .+|++|+.++|+.                +|++|.+.++.++.         ..+.+++
T Consensus         2 ~rAlITGas~GIG~aiA~~la~~G~~Vi~~~r~~~~~l~~~~~~~~~~~~~Dl~d~~~~~~~~~~~~~~~~~~~~~~~il   81 (243)
T PRK07023          2 VRAIVTGHSRGLGAALAEQLLQPGIAVLGVSRSRHPSLAARAGERLAEVELDLSDPAAAAAWLAGDTLRAFVDGASRVLL   81 (243)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             99999287629999999999987999999979978999986799757999505778999999999999975413775899


Q ss_pred             EECCCCCCCCC--C---CCCCCEEEEECCCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             97863445432--2---332210242012221100011223----33-33344553211135755442111122221110
Q gi|254780921|r   55 INPAAYTAVDK--A---EDEPEIAFSINAEGAGAIAKAADS----IG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        55 ih~Aa~~~~~~--~---e~~~~~~~~~Nv~~~~~l~~~~~~----~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      ||.|+...+..  .   +.+.+..+++|+.++..+.+++..    .+ .++|++||...+.     |..      ....|
T Consensus        82 inNAG~~~~~~~~~~~~~~~~~~~~~vNl~~~~~l~~~~~~~~~~~~~g~IInisS~a~~~-----~~~------~~~~Y  150 (243)
T PRK07023         82 INNAGTVEPIGPLDTQDAAAIARAVGLNVAAPLMLTAALAQAASDAAERRILHISSGAARN-----AYA------GWSVY  150 (243)
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECHHHCC-----CCC------CCHHH
T ss_conf             9779878888751009999999999997599999999999999972798605783311167-----899------96689


Q ss_pred             HHHHHHHHHHHCCCCCC
Q ss_conf             12456666531012223
Q gi|254780921|r  125 GKSKLAGEEKVASYTNN  141 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~~  141 (290)
                      +.||.+.+.+.+..+..
T Consensus       151 ~aSKaal~~~t~sla~E  167 (243)
T PRK07023        151 CATKAALDHHARAVALE  167 (243)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             99999999999999986


No 117
>pfam00106 adh_short short chain dehydrogenase. This family contains a wide variety of dehydrogenases.
Probab=99.27  E-value=6.4e-12  Score=86.31  Aligned_cols=128  Identities=14%  Similarity=0.203  Sum_probs=92.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCE-EEEECHH-----------------------HCCCCCHHHHHHHHHHC-----CC
Q ss_conf             4999978897889999999-64985-9996136-----------------------70878999999999755-----99
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVE-IIRVGRP-----------------------DIDLLKPKDFASFFLSF-----SP   51 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~-v~~~~r~-----------------------~~D~~~~~~~~~~l~~~-----~p   51 (290)
                      -+|||||++=||.++++.| .+|.. ++..+|+                       .+|++|+++++++++..     ++
T Consensus         2 T~lITGas~GIG~aia~~la~~Ga~~vv~~~r~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~i   81 (167)
T pfam00106         2 TVLITGGTGGLGLALARWLAAEGARHLVLVSRRGDAPGAAELVAELEALGAEVTVAACDVADRDALAALLAALPAALGPL   81 (167)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             89998978789999999999879948999659967689999999999559859999846999999999999999975997


Q ss_pred             CEEEECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             89997863445432----2332210242012221100011223333-334455321113575544211112222111012
Q gi|254780921|r   52 DVIINPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        52 d~Vih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      |++||+|+......    .+.+.+..+++|+.++.++++.+...+. ++|++||..-+-+   .|        -...|+.
T Consensus        82 D~linnAG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~~~G~Ii~isS~~g~~~---~~--------~~~~Y~a  150 (167)
T pfam00106        82 DGVVHNAGVLDDGPLEELTPERFERVLAPKVTGAWNLHELTLDLDLGAFVLFSSVAGVLG---SP--------GQANYAA  150 (167)
T ss_pred             CEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCC---CC--------CCHHHHH
T ss_conf             399988712689865652699999999998699999999975535895799935111378---99--------9778999


Q ss_pred             HHHHHHHHHCCCCC
Q ss_conf             45666653101222
Q gi|254780921|r  127 SKLAGEEKVASYTN  140 (290)
Q Consensus       127 sK~~~E~~v~~~~~  140 (290)
                      ||.+.+.+.+....
T Consensus       151 sKaal~~lt~~La~  164 (167)
T pfam00106       151 ANAALDALAEHRRA  164 (167)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999997


No 118
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.26  E-value=1.1e-11  Score=85.05  Aligned_cols=179  Identities=18%  Similarity=0.141  Sum_probs=111.0

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEE-CHH---------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             4999978897889999999-649859996-136---------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRV-GRP---------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~-~r~---------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      .+|||||++=||+++++.| .+|.+|+.. .++                     ++|++|++++++++++.     +.|+
T Consensus         6 valVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~G~iDi   85 (250)
T PRK08063          6 VALVTGSSRGIGKAIALRLAKEGYDIAINYARSRKAAEETANEIEQLGRKALVVKANVGDVEKIKEMFSQIDEHFGRLDV   85 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             89995876699999999999889989997599989999999999954995899984799999999999999998099889


Q ss_pred             EEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9978634454----32233221024201222110001122----333-33344553211135755442111122221110
Q gi|254780921|r   54 IINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        54 Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      +||.|+....    +..+.+.+..+++|+.++-.+++.+.    +.+ -++|++||....   ...  .      ....|
T Consensus        86 LVnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IVnisS~~~~---~~~--~------~~~~Y  154 (250)
T PRK08063         86 FVNNAASGVLRPAMELEESHWDWTMNINAKALLFCAQEAAKLMEKNGGGKIISLSSLGSI---RYL--E------NYTTV  154 (250)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEHHHC---CCC--C------CCCHH
T ss_conf             998785678899266999999999987403799999999999986389861588733105---678--9------96045


Q ss_pred             HHHHHHHHHHHCCCCCCC---CC----CCCCCCEECCCCCCC--CEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHH
Q ss_conf             124566665310122232---23----555420003686320--002011246652153045545445223689999999
Q gi|254780921|r  125 GKSKLAGEEKVASYTNNY---VI----LRTAWVYSIFGSNFL--LSMLRLAKERREISVVCDQFGTPTSALQIARAIIQI  195 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~~~---~I----lR~~~vyG~~~~~~v--~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~  195 (290)
                      +.+|.+.+.+.+..+..+   -|    +.|+++-.+.-..+.  ..+++...++.++       +-+...+|+|+++..+
T Consensus       155 ~asKaal~~ltk~lA~ela~~gIrVNaI~PG~i~T~~~~~~~~~~~~~~~~~~~~P~-------~R~g~pedia~~v~fL  227 (250)
T PRK08063        155 GVSKAALEALTRYLAVELAPKGIAVNAVSGGAVDTDALKHFPNREELLEDAQANTPA-------GRMVEPEDLVNAVLFL  227 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCHHHHCCCCCHHHHHHHHHCCCC-------CCCCCHHHHHHHHHHH
T ss_conf             878999999999999997253928999860879876776179849999999867999-------9986999999999999


Q ss_pred             HHH
Q ss_conf             984
Q gi|254780921|r  196 AHN  198 (290)
Q Consensus       196 ~~~  198 (290)
                      +..
T Consensus       228 ~S~  230 (250)
T PRK08063        228 CSP  230 (250)
T ss_pred             HCC
T ss_conf             374


No 119
>PRK08324 short chain dehydrogenase; Validated
Probab=99.26  E-value=1.2e-11  Score=84.88  Aligned_cols=128  Identities=17%  Similarity=0.248  Sum_probs=95.7

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHHC-----CCCEEEE
Q ss_conf             999978897889999999-6498599961367--------------------0878999999999755-----9989997
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLSF-----SPDVIIN   56 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~~-----~pd~Vih   56 (290)
                      +|||||+|=||.++++.| .+|.+|+.+++++                    +|++|++++++++++.     +.|++||
T Consensus       424 ALVTGga~GIG~A~A~~fa~eGA~Vvl~D~~~~~l~~~a~el~~~~~~~~~~~DVtd~~~v~~~v~~~~~~fGgIDiLVn  503 (676)
T PRK08324        424 ALVTGAAGGIGLATAKRLAAEGACVVLADIDEEAAEAAAAELGGRDRALGVACDVTDEAAVQAAFEEAALAFGGVDIVVS  503 (676)
T ss_pred             EEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             99947988162999999998799899995888999999999707994799980689999999999999998599888997


Q ss_pred             CCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             86344543----2233221024201222110001122----33--33334455321113575544211112222111012
Q gi|254780921|r   57 PAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SI--GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        57 ~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~--~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      .||+....    ..+.+.+..+++|+.++..+++++.    ..  |-.+|++||.....+   .|        ....|+.
T Consensus       504 NAGi~~~~~~~e~s~e~w~~~~~vNl~g~f~~~r~a~p~M~~qg~GG~IV~isS~~a~~~---~~--------~~~aY~a  572 (676)
T PRK08324        504 NAGIALSGPIGETSDELWRRSFEVNFTGHFLVAREAVRIMKAQGTGGNLVFIASKNAVNP---GP--------NFGAYSA  572 (676)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHCC---CC--------CCHHHHH
T ss_conf             677789988265999999999988609999999999999997699919999825775267---99--------9689999


Q ss_pred             HHHHHHHHHCCCCCC
Q ss_conf             456666531012223
Q gi|254780921|r  127 SKLAGEEKVASYTNN  141 (290)
Q Consensus       127 sK~~~E~~v~~~~~~  141 (290)
                      +|.+...+.+.++..
T Consensus       573 sKAAl~~Ltr~lA~E  587 (676)
T PRK08324        573 AKAAELHLVRQYALE  587 (676)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 120
>PRK05866 short chain dehydrogenase; Provisional
Probab=99.26  E-value=9.9e-12  Score=85.24  Aligned_cols=129  Identities=18%  Similarity=0.225  Sum_probs=91.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+||||+++=||.++++.| .+|.+|+.++|++                     +|++|.+++++++++.     +.|++
T Consensus        42 vaLITGassGIG~aiA~~la~~Ga~Vvl~~R~~~~l~~~~~~i~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDiL  121 (290)
T PRK05866         42 RILLTGASSGIGEAAAEKFARRGATVVAVARRKDLLDAVADRITAAGGDAMAIPCDLSDLDAVDALVADVEERIGGVDIL  121 (290)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89990813099999999999869989999899999999999999649908999778898999999999999985998889


Q ss_pred             EECCCCCCCCCC-C-----CCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             978634454322-3-----3221024201222110001122----333-3334455321113575544211112222111
Q gi|254780921|r   55 INPAAYTAVDKA-E-----DEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        55 ih~Aa~~~~~~~-e-----~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      ||.||....... +     .+.+..+++|+.++.++++++.    +.+ -++|.+||...+.+  ..|.        .+.
T Consensus       122 VNNAG~~~~~~~~~~~~~~~d~~~~~~vN~~g~~~l~~~~lp~M~~~~~G~IVnisS~~~~~~--~~p~--------~~~  191 (290)
T PRK05866        122 INNAGRSIRRPLAESLDRWHDVERTMVLNYYAPLRLIRGLAPGMIERGDGHIINVATWGVLSE--ASPL--------FSV  191 (290)
T ss_pred             EECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCC--CCCC--------CCH
T ss_conf             975766678742221577999999999983999999987509999669964999927243278--8988--------641


Q ss_pred             CHHHHHHHHHHHCCCCC
Q ss_conf             01245666653101222
Q gi|254780921|r  124 YGKSKLAGEEKVASYTN  140 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~~  140 (290)
                      |+.||.+...+.+....
T Consensus       192 Y~ASKaAl~~lt~sLa~  208 (290)
T PRK05866        192 YNASKAALSAVSRVIET  208 (290)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             89999999999999999


No 121
>PRK07067 sorbitol dehydrogenase; Provisional
Probab=99.26  E-value=8.5e-12  Score=85.62  Aligned_cols=127  Identities=15%  Similarity=0.175  Sum_probs=94.9

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEEECC
Q ss_conf             999978897889999999-6498599961367------------------0878999999999755-----998999786
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVIINPA   58 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vih~A   58 (290)
                      +|||||++=||.++++.| .+|.+|+..++++                  +|++|.+++++++++.     ++|++||.|
T Consensus         8 alVTGas~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiLVNNA   87 (256)
T PRK07067          8 ALLTGAASGIGEAVAQRYLREGARVVLADIKPARAALAALEIGPAAVAVSLDVTRQDSIDRIVAAAVERFGGIDILVNNA   87 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99937677899999999998799999997988999999998199759999848999999999999999819998999899


Q ss_pred             CCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----C--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             34454----32233221024201222110001122----3--33333445532111357554421111222211101245
Q gi|254780921|r   59 AYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----S--IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        59 a~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~--~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
                      ++...    +..+.+.+..+++|+.++-.+++++.    +  .+-++|.+||....   ...|        ....|+.||
T Consensus        88 Gi~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~~~m~~~~~~G~IVnisS~~g~---~~~~--------~~~~Y~asK  156 (256)
T PRK07067         88 ALFDMAPILEISRDVYDRLFAVNVKGLFFLMQAVAQHMVEQGRGGKIINMASQAGR---RGEA--------LVSHYCATK  156 (256)
T ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEHHHC---CCCC--------CCHHHHHHH
T ss_conf             88999881349999999999985177899999999999980899559998416436---6898--------866899999


Q ss_pred             HHHHHHHCCCCC
Q ss_conf             666653101222
Q gi|254780921|r  129 LAGEEKVASYTN  140 (290)
Q Consensus       129 ~~~E~~v~~~~~  140 (290)
                      .+...+.+..+.
T Consensus       157 aav~~lTr~lA~  168 (256)
T PRK07067        157 AAVISYTQSAAL  168 (256)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 122
>PRK07035 short chain dehydrogenase; Provisional
Probab=99.25  E-value=2.3e-11  Score=83.23  Aligned_cols=128  Identities=16%  Similarity=0.192  Sum_probs=92.4

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++=||+++++.| ++|.+|+..+|+.                     +|++|+++++++++..     ++|++
T Consensus        10 valITGas~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~iDil   89 (252)
T PRK07035         10 IALVTGASRGIGEAIAKLLAQQGAHVIVSSRKLDGCQAVADAIVAAGGKAEALACHIGEMEQIDALFAQIRERHGRLDIL   89 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995887499999999999879989999798899999999999649957999824899999999999999982997789


Q ss_pred             EECCCCCCC-----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             978634454-----32233221024201222110001122----333-33344553211135755442111122221110
Q gi|254780921|r   55 INPAAYTAV-----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        55 ih~Aa~~~~-----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      ||+||....     +..+.+.+..+++|+.++..+++++.    +.+ .++|++||..-+.   ..        .....|
T Consensus        90 VnnAg~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IvnisS~~~~~---~~--------~~~~~Y  158 (252)
T PRK07035         90 VNNAAANPYFGHILDTDLGAFQKTVDVNIRGYFFMSVEAGKLMKEQGGGSIVNVASVNGVS---PG--------DFQGIY  158 (252)
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHCC---CC--------CCCHHH
T ss_conf             8768558888882009999999999987124310004536999966997499972544368---89--------874889


Q ss_pred             HHHHHHHHHHHCCCCC
Q ss_conf             1245666653101222
Q gi|254780921|r  125 GKSKLAGEEKVASYTN  140 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~  140 (290)
                      +.+|.+.+.+.+..+.
T Consensus       159 ~asKaal~~ltr~lA~  174 (252)
T PRK07035        159 SITKAAVISMTKAFAK  174 (252)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999


No 123
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated
Probab=99.25  E-value=1.4e-11  Score=84.42  Aligned_cols=177  Identities=13%  Similarity=0.109  Sum_probs=112.4

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+||||+++-||+++++.| .+|.+|+..+|++                     +|++|.++++++++..     +.|++
T Consensus        13 valVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~~G~iDil   92 (255)
T PRK06113         13 CAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAVSKLGKVDIL   92 (255)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995887789999999999879999999698899999999999659908999836899999999999999981998899


Q ss_pred             EECCCCCCC---CCCCCCCCEEEEECCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             978634454---32233221024201222110001122----33-33334455321113575544211112222111012
Q gi|254780921|r   55 INPAAYTAV---DKAEDEPEIAFSINAEGAGAIAKAAD----SI-GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        55 ih~Aa~~~~---~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~-~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      ||.|+...+   |....+.+..+++|+.++-++++.+.    +. +-++|.+||....   ...        .....|+.
T Consensus        93 VnNAG~~~~~~~d~~~~~~~~~~~~Nl~~~~~~~~~~~p~m~~~~~G~IInisS~~~~---~~~--------~~~~~Y~a  161 (255)
T PRK06113         93 VNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAE---NKN--------INMTSYAS  161 (255)
T ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHC---CCC--------CCCHHHHH
T ss_conf             9878878998775999999999999649999999999998887189679998446546---889--------98520899


Q ss_pred             HHHHHHHHHCCCCCC---CCCCCCCCCEECC--CCCCCCEE-----ECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             456666531012223---2235554200036--86320002-----0112466521530455454452236899999999
Q gi|254780921|r  127 SKLAGEEKVASYTNN---YVILRTAWVYSIF--GSNFLLSM-----LRLAKERREISVVCDQFGTPTSALQIARAIIQIA  196 (290)
Q Consensus       127 sK~~~E~~v~~~~~~---~~IlR~~~vyG~~--~~~~v~~~-----l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~  196 (290)
                      +|.+...+.+..+..   +- +|... ..|+  ........     .+...++.++.    .+   -..+|+|.++..++
T Consensus       162 sKaav~~ltk~lA~ela~~g-IrVN~-V~PG~i~T~~~~~~~~~~~~~~~~~~~Pl~----R~---g~pediA~~v~fL~  232 (255)
T PRK06113        162 SKAAASHLVRNMAFDLGEKN-IRVNG-IAPGAILTDALKSVITPEIEQKMLQHTPIR----RL---GQPQDIANAALFLC  232 (255)
T ss_pred             HHHHHHHHHHHHHHHHHHCC-EEEEE-EEECCCCCCHHHHCCCHHHHHHHHHCCCCC----CC---CCHHHHHHHHHHHH
T ss_conf             99999999999999982649-49999-864889870222017999999998579988----98---29999999999994


Q ss_pred             HH
Q ss_conf             84
Q gi|254780921|r  197 HN  198 (290)
Q Consensus       197 ~~  198 (290)
                      ..
T Consensus       233 S~  234 (255)
T PRK06113        233 SP  234 (255)
T ss_pred             CC
T ss_conf             81


No 124
>PRK06914 short chain dehydrogenase; Provisional
Probab=99.25  E-value=1.2e-11  Score=84.78  Aligned_cols=126  Identities=22%  Similarity=0.192  Sum_probs=91.9

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH-----------------------HCCCCCHHHHHHH---HHH-CCCCEE
Q ss_conf             999978897889999999-649859996136-----------------------7087899999999---975-599899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-----------------------DIDLLKPKDFASF---FLS-FSPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-----------------------~~D~~~~~~~~~~---l~~-~~pd~V   54 (290)
                      +|||||++=||.++++.| .+|++|+.++|+                       .+|++|.++++.+   +++ .+.|++
T Consensus         6 alITGassGIG~a~A~~la~~G~~V~~~~r~~~~~~~l~~~~~~~~~~~~~~~~~~Dvtd~~~v~~~~~~~~~~g~iDvL   85 (280)
T PRK06914          6 AIITGASSGFGLLTTLELAKKDYLVIATMRNLEKQENLISQAAQLNLSQNIKVQQLDVTDQNSIHNFQLFLKEYGRIDLL   85 (280)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             99907344999999999998799899998988999999999996499976699968899999999999999982998789


Q ss_pred             EECCCCCCCCCC----CCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             978634454322----33221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVDKA----EDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~~~----e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||.||+......    ..+.+..+++|+.|+..+++++.    +.+ -++|.+||-.   |....|.        .+.|+
T Consensus        86 VNNAG~~~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~lp~m~~~~~G~IvnisS~~---g~~~~p~--------~~~Y~  154 (280)
T PRK06914         86 VNNAGYANGGFVEEIPVEEYRKQFETNVFGAISVTQAVLPYMRKQKSGKIINISSIS---GQVGFPA--------LSPYV  154 (280)
T ss_pred             EECCCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHH---HCCCCCC--------CHHHH
T ss_conf             978866778742117799999999871289998999997877756995899983413---3268998--------73799


Q ss_pred             HHHHHHHHHHCCCC
Q ss_conf             24566665310122
Q gi|254780921|r  126 KSKLAGEEKVASYT  139 (290)
Q Consensus       126 ~sK~~~E~~v~~~~  139 (290)
                      .||.+.+.+.....
T Consensus       155 aSK~Al~~~t~sL~  168 (280)
T PRK06914        155 SSKYALEGWSESLR  168 (280)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999


No 125
>PRK06483 short chain dehydrogenase; Provisional
Probab=99.25  E-value=1e-11  Score=85.13  Aligned_cols=127  Identities=20%  Similarity=0.185  Sum_probs=89.7

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------CCCCCHHHHHHHHHHC-----CCCEEEECCCC
Q ss_conf             999978897889999999-6498599961367----------------0878999999999755-----99899978634
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------IDLLKPKDFASFFLSF-----SPDVIINPAAY   60 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------~D~~~~~~~~~~l~~~-----~pd~Vih~Aa~   60 (290)
                      ||||||++=||.++++.| .+|++|+.++|++                +|++|+++++++++..     ++|++||+|+.
T Consensus         5 VlVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~~~~~l~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~id~lVnNAg~   84 (236)
T PRK06483          5 ILITGAGQRIGLALAKHLLAQGQPVIVSYRSHYPAIDELRQAGATCIQADFSTNAGIMAFIDELKQHTDGLRAIIHNASD   84 (236)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             99978998899999999998899899995984799999985699899922799999999999999983997599977744


Q ss_pred             CCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             45432----233221024201222110001122----333---3334455321113575544211112222111012456
Q gi|254780921|r   61 TAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SIG---IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        61 ~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~---~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~  129 (290)
                      ..++.    .+.+.+..+++|+.++..+.+++.    ..+   ..+|++||.....|   .|        ....|+.+|.
T Consensus        85 ~~~~~~~~~~~~~~~~~~~vn~~~~~~~~~~~~~~l~~~~~~~~~Ii~isS~~~~~g---~~--------~~~~Y~asKa  153 (236)
T PRK06483         85 WLAESPGAPLADVLARMMQIHVNAPYLLNLALEDLLRGHGHAASDIIHITDYVVEKG---SD--------KHIAYAASKA  153 (236)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCC---CC--------CCHHHHHHHH
T ss_conf             678883438899999999973358999999989999975888667765422656424---88--------8478999999


Q ss_pred             HHHHHHCCCCC
Q ss_conf             66653101222
Q gi|254780921|r  130 AGEEKVASYTN  140 (290)
Q Consensus       130 ~~E~~v~~~~~  140 (290)
                      +.+.+.+..+.
T Consensus       154 al~~ltr~lA~  164 (236)
T PRK06483        154 ALDNMTLSFAA  164 (236)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 126
>PRK12939 short chain dehydrogenase; Provisional
Probab=99.25  E-value=8.8e-12  Score=85.53  Aligned_cols=129  Identities=20%  Similarity=0.203  Sum_probs=96.4

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++=||.++++.| .+|.+|+.++|++                     +|+++.+.++++++..     ++|++
T Consensus         9 valVTGgs~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iDiL   88 (250)
T PRK12939          9 RALVTGAARGLGAAFAEALAEAGATVAFNDGLAAEARELAAALEAAGGRAHAIAADLADPASVQRFFDAAAAALGGLDGL   88 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             79995836689999999999879999999698899999999999559909999924899999999999999974999799


Q ss_pred             EECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             978634454----32233221024201222110001122----33-3333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SI-GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~-~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||+|++...    +..+.+.+..+++|+.++-.+++++.    +. +-++|.+||....-+   .|        ....|+
T Consensus        89 VNNAG~~~~~~~~~~~~e~~~~~~~iNl~~~~~~~k~~~~~m~~~~~G~IInisS~~~~~~---~~--------~~~~Y~  157 (250)
T PRK12939         89 VNNAGITNSKSATELDIDTWDAVMNVNVRGTFLMSRAALPHLRDSGRGRIVNLASDTALWG---AP--------KLLAYV  157 (250)
T ss_pred             EECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CC--------CCHHHH
T ss_conf             9887789999903499999999999982999999999999999849937999806776768---99--------858899


Q ss_pred             HHHHHHHHHHCCCCCC
Q ss_conf             2456666531012223
Q gi|254780921|r  126 KSKLAGEEKVASYTNN  141 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~~  141 (290)
                      .+|.+.+.+.+..+..
T Consensus       158 asKaal~~ltk~lA~e  173 (250)
T PRK12939        158 ASKGAVIGMTRSLARE  173 (250)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999


No 127
>PRK07775 short chain dehydrogenase; Provisional
Probab=99.25  E-value=1e-11  Score=85.15  Aligned_cols=128  Identities=20%  Similarity=0.252  Sum_probs=95.4

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+||||+++=||.++++.| .+|++|+.++|+.                     +|++|.+++++++++.     +.|++
T Consensus        12 tAlVTGAssGIG~aiA~~la~~G~~V~l~~R~~e~l~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDiL   91 (275)
T PRK07775         12 PAIVAGASSGIGAATAIELAAHGFPVALGARRVEKCEEIVDKIRADGGEAVAFPLDVTDPDSVKSFVAQATEALGDIEVL   91 (275)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             79994623599999999999879989999898999999999999649948999912899999999999999985996599


Q ss_pred             EECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             97863445432----233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||+|+......    .+.+.+..+++|+.++.++++++.    +.+ -++|++||..-+.   ..|.        .+.|+
T Consensus        92 VnNAG~~~~~~~~e~~~e~~~~~~~vNl~g~~~~~~a~lP~M~~~~~G~IV~isS~a~~~---~~p~--------~~~Y~  160 (275)
T PRK07775         92 VSGAGDTYFGKLHEISTEQFESQVQIHLVGANRLATAVLPGMVERRRGDLIFVGSDVALR---QRPH--------MGAYG  160 (275)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHC---CCCC--------CHHHH
T ss_conf             976756888860109999999999885279999999999999975995799984476506---8999--------80599


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+.+.+.+....
T Consensus       161 AsKaav~~lt~~La~  175 (275)
T PRK07775        161 AAKAGLVAMVTNLQM  175 (275)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 128
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional
Probab=99.25  E-value=1.1e-11  Score=84.91  Aligned_cols=127  Identities=14%  Similarity=0.091  Sum_probs=92.5

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH-----------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             999978897889999999-649859996136-----------------------70878999999999755-----9989
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-----------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-----------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      +|||||++=||.++++.| .+|++|+.++|+                       ++|++|++++++++++.     ++|+
T Consensus         5 alITG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~iDi   84 (259)
T PRK12384          5 AVVIGGGQTLGAFLCHGLAEEGYRVAVADINSEKAANVAQEINAEYGEGMAYGFGADATSEQSVLALSRGVDEIFGRVDL   84 (259)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             99946886899999999998799999997988999999999986248860899983279999999999999998299719


Q ss_pred             EEECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99786344543----2233221024201222110001122----333--3334455321113575544211112222111
Q gi|254780921|r   54 IINPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG--IPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        54 Vih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~--~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      +||+|++....    ..+.+.+..+++|+.++-.+++.+.    +.+  -++|++||...+-+   .|        +...
T Consensus        85 lVnnAG~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~Iv~isS~~~~~~---~~--------~~~~  153 (259)
T PRK12384         85 LVYSAGIAKAAKITDFQLGDFDRSLQVNLVGYFLCAREFSRLMIRDGIQGRIIQINSKSGKVG---SK--------HNSG  153 (259)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CC--------CCCH
T ss_conf             998997778899145999999999998864422346776368997389845999835254558---85--------4306


Q ss_pred             CHHHHHHHHHHHCCCCC
Q ss_conf             01245666653101222
Q gi|254780921|r  124 YGKSKLAGEEKVASYTN  140 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~~  140 (290)
                      |+.+|.+.+.+.+..+.
T Consensus       154 Y~asK~al~~ltk~lA~  170 (259)
T PRK12384        154 YSAAKFGGVGLTQSLAL  170 (259)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             79999999999999999


No 129
>PRK07523 gluconate 5-dehydrogenase; Provisional
Probab=99.25  E-value=9.7e-12  Score=85.29  Aligned_cols=128  Identities=19%  Similarity=0.184  Sum_probs=94.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEEEC
Q ss_conf             4999978897889999999-6498599961367------------------0878999999999755-----99899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vih~   57 (290)
                      .+|||||++=||.++++.| .+|.+|+..+|++                  +|++|.+++++++++.     ++|++||+
T Consensus        11 ~alVTG~s~GIG~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~~l~~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDiLVNN   90 (251)
T PRK07523         11 RALITGSSQGIGYALAKGLAQAGAEVILNGRDAAKLAAAAESLKGSAHTLAFDVTDHDAVRAAIDAFEAEIGPIDILVNN   90 (251)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             89995836699999999999879999999699899999999818872799995799999999999999975998699989


Q ss_pred             CCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             6344543----2233221024201222110001122----333-333445532111357554421111222211101245
Q gi|254780921|r   58 AAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        58 Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
                      |++....    ..+.+.+..+++|+.++-.+++++.    +.+ -++|.+||..-.   ...|        -...|+.+|
T Consensus        91 AG~~~~~~~~~~~~e~~~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IInisS~~~~---~~~~--------~~~~Y~asK  159 (251)
T PRK07523         91 AGMQHRTPLEDFPADAFERLLQTNISSVFYVGQAVARHMIARGAGKIINIASVQSA---LARP--------GIAPYTATK  159 (251)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHC---CCCC--------CCHHHHHHH
T ss_conf             88799999055999999999999739999999999899886399679999415760---7689--------947899999


Q ss_pred             HHHHHHHCCCCC
Q ss_conf             666653101222
Q gi|254780921|r  129 LAGEEKVASYTN  140 (290)
Q Consensus       129 ~~~E~~v~~~~~  140 (290)
                      .+.+.+.+..+.
T Consensus       160 aav~~lTr~lA~  171 (251)
T PRK07523        160 GAVGNLTKGMAT  171 (251)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 130
>PRK06398 aldose dehydrogenase; Validated
Probab=99.25  E-value=9e-12  Score=85.49  Aligned_cols=127  Identities=17%  Similarity=0.150  Sum_probs=94.9

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-----------CCCCCHHHHHHHHHHC-----CCCEEEECCCCCCCC
Q ss_conf             4999978897889999999-6498599961367-----------0878999999999755-----998999786344543
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-----------IDLLKPKDFASFFLSF-----SPDVIINPAAYTAVD   64 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-----------~D~~~~~~~~~~l~~~-----~pd~Vih~Aa~~~~~   64 (290)
                      .+|||||++=||.++++.| .+|.+|+.++|++           +|++|++++++++++.     +.|++||+|++....
T Consensus         8 valVTGgs~GIG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~i~~Dvt~~~~v~~~v~~~~~~~G~iDiLVNNAG~~~~~   87 (256)
T PRK06398          8 VVIVTGGSSGIGLAIVSRFVDEGSKVVSISRSEPEDINKSDHIKCDVTNEDEVKNAINEISKKYGRIDVLVNNAGIEKYG   87 (256)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCEEEECCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCC
T ss_conf             89996878789999999999869999999487512517223898547999999999999999839997999899999999


Q ss_pred             ----CCCCCCCEEEEECCCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             ----22332210242012221100011223----33-3334455321113575544211112222111012456666531
Q gi|254780921|r   65 ----KAEDEPEIAFSINAEGAGAIAKAADS----IG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKV  135 (290)
Q Consensus        65 ----~~e~~~~~~~~~Nv~~~~~l~~~~~~----~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v  135 (290)
                          ..+.+.+..+++|+.++-++++++..    .+ -++|.+||..-+-+   .|        ....|+.+|.+...+.
T Consensus        88 ~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~~~---~~--------~~~~Y~asKaal~~lt  156 (256)
T PRK06398         88 SLHKTDSGTWRRIIDVNVNGVYYMSKEVIPHMLRSGTGSIVNISSVQADIA---TK--------NAAAYVTSKHALIGLT  156 (256)
T ss_pred             CHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCC---CC--------CCHHHHHHHHHHHHHH
T ss_conf             904499999999999973628999999999999839957999804020777---99--------9689999999999999


Q ss_pred             CCCC
Q ss_conf             0122
Q gi|254780921|r  136 ASYT  139 (290)
Q Consensus       136 ~~~~  139 (290)
                      +..+
T Consensus       157 rslA  160 (256)
T PRK06398        157 KSIA  160 (256)
T ss_pred             HHHH
T ss_conf             9999


No 131
>PRK07806 short chain dehydrogenase; Provisional
Probab=99.25  E-value=2.7e-11  Score=82.82  Aligned_cols=128  Identities=16%  Similarity=0.235  Sum_probs=90.9

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             4999978897889999999-649859996136----------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      .+||||+++=||.++++.| .+|++|+..+|+                      ++|++|++++++++++.     ++|+
T Consensus         8 valVTGas~GIG~aiA~~la~~Ga~Vvi~~~~~~~~a~~~~~~i~~~g~~a~~~~~Dvtd~~~v~~l~~~~~~~~G~iDi   87 (248)
T PRK07806          8 IALVTGSSRGIGAEVAKYLAGAGAHVVVNYRNKAARAEKVVAEIRAAGGRASAVGADLTDEASVAALMDAIRAEFGGLDA   87 (248)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             89993788599999999999879989998389568999999999961983999978999999999999999998499989


Q ss_pred             EEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCC---CCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCC-CCCCHHH
Q ss_conf             997863445432233221024201222110001122---33333344553211--13575544211112222-1110124
Q gi|254780921|r   54 IINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAAD---SIGIPCIYISTDYV--FDGLSRTPIDEFSPTNP-LNIYGKS  127 (290)
Q Consensus        54 Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~---~~~~~~I~iSS~~V--y~g~~~~p~~E~d~~~P-~~~Yg~s  127 (290)
                      +||.|+.....  ..+++..+++|..++.++++.+.   ..+.++|++||...  +.+...         -| ...|+.+
T Consensus        88 LVnNAg~~~~~--~~~~~~~~~~n~~~~~~~~~~~~p~m~~gg~Ii~isS~~~~~~~~~~~---------~p~~~~y~as  156 (248)
T PRK07806         88 LVLNASGGMES--GMDPDYAMRLNRDAQRRLLTLALPLMPAGSRVVFVTSHQAHFIPTVKT---------MPEYEAVAAS  156 (248)
T ss_pred             EEECCCCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHCCCCCCC---------CCCCHHHHHH
T ss_conf             99899998778--997226899998999999999997750497899985516615687777---------8662899999


Q ss_pred             HHHHHHHHCCCCC
Q ss_conf             5666653101222
Q gi|254780921|r  128 KLAGEEKVASYTN  140 (290)
Q Consensus       128 K~~~E~~v~~~~~  140 (290)
                      |.+.+.+.+....
T Consensus       157 K~A~~~~~~~la~  169 (248)
T PRK07806        157 KRAGEDALRALRP  169 (248)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999999


No 132
>PRK07041 short chain dehydrogenase; Provisional
Probab=99.24  E-value=1.6e-11  Score=84.03  Aligned_cols=177  Identities=20%  Similarity=0.174  Sum_probs=114.5

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHHC-CCCEEEECCC
Q ss_conf             4999978897889999999-6498599961367--------------------0878999999999755-9989997863
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLSF-SPDVIINPAA   59 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~~-~pd~Vih~Aa   59 (290)
                      ++|||||++=||.++++.| .+|.+|+.++|++                    +|++|.+.+++++++. +.|.+||+|+
T Consensus         9 ~~lITGgs~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~g~~d~lv~nag   88 (240)
T PRK07041          9 KVLVVGGSSGIGLAAARAFAARGADVTIASRSRERLAAAARALGGPRPVRTAALDITDEAAVDAFFAEAGPFDHVVITAA   88 (240)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEECCC
T ss_conf             89995778889999999999879999999598899999999847888669998479999999999997098788998234


Q ss_pred             CCCCCC----CCCCCCEEEEECCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             445432----233221024201222110001122333-333445532111357554421111222211101245666653
Q gi|254780921|r   60 YTAVDK----AEDEPEIAFSINAEGAGAIAKAADSIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEK  134 (290)
Q Consensus        60 ~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~  134 (290)
                      ......    ...+.+..+++|+.++..++++.+... ..+|++||...+   ...|        -...|+.+|.+.+.+
T Consensus        89 ~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~~~G~Ii~iss~~~~---~~~~--------~~~~Y~asKaal~~l  157 (240)
T PRK07041         89 DTAGGPVRALPLAAAQAAMDSKFWGAYRVARAARIAPGGSLTFVSGFLAV---RPSA--------SGVLQGAINAALEAL  157 (240)
T ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCHHHC---CCCC--------CCHHHHHHHHHHHHH
T ss_conf             47999810299999999999888999999999997169679996443314---7788--------617888876799999


Q ss_pred             HCCCCCCCCCCCCCCCEECC--CCCCCCEEE--------CCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             10122232235554200036--863200020--------1124665215304554544522368999999998
Q gi|254780921|r  135 VASYTNNYVILRTAWVYSIF--GSNFLLSML--------RLAKERREISVVCDQFGTPTSALQIARAIIQIAH  197 (290)
Q Consensus       135 v~~~~~~~~IlR~~~vyG~~--~~~~v~~~l--------~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~  197 (290)
                      .+..+..+-=+|...| .|+  ...+...+.        ....++.++    ..++   -.+|+|+++..|+.
T Consensus       158 tr~lA~ela~IrVN~I-aPG~i~T~~~~~~~~~~~~~~~~~~~~~iPl----~R~g---~pedia~~v~fL~s  222 (240)
T PRK07041        158 ARGLALELAPVRVNAV-SPGLVDTPLWSKLAGDARAAMFAAAAERLPA----RRVG---QPEDVANAIVFLAA  222 (240)
T ss_pred             HHHHHHHHCCCEEEEE-EECCCCCHHHHHCCCHHHHHHHHHHHHCCCC----CCCC---CHHHHHHHHHHHHH
T ss_conf             9999998289289998-4187677366531711389999999845999----9984---99999999999984


No 133
>PRK06194 hypothetical protein; Provisional
Probab=99.24  E-value=3.2e-11  Score=82.39  Aligned_cols=124  Identities=10%  Similarity=0.103  Sum_probs=89.9

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             999978897889999999-6498599961367---------------------0878999999999755-----998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      ++||||++=||.++++.| .+|.+|+.++|++                     +|++|.++++++++..     ++|++|
T Consensus         9 avITGassGIG~a~A~~la~~Ga~Vvl~d~~~~~l~~~~~~l~~~g~~v~~~~~DVsd~~~v~~l~~~~~~~fG~iDiLV   88 (301)
T PRK06194          9 AVITGAASGFGREFARIGARLGMKLVLADVQQDALDRAVAELRAQGAEVLGVRTDVSDAAQVEALADAALERFGAVHLLF   88 (301)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCEEEEE
T ss_conf             99927377999999999998799899997988999999999984598499996568999999999999999839937999


Q ss_pred             ECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-------CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             786344543----2233221024201222110001122----333-------3334455321113575544211112222
Q gi|254780921|r   56 NPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-------IPCIYISTDYVFDGLSRTPIDEFSPTNP  120 (290)
Q Consensus        56 h~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-------~~~I~iSS~~Vy~g~~~~p~~E~d~~~P  120 (290)
                      |+||+....    ..+.+.+..+++|+.|+.++++++.    +.+       -.+|.+||-.-+   ...|.        
T Consensus        89 NNAGi~~~~~~~e~~~edw~~v~~VNl~G~~~~~r~~lP~M~~~~~~~~~~~G~IVNisSiaG~---~~~p~--------  157 (301)
T PRK06194         89 NNAGVGAGGLLWENSLADWEWVLGVNLMGVIHGVRIFTPLMLAAAEKDPAYEGHIVNTASMAGL---LAPPA--------  157 (301)
T ss_pred             ECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHC---CCCCC--------
T ss_conf             5576678887344999999999999819999999999999997688788986499994542323---58999--------


Q ss_pred             CCCCHHHHHHHHHHHCC
Q ss_conf             11101245666653101
Q gi|254780921|r  121 LNIYGKSKLAGEEKVAS  137 (290)
Q Consensus       121 ~~~Yg~sK~~~E~~v~~  137 (290)
                      .+.|+.||.+..-+-+.
T Consensus       158 ~~~Y~ASK~AV~glT~s  174 (301)
T PRK06194        158 MGVYNVSKHAVVSLTET  174 (301)
T ss_pred             CCHHHHHHHHHHHHHHH
T ss_conf             70789999999999999


No 134
>PRK08643 acetoin reductase; Validated
Probab=99.24  E-value=1.2e-11  Score=84.73  Aligned_cols=127  Identities=19%  Similarity=0.256  Sum_probs=93.7

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             999978897889999999-6498599961367---------------------0878999999999755-----998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      +|||||++=||..+++.| ++|++|+.+++++                     +|++|++++++++++.     ++|++|
T Consensus         5 alVTGg~~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~~~~~~~~~G~iDiLV   84 (256)
T PRK08643          5 ALVTGAGQGIGFAIAKRLVEDGFKVAIVDYNEETAKAAADKLSSDGGKAIAVKADVSNRDQVFDAVQQVVDTFGDLNVVV   84 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99957578899999999998799999996988999999999985399099998058999999999999999829987999


Q ss_pred             ECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             78634454----32233221024201222110001122----33--3333445532111357554421111222211101
Q gi|254780921|r   56 NPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SI--GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        56 h~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~--~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      |.||+...    +..+.+.+..+++|+.++-.+++++.    +.  +.++|.+||..-+-|   .|  .      ...|+
T Consensus        85 NnAG~~~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~~~~m~~~~~~G~IVnisS~~~~~~---~~--~------~~~Y~  153 (256)
T PRK08643         85 NNAGLAPTTPIDTITEEQFKKVYGINVGGVIWGIQAAQEQFKKLGHGGKIINATSQAGVEG---NP--G------LSVYG  153 (256)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHCCC---CC--C------CHHHH
T ss_conf             8998899988255999999999999763689999999999998289927999832101358---99--8------48999


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .||.+...+.+..+.
T Consensus       154 asKaav~~ltkslA~  168 (256)
T PRK08643        154 STKFAVRGLTQTAAR  168 (256)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 135
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.23  E-value=1.7e-11  Score=83.99  Aligned_cols=129  Identities=12%  Similarity=0.110  Sum_probs=92.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------HCCCCCHHHHHHHHHHC-----CCCEEEECCC
Q ss_conf             4999978897889999999-649859996136----------------70878999999999755-----9989997863
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------DIDLLKPKDFASFFLSF-----SPDVIINPAA   59 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------~~D~~~~~~~~~~l~~~-----~pd~Vih~Aa   59 (290)
                      .+|||||++=||.++++.| .+|.+|+...+.                ++|++|++++++++++.     +.|++||.|+
T Consensus         9 valVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiLVNNAG   88 (254)
T PRK06463          9 VALITGGSRGIGRAIAEKFLKEGAKVAILYNSSEDKAKELKEKGVETFKCDVSNRDQVRKAKEEIHKKLGRIDVLVNNAG   88 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             89994847789999999999889999996499789999998669889997389999999999999998299989998997


Q ss_pred             CCCC----CCCCCCCCEEEEECCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             4454----3223322102420122211000112----2333333445532111357554421111222211101245666
Q gi|254780921|r   60 YTAV----DKAEDEPEIAFSINAEGAGAIAKAA----DSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAG  131 (290)
Q Consensus        60 ~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~----~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~  131 (290)
                      +...    +..+.+.+..+++|+.++-.+++++    ++.+-++|.+||..   |....  .     .....|+.+|.+.
T Consensus        89 ~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~G~IVnisS~~---g~~~~--~-----~~~~~Y~asKaav  158 (254)
T PRK06463         89 IWYLMPFEEFDEEKYNRMLDVNLNGTIYTTYEFLPDLKEENGVIINIASNA---GIGTA--A-----EGTTFYAITKAGI  158 (254)
T ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEHH---HCCCC--C-----CCCHHHHHHHHHH
T ss_conf             789999155999999999999838999999999998876398699997575---42878--8-----7617889999999


Q ss_pred             HHHHCCCCC
Q ss_conf             653101222
Q gi|254780921|r  132 EEKVASYTN  140 (290)
Q Consensus       132 E~~v~~~~~  140 (290)
                      ..+.+..+.
T Consensus       159 ~~ltr~lA~  167 (254)
T PRK06463        159 IMLTKRLAF  167 (254)
T ss_pred             HHHHHHHHH
T ss_conf             999999999


No 136
>PRK08277 D-mannonate oxidoreductase; Provisional
Probab=99.23  E-value=1.4e-11  Score=84.44  Aligned_cols=128  Identities=19%  Similarity=0.180  Sum_probs=91.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++-||.++++.| .+|.+|+.++|++                     +|++|++++++++++.     ++|++
T Consensus        12 valVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~~~~~~~~~G~iDiL   91 (278)
T PRK08277         12 VAVITGGGGVLGGAMAKELARAGAKVAILDRNQEKAEAVVEEIKANGGEAIALKADVLDKESLEQARQQILKDFGRCDIL   91 (278)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995867489999999999879989999798899999999998459909999824899999999999999984998889


Q ss_pred             EECCCCCCC-------------------CCCCCCCCEEEEECCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCC
Q ss_conf             978634454-------------------3223322102420122211000112----233-3333445532111357554
Q gi|254780921|r   55 INPAAYTAV-------------------DKAEDEPEIAFSINAEGAGAIAKAA----DSI-GIPCIYISTDYVFDGLSRT  110 (290)
Q Consensus        55 ih~Aa~~~~-------------------~~~e~~~~~~~~~Nv~~~~~l~~~~----~~~-~~~~I~iSS~~Vy~g~~~~  110 (290)
                      ||+|+...+                   |..+.+.+..+++|+.++-.+++++    .+. +-++|.+||..-+.+   .
T Consensus        92 VNnAG~~~p~~~~~~~~~~~~~~~~~~~d~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IInisS~~~~~~---~  168 (278)
T PRK08277         92 INGAGGNHPGATTDNEFHELPPETKTFFDLDEDGFEFVFDLNLLGTLLPTQVFAKDMIEQKGGNIINISSMNAFTP---L  168 (278)
T ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---C
T ss_conf             9889876766632332122454557631199999999999975999999999999998769965999813664778---8


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             421111222211101245666653101222
Q gi|254780921|r  111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       111 p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~  140 (290)
                        .      ....|+.+|.+...+.+..+.
T Consensus       169 --~------~~~~Y~asKaav~~lTk~lA~  190 (278)
T PRK08277        169 --T------KVPAYSAAKAAISNFTQWLAV  190 (278)
T ss_pred             --C------CCHHHHHHHHHHHHHHHHHHH
T ss_conf             --9------865579999999999999999


No 137
>PRK09135 pteridine reductase; Provisional
Probab=99.23  E-value=2.2e-11  Score=83.34  Aligned_cols=175  Identities=16%  Similarity=0.131  Sum_probs=109.0

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH-----------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             999978897889999999-649859996136-----------------------70878999999999755-----9989
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-----------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-----------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      +|||||++-||.++++.| .+|.+|+...++                       ++|++|.+++++++++.     +.|+
T Consensus         9 alVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~~l~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~iDi   88 (249)
T PRK09135          9 ALITGGARRIGAAIARTLHAAGYRVAVHYHRSAAEADALAAELNRLRPGSAAALQADLLDPDALEQLVAAAVAAFGRLDA   88 (249)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCE
T ss_conf             99968875899999999998799899981898799999999998505981899981699999999999999998399989


Q ss_pred             EEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             9978634454----32233221024201222110001122----333333445532111357554421111222211101
Q gi|254780921|r   54 IINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        54 Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      +||+|+....    +..+.+.+..+++|+.++-.+++++.    +.+-++|.+||...+.     |..      ....|+
T Consensus        89 LVNNAg~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~G~IInisS~~~~~-----~~~------~~~~Y~  157 (249)
T PRK09135         89 LVNNASSFYPTPLGEITEAQWDDLFASNAKAPFFLSQAAAPQLRKQRGAIVNITDIHAER-----PLK------NYPVYC  157 (249)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCC-----CCC------CCHHHH
T ss_conf             998998899998155999999999998339999999999999874788789998712277-----889------856789


Q ss_pred             HHHHHHHHHHCCCCC---CCCCCCCC-----CCEECCCCC-CCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             245666653101222---32235554-----200036863-200020112466521530455454452236899999999
Q gi|254780921|r  126 KSKLAGEEKVASYTN---NYVILRTA-----WVYSIFGSN-FLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIA  196 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~---~~~IlR~~-----~vyG~~~~~-~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~  196 (290)
                      .+|.+.+.+.+..+.   +.  +|..     .+..|.... +.....+....+.++       +.+-..+|+|+++..|+
T Consensus       158 asKaal~~ltr~lA~ela~~--IrVNaVaPG~i~t~~~~~~~~~~~~~~~~~~~Pl-------~R~g~pediA~~v~fLa  228 (249)
T PRK09135        158 AAKAALEMLTRSLALELAPE--VRVNAVAPGAILWPENDQGLDAEARQAILARTPL-------KRIGTPEDIAEAVLFLL  228 (249)
T ss_pred             HHHHHHHHHHHHHHHHHCCC--CEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCC-------CCCCCHHHHHHHHHHHH
T ss_conf             99999999999999997799--8899993077367763344999999999857999-------99819999999999996


Q ss_pred             H
Q ss_conf             8
Q gi|254780921|r  197 H  197 (290)
Q Consensus       197 ~  197 (290)
                      .
T Consensus       229 s  229 (249)
T PRK09135        229 E  229 (249)
T ss_pred             C
T ss_conf             5


No 138
>PRK08264 short chain dehydrogenase; Validated
Probab=99.23  E-value=2e-11  Score=83.59  Aligned_cols=127  Identities=20%  Similarity=0.236  Sum_probs=89.9

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCE-EEEECHH------------HCCCCCHHHHHHHHHHC-CCCEEEECCCCCCCCC-
Q ss_conf             4999978897889999999-64985-9996136------------70878999999999755-9989997863445432-
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVE-IIRVGRP------------DIDLLKPKDFASFFLSF-SPDVIINPAAYTAVDK-   65 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~-v~~~~r~------------~~D~~~~~~~~~~l~~~-~pd~Vih~Aa~~~~~~-   65 (290)
                      .+||||+++=||.++++.| .+|.. |+...|+            ++|++|+++++++.+.. ++|++||+||+..... 
T Consensus         7 ~alITGassGIG~aiA~~la~~Ga~~V~~~~r~~~~~~~~~~~~~~~Dv~d~~~v~~~~~~~~~idvlVnNAGi~~~~~~   86 (235)
T PRK08264          7 VVLVTGANRGIGRAFVEELLARGAAKVYAAARDPESVDLPRVVPLQLDVTDPASVAAAAEQASDVTILINNAGISRPGSL   86 (235)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCHHHCCCCCEEEEEECCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCC
T ss_conf             89992675499999999999869977999727840355598799980689999999999973998699988855778986


Q ss_pred             -CC---CCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             -23---3221024201222110001122----333-33344553211135755442111122221110124566665310
Q gi|254780921|r   66 -AE---DEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVA  136 (290)
Q Consensus        66 -~e---~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~  136 (290)
                       .+   .+.+..+++|+.++.++++.+.    +.+ .++|++||..-+   ...|        ....|+.||.+.+.+.+
T Consensus        87 ~~~~~~~~~~~~~~vNl~g~~~l~~~~~p~m~~~~~G~IvnisS~~g~---~~~p--------~~~~Y~aSKaal~~~~~  155 (235)
T PRK08264         87 LAEGDLDALRAEMETNVFGPLRMARAFAPVLAANGGGAIVNVLSVLSW---VNFP--------NLGAYSASKAAAWSLTQ  155 (235)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHC---CCCC--------CCHHHHHHHHHHHHHHH
T ss_conf             455999999999999729999999872699985799859999275444---8999--------97679999999999999


Q ss_pred             CCC
Q ss_conf             122
Q gi|254780921|r  137 SYT  139 (290)
Q Consensus       137 ~~~  139 (290)
                      ...
T Consensus       156 ~La  158 (235)
T PRK08264        156 ALR  158 (235)
T ss_pred             HHH
T ss_conf             999


No 139
>PRK06841 short chain dehydrogenase; Provisional
Probab=99.23  E-value=1.2e-11  Score=84.86  Aligned_cols=128  Identities=14%  Similarity=0.180  Sum_probs=95.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEEEC
Q ss_conf             4999978897889999999-6498599961367------------------0878999999999755-----99899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vih~   57 (290)
                      .+|||||++=||.++++.| .+|.+|+.++|++                  +|++|++++++++++.     +.|++||+
T Consensus        17 valVTGas~GIG~aiA~~la~~Ga~V~i~d~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~g~iDiLVNN   96 (255)
T PRK06841         17 VAVVTGGASGIGHAIAELFAAKGARVALLDRSEDVAEVAAQLLGGNAKGLVCDVSDSQSVEAAVAAAISAFGRIDILVNS   96 (255)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             99997967789999999999879999999698789999998459966999984699999999999999981998799989


Q ss_pred             CCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             6344543----2233221024201222110001122----333-333445532111357554421111222211101245
Q gi|254780921|r   58 AAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        58 Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
                      |++....    ..+.+.+..+++|+.++-.+++++.    +.+ -++|.+||..-+-|   .|        ....|+.+|
T Consensus        97 AGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~m~~~~~G~IInisS~~~~~~---~~--------~~~~Y~asK  165 (255)
T PRK06841         97 AGVALLAPAEDVSEADWDKTIDINLKGSFLMAQAVGRHMIAAGGGKIVNLASQAGVVA---LE--------RHVAYCASK  165 (255)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCC---CC--------CCHHHHHHH
T ss_conf             9789999804499999999999855999999999999999829965999946665668---99--------858899999


Q ss_pred             HHHHHHHCCCCC
Q ss_conf             666653101222
Q gi|254780921|r  129 LAGEEKVASYTN  140 (290)
Q Consensus       129 ~~~E~~v~~~~~  140 (290)
                      .+...+.+..+.
T Consensus       166 aav~~ltrslA~  177 (255)
T PRK06841        166 AGVVGMTKVLAL  177 (255)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 140
>PRK07069 short chain dehydrogenase; Validated
Probab=99.23  E-value=1e-11  Score=85.13  Aligned_cols=127  Identities=18%  Similarity=0.182  Sum_probs=93.1

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH------------------------HCCCCCHHHHHHHHHH-----CCC
Q ss_conf             4999978897889999999-649859996136------------------------7087899999999975-----599
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP------------------------DIDLLKPKDFASFFLS-----FSP   51 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~------------------------~~D~~~~~~~~~~l~~-----~~p   51 (290)
                      |.|||||++=||.++++.| .+|.+|+..+++                        ++|++|.++++.++++     -+.
T Consensus         1 ~AlVTGgs~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~l~~~~~~~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~i   80 (251)
T PRK07069          1 RAFITGAAGGLGRAIARRMAEQGARVFLTDINDAAALDAFAAEINAAHGEGVAFAAVQDVTDEAQWQALLAQAADAMGGL   80 (251)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             97998557889999999999869999999689435899999999861599639999577999999999999999982999


Q ss_pred             CEEEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             899978634454----32233221024201222110001122----333-333445532111357554421111222211
Q gi|254780921|r   52 DVIINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLN  122 (290)
Q Consensus        52 d~Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~  122 (290)
                      |++||.|++...    +..+.+.+..+++|+.++-.+++++.    +.+ -++|.+||-.-+-+   .|   .     ..
T Consensus        81 DilVNnAGi~~~~~~~~~~~~~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~~~~~---~~---~-----~~  149 (251)
T PRK07069         81 SVLVNNAGVGSFGAIEQIELDEWRRVMAINVESIVLGCKHALPYLRASQPASIVNISSVAAFKA---EP---D-----YT  149 (251)
T ss_pred             CEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CC---C-----CH
T ss_conf             8999899999999903499999999999997899999999999999669978999286754577---99---9-----66


Q ss_pred             CCHHHHHHHHHHHCCCC
Q ss_conf             10124566665310122
Q gi|254780921|r  123 IYGKSKLAGEEKVASYT  139 (290)
Q Consensus       123 ~Yg~sK~~~E~~v~~~~  139 (290)
                      .|+.+|.....+.+..+
T Consensus       150 ~Y~asKaal~~ltk~lA  166 (251)
T PRK07069        150 AYNASKAAVASLTKSIA  166 (251)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             89999999999999999


No 141
>PRK12938 acetyacetyl-CoA reductase; Provisional
Probab=99.23  E-value=1.9e-11  Score=83.60  Aligned_cols=127  Identities=17%  Similarity=0.096  Sum_probs=91.4

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEE-CHH---------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             999978897889999999-649859996-136---------------------70878999999999755-----99899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRV-GRP---------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~-~r~---------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      +|||||++=||.++++.| .+|++|+.. .++                     ++|++|+++++.++++.     ++|++
T Consensus         6 alVTGgs~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~i~~~~g~idiL   85 (246)
T PRK12938          6 AYVTGGMGGIGTSICQRLHKDGFKVVAGCGPNSPRRVKWLEDQKALGFDFIASEGNVGDWDSTKAAFDKVKAEVGEIDVL   85 (246)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99918586999999999998799899947998178999999998459978999678799999999999999975999899


Q ss_pred             EECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             97863445432----233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||.|++.....    .+.+.+..+++|+.++-++++.+.    +.+ -++|.+||...+.|   .|        ....|+
T Consensus        86 VNNAG~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m~~~~~G~IVnisS~~~~~~---~~--------~~~~Y~  154 (246)
T PRK12938         86 VNNAGITRDVVFRKMTREDWTAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNGQKG---QF--------GQTNYS  154 (246)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEHHHCCC---CC--------CCHHHH
T ss_conf             9898889998803499999999999985639999999998610328818999833664668---88--------863779


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+.+.+.+.++.
T Consensus       155 asKaal~~ltk~lA~  169 (246)
T PRK12938        155 TAKAGIHGFTMSLAQ  169 (246)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 142
>PRK06924 short chain dehydrogenase; Provisional
Probab=99.23  E-value=7.7e-12  Score=85.86  Aligned_cols=128  Identities=16%  Similarity=0.188  Sum_probs=87.3

Q ss_pred             CE-EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------------CCCCCHHHHHHHHHHC---------C
Q ss_conf             94-999978897889999999-6498599961367-------------------0878999999999755---------9
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------------IDLLKPKDFASFFLSF---------S   50 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------------~D~~~~~~~~~~l~~~---------~   50 (290)
                      || +|||||++=||.++++.| .+|++|+.++|++                   +|++|.+.+++.++..         .
T Consensus         1 MK~alITGas~GIG~aiA~~la~~G~~V~~~~r~~~~~~~~~~~~~~~~~~~~~~Dv~d~~~~~~~~~~~~~~~~~~~~~   80 (251)
T PRK06924          1 MRYVIITGTSKGLGEAIATQLLEKGTSVISISRRENKELTKLAEQYNSNLTFHSLDLQDLHNLETNFNEILSSIQEDDVS   80 (251)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999929874999999999998799999997982278999998746893699997058999999999999986431568


Q ss_pred             CCEEEECCCCCCC-C----CCCCCCCEEEEECCCCCCCCCCCCC----C-C-CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9899978634454-3----2233221024201222110001122----3-3-3333445532111357554421111222
Q gi|254780921|r   51 PDVIINPAAYTAV-D----KAEDEPEIAFSINAEGAGAIAKAAD----S-I-GIPCIYISTDYVFDGLSRTPIDEFSPTN  119 (290)
Q Consensus        51 pd~Vih~Aa~~~~-~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~-~-~~~~I~iSS~~Vy~g~~~~p~~E~d~~~  119 (290)
                      .+.+||.||+..+ +    ....+.+..+++|+.++..+++.+.    + . +.++|.+||..-.     .|+.      
T Consensus        81 ~i~LVnNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~~~l~~~~~~~~~~~~~~g~IvnisS~a~~-----~~~~------  149 (251)
T PRK06924         81 SIHLINNAGMVAPIKPAEKAESEQLITHVHINLLAPMILTSTFMKHTKDWKVDKRVINISSGAAK-----NPYF------  149 (251)
T ss_pred             CEEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHC-----CCCC------
T ss_conf             64899548764556862119999999999876099999999999999984799854999724325-----8999------


Q ss_pred             CCCCCHHHHHHHHHHHCCCC
Q ss_conf             21110124566665310122
Q gi|254780921|r  120 PLNIYGKSKLAGEEKVASYT  139 (290)
Q Consensus       120 P~~~Yg~sK~~~E~~v~~~~  139 (290)
                      ..+.|+.||.+-+.+.+..+
T Consensus       150 ~~~~Y~aSKaal~~ltk~lA  169 (251)
T PRK06924        150 GWSAYCSSKAGLNMFTQTVA  169 (251)
T ss_pred             CCHHHHHHHHHHHHHHHHHH
T ss_conf             97699999999999999999


No 143
>PRK06196 oxidoreductase; Provisional
Probab=99.22  E-value=3.7e-11  Score=82.02  Aligned_cols=139  Identities=18%  Similarity=0.140  Sum_probs=95.4

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-----------------CCCCCHHHHHHHHHH-----CCCCEEEECC
Q ss_conf             4999978897889999999-6498599961367-----------------087899999999975-----5998999786
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-----------------IDLLKPKDFASFFLS-----FSPDVIINPA   58 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-----------------~D~~~~~~~~~~l~~-----~~pd~Vih~A   58 (290)
                      .++|||+++=||.+.++.| ..|.+|+...|+.                 +|+.|.++++++.++     .+.|++||.|
T Consensus        28 ~~vITGa~sGIG~~tA~~La~~Ga~Vil~~R~~~k~~~a~~~i~~~~~~~lDLs~~~sVr~~a~~~~~~~~~lDvLInNA  107 (316)
T PRK06196         28 TAIVTGGYSGLGLETTRALAQAGAHVVVPARRPDAAREALAGIDGVEVVALDLADLASVRAFAERFLDSGRRIDILINNA  107 (316)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             89991799679999999999789989999499999999998741785798368899999999999997579832999578


Q ss_pred             CCCCCCC--CCCCCCEEEEECCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCHHHHHH
Q ss_conf             3445432--2332210242012221100011----2233-333344553211135755-442111122221110124566
Q gi|254780921|r   59 AYTAVDK--AEDEPEIAFSINAEGAGAIAKA----ADSI-GIPCIYISTDYVFDGLSR-TPIDEFSPTNPLNIYGKSKLA  130 (290)
Q Consensus        59 a~~~~~~--~e~~~~~~~~~Nv~~~~~l~~~----~~~~-~~~~I~iSS~~Vy~g~~~-~p~~E~d~~~P~~~Yg~sK~~  130 (290)
                      |......  .+...+..+.+|..|+-.|.+.    .++. +.|+|.+||..-.-+.-+ ....-....+|...|+.||++
T Consensus       108 Gi~~~~~~~t~dG~E~~~~vN~lg~flLt~lLlp~L~~~~~~RIV~vSS~~h~~~~i~~~d~~~~~~y~~~~aY~~SKla  187 (316)
T PRK06196        108 GVMACPETRVGDGWEAQFATNHLGHFALVNLLWPALAAGAGARVVAVSSLGHRRSPIRWDDVHFERGYDKWLAYGQSKTA  187 (316)
T ss_pred             CCCCCCCEEECCCHHHHHHHHHCCHHHHHHHHHHHHHCCCCCEEEEEECHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             76788753534555776655412287899998899753689779997137764388764454656789827999998999


Q ss_pred             HHHHHCCCCC
Q ss_conf             6653101222
Q gi|254780921|r  131 GEEKVASYTN  140 (290)
Q Consensus       131 ~E~~v~~~~~  140 (290)
                      .-.+.+++..
T Consensus       188 nilft~~La~  197 (316)
T PRK06196        188 NALFAVHLDK  197 (316)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999999


No 144
>PRK07831 short chain dehydrogenase; Provisional
Probab=99.22  E-value=5.1e-11  Score=81.25  Aligned_cols=128  Identities=13%  Similarity=0.107  Sum_probs=94.2

Q ss_pred             EEEEECCCC-HHHHHHHHHH-HCCCEEEEECHHH-----------------------CCCCCHHHHHHHHHHC-----CC
Q ss_conf             499997889-7889999999-6498599961367-----------------------0878999999999755-----99
Q gi|254780921|r    2 KCLVIGNNG-QIAQSLSSMC-VQDVEIIRVGRPD-----------------------IDLLKPKDFASFFLSF-----SP   51 (290)
Q Consensus         2 kiLVtG~~G-~iG~~l~~~l-~~~~~v~~~~r~~-----------------------~D~~~~~~~~~~l~~~-----~p   51 (290)
                      ++|||||+| =||.++++.| .+|.+|+.+++++                       +|++|++++++++++.     +.
T Consensus        18 valVTGgsg~GIG~a~a~~la~~Ga~V~i~d~~~~~~~e~~~~~~~~~g~~~v~~~~~Dvt~~~~v~~~v~~~~~~~G~i   97 (261)
T PRK07831         18 VVVVTAAAGTGIGSATARRALEEGADVVISDIHERRLGETADELAAELGLGRVEGVVCDVTSEAQVDALIDAAVERLGRL   97 (261)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             49994999647899999999987998999808777789999999984387728999756899999999999999982998


Q ss_pred             CEEEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             899978634454----32233221024201222110001122----333--33344553211135755442111122221
Q gi|254780921|r   52 DVIINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG--IPCIYISTDYVFDGLSRTPIDEFSPTNPL  121 (290)
Q Consensus        52 d~Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~--~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~  121 (290)
                      |++||.|++...    +..+.+.+..+++|+.++.++++++.    +.+  -++|.+||..-+-+   .        .+.
T Consensus        98 DiLVNNAG~~~~~~~~e~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~gG~IinisS~~~~~~---~--------~~~  166 (261)
T PRK07831         98 DVLVNNAGLGGQTPVVDMTDDEWSRVLDVTLTGTFRATRAALRYMRAAPHGGVIVNNASVLGWRA---Q--------HSQ  166 (261)
T ss_pred             CEEEECCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCC---C--------CCC
T ss_conf             69998886689988144999999998613215199999999999997699978984544030567---8--------874


Q ss_pred             CCCHHHHHHHHHHHCCCCC
Q ss_conf             1101245666653101222
Q gi|254780921|r  122 NIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       122 ~~Yg~sK~~~E~~v~~~~~  140 (290)
                      ..|+.+|.+...+.+..+.
T Consensus       167 ~~Y~asKaav~~lTk~lA~  185 (261)
T PRK07831        167 AHYAAAKAGVMALTRCSAI  185 (261)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             3689999999999999999


No 145
>PRK12937 short chain dehydrogenase; Provisional
Probab=99.22  E-value=2.2e-11  Score=83.30  Aligned_cols=128  Identities=20%  Similarity=0.215  Sum_probs=94.0

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             999978897889999999-649859996136----------------------70878999999999755-----99899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      +|||||++=||.++++.| .+|.+|+...+.                      ++|++|.+.+++++++.     ++|++
T Consensus         8 alVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~v~~~~~~~g~iDil   87 (245)
T PRK12937          8 AIVTGASRGIGAAIARRLAADGFAVAVNYAGSAAMADELVEEIEAAGGRAIAVQADVADAAAVDRLFEAAETAFGRIDVL   87 (245)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99948577899999999998799999976998689999999999659958999837899999999999999981998899


Q ss_pred             EECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             978634454----322332210242012221100011223---3333344553211135755442111122221110124
Q gi|254780921|r   55 INPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKS  127 (290)
Q Consensus        55 ih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~s  127 (290)
                      ||.|+....    +..+.+.+..+++|+.++-.+++.+..   .+-++|.+||...+-   ..|        ....|+.+
T Consensus        88 VnNAg~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m~~~G~IInisS~~~~~---~~~--------~~~~Y~as  156 (245)
T PRK12937         88 VNSAGIMPLAPIADGDLEGFDRTIAVNLRGAFNVLGEAARHLRRGGRIINLSTSVIAR---ALP--------GYGPYAAS  156 (245)
T ss_pred             EEECCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECHHCC---CCC--------CCHHHHHH
T ss_conf             9805489998813499999999999985999999999999997288299997300057---899--------94889999


Q ss_pred             HHHHHHHHCCCCCC
Q ss_conf             56666531012223
Q gi|254780921|r  128 KLAGEEKVASYTNN  141 (290)
Q Consensus       128 K~~~E~~v~~~~~~  141 (290)
                      |.+.+.+.+..+..
T Consensus       157 Kaav~~ltk~lA~e  170 (245)
T PRK12937        157 KAAVEGLVHVLANE  170 (245)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999


No 146
>PRK07097 gluconate 5-dehydrogenase; Provisional
Probab=99.21  E-value=1.8e-11  Score=83.73  Aligned_cols=129  Identities=13%  Similarity=0.124  Sum_probs=96.0

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++=||.++++.| .+|.+|+.++|++                     +|++|.+++++++++.     ++|++
T Consensus        12 ~alVTG~s~GIG~aiA~~la~~Ga~Vii~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~g~iDiL   91 (265)
T PRK07097         12 IALITGASYGIGFAIAKAYAEAGATIVFNDIKQELVDKGLAAYRELGIEAHGYVCDVTDEDGIQAMVAQIEKEVGVIDIL   91 (265)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             89995857689999999999869999999599899999999999549917999932899999999999999982999899


Q ss_pred             EECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             978634454----32233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||.|+....    +..+.+.+..+++|+.++-.+++++.    +.+ -++|++||..-+-|   .|        -...|+
T Consensus        92 VnNAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IVnisS~~~~~~---~~--------~~~~Y~  160 (265)
T PRK07097         92 VNNAGIIRRIPMLEMSAEDFRQVIDIDLNAPFIVSKAVLPSMIKKGHGKIINICSMMSELG---RE--------TVSAYA  160 (265)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHCCC---CC--------CCHHHH
T ss_conf             9899899998826599999999999860728999999999899808975999905211567---88--------866899


Q ss_pred             HHHHHHHHHHCCCCCC
Q ss_conf             2456666531012223
Q gi|254780921|r  126 KSKLAGEEKVASYTNN  141 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~~  141 (290)
                      .+|.+...+.+..+..
T Consensus       161 asKaav~~ltr~lA~e  176 (265)
T PRK07097        161 AAKGGLKMLTKNIASE  176 (265)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999


No 147
>PRK06949 short chain dehydrogenase; Provisional
Probab=99.21  E-value=1.3e-11  Score=84.50  Aligned_cols=129  Identities=17%  Similarity=0.219  Sum_probs=94.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+||||+++=||.++++.| .+|.+|+.++|++                     +|++|+++++.+++..     ++|++
T Consensus        11 valVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iDiL   90 (258)
T PRK06949         11 VALVTGASSGLGQRFAQVLSQAGAKVVLASRRVERLKELRAEIEAEGGAAHVVSLDVTDYQSIKAAVAHAETEAGTIDIL   90 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995857799999999999879999999698899999999999659928999826899999999999999984999899


Q ss_pred             EECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCCC-------------CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             978634454----322332210242012221100011223-------------333334455321113575544211112
Q gi|254780921|r   55 INPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAADS-------------IGIPCIYISTDYVFDGLSRTPIDEFSP  117 (290)
Q Consensus        55 ih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~~-------------~~~~~I~iSS~~Vy~g~~~~p~~E~d~  117 (290)
                      ||+|++...    +..+.+.+..+++|+.++-.+++.+..             .+-++|++||..-+   ...|      
T Consensus        91 VnnAG~~~~~~~~~~~~~~~~~~~~vNl~g~~~~~~~~~~~mi~~~~~~~~~~~~G~IVni~S~~~~---~~~~------  161 (258)
T PRK06949         91 VNNSGVSTTQKLVDVTPADFEFVFDTNTRGAFFVAQEVAKRMIARAKGAGNAKPQCRIINIASVAGL---RVLP------  161 (258)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCHHHC---CCCC------
T ss_conf             9899889998926599999999999870999999999999999845799888898399998355547---6899------


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             222111012456666531012223
Q gi|254780921|r  118 TNPLNIYGKSKLAGEEKVASYTNN  141 (290)
Q Consensus       118 ~~P~~~Yg~sK~~~E~~v~~~~~~  141 (290)
                        ....|+.+|.+...+.+..+..
T Consensus       162 --~~~~Y~asKaav~~ltr~lA~e  183 (258)
T PRK06949        162 --QIGLYCMSKAAVVHMTRAMALE  183 (258)
T ss_pred             --CCHHHHHHHHHHHHHHHHHHHH
T ss_conf             --8389999999999999999999


No 148
>PRK05854 short chain dehydrogenase; Provisional
Probab=99.21  E-value=6.1e-11  Score=80.80  Aligned_cols=138  Identities=19%  Similarity=0.140  Sum_probs=95.0

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH-----------------------HCCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             999978897889999999-649859996136-----------------------7087899999999975-----59989
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-----------------------DIDLLKPKDFASFFLS-----FSPDV   53 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-----------------------~~D~~~~~~~~~~l~~-----~~pd~   53 (290)
                      ++||||+.=||.+.++.| ..|.+|+...|+                       ++|+.|.++++++-+.     .+.|+
T Consensus        17 ~vITGa~sGIG~~~a~~La~~Ga~Vil~~R~~~k~~~a~~~i~~~~~~~~v~~~~lDLs~l~sVr~~a~~~~~~~~~lDi   96 (314)
T PRK05854         17 AVVTGASSGLGFGLARRLAAAGADVILPVRNRAKGEAAVAAIRTAVPDAKLTIRALDLSSLASVAALGEQLLAEGRPIHL   96 (314)
T ss_pred             EEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCCE
T ss_conf             99906882999999999997849899997999999999999998689985699964631689999999987530687527


Q ss_pred             EEECCCCCCC-C--CCCCCCCEEEEECCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCH
Q ss_conf             9978634454-3--22332210242012221100----0112233333344553211135755-4421111222211101
Q gi|254780921|r   54 IINPAAYTAV-D--KAEDEPEIAFSINAEGAGAI----AKAADSIGIPCIYISTDYVFDGLSR-TPIDEFSPTNPLNIYG  125 (290)
Q Consensus        54 Vih~Aa~~~~-~--~~e~~~~~~~~~Nv~~~~~l----~~~~~~~~~~~I~iSS~~Vy~g~~~-~p~~E~d~~~P~~~Yg  125 (290)
                      +||.||+-.+ .  ......+..+.+|..|+-.|    +...+..+.|+|.+||..-..+.-+ ....-+...+|...|+
T Consensus        97 LInNAGv~~~~~~~~T~dG~E~~f~vN~LghflLt~~Llp~l~~~~~RIV~vsS~~~~~~~i~~~dl~~~~~y~~~~aY~  176 (314)
T PRK05854         97 LINNAGVMTPPERQTTADGFELQFGTNHLGHFALTAHLLPLLRAGRARVTSQSSIAARRGRINFDDLNFERSYAPMTAYG  176 (314)
T ss_pred             EEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             87267666588654057763665553457788898877876325787056643420115776545688645688618888


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .||++.-.+.+++..
T Consensus       177 ~SKlanilf~~eLar  191 (314)
T PRK05854        177 QSKLAVLMFALELDR  191 (314)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999986


No 149
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.21  E-value=2.2e-11  Score=83.29  Aligned_cols=127  Identities=15%  Similarity=0.138  Sum_probs=91.6

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             999978897889999999-649859996136----------------------70878999999999755-----99899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      +|||||++=||.++++.| .+|++|+.++++                      ++|++|.+.+++++++.     +.|++
T Consensus         8 alVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~fg~iDiL   87 (259)
T PRK12745          8 ALVTGGRRGIGLGIALALAAGGFDLAINDRPDAEKLAATQQELRALGVEVIFFPADVADLSAHEATLDAAQDAWGRIDCL   87 (259)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99968678999999999998799899997986678999999998449948999846899999999999999982998899


Q ss_pred             EECCCCCCC------CCCCCCCCEEEEECCCCCCCCCCCCCCC-----------CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             978634454------3223322102420122211000112233-----------33334455321113575544211112
Q gi|254780921|r   55 INPAAYTAV------DKAEDEPEIAFSINAEGAGAIAKAADSI-----------GIPCIYISTDYVFDGLSRTPIDEFSP  117 (290)
Q Consensus        55 ih~Aa~~~~------~~~e~~~~~~~~~Nv~~~~~l~~~~~~~-----------~~~~I~iSS~~Vy~g~~~~p~~E~d~  117 (290)
                      ||.|++...      +..+.+.+..+++|+.++-.+++++...           +-.+|.+||..-+-   ..|      
T Consensus        88 VNNAG~~~~~~~~~~~~~~e~~~~~~~vNl~~~f~~~q~~~~~m~~~~~~~~~~~gsIInisS~~a~~---~~~------  158 (259)
T PRK12745         88 VNNAGVGVKKRGDLLDLTPESFDRCLAVNLRGTFFLTQAVAKRMLAQPKPEAELPRSIVTVSSVNAIM---LSP------  158 (259)
T ss_pred             EECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHCC---CCC------
T ss_conf             98475366889981019999999999997389999999999999965268889970899977876557---788------


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             22211101245666653101222
Q gi|254780921|r  118 TNPLNIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       118 ~~P~~~Yg~sK~~~E~~v~~~~~  140 (290)
                        ....|+.+|.+.+.+.+..+.
T Consensus       159 --~~~~Y~asKaal~~ltr~lA~  179 (259)
T PRK12745        159 --NRGEYCISKAGLSMAAQLFAL  179 (259)
T ss_pred             --CCHHHHHHHHHHHHHHHHHHH
T ss_conf             --847889999999999999999


No 150
>PRK12828 short chain dehydrogenase; Provisional
Probab=99.20  E-value=1.8e-11  Score=83.77  Aligned_cols=175  Identities=15%  Similarity=0.165  Sum_probs=112.0

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------------CCCCCHHHHHHHHHH-----CCCCEEEE
Q ss_conf             4999978897889999999-6498599961367-------------------087899999999975-----59989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------------IDLLKPKDFASFFLS-----FSPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------------~D~~~~~~~~~~l~~-----~~pd~Vih   56 (290)
                      .+|||||++=||.++++.| .+|.+|+.++|++                   +|++|++++++++++     -++|++||
T Consensus         9 valITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~~~~~v~~~~~~~G~iDilVn   88 (239)
T PRK12828          9 VVAITGGFGGLGRATAAWLAARGARVALIGRGAAPLSQTLPGVPADALRIGGIDLVDPQAARRAVDEVNRQFGRLDALVN   88 (239)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             89994725489999999999879989999798778999998751788569996079999999999999998399979998


Q ss_pred             CCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             86344543----2233221024201222110001122----333-33344553211135755442111122221110124
Q gi|254780921|r   57 PAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKS  127 (290)
Q Consensus        57 ~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~s  127 (290)
                      +|+.....    ..+.+.+..+++|+.++-.+++.+.    +.+ -++|.+||..-+-+   .|        ....|+.+
T Consensus        89 NAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IInisS~~~~~~---~~--------~~~~Y~as  157 (239)
T PRK12828         89 IAGAFVWGTIADGDADTWDRMYGVNVKTTLNASKAALPALTASGGGRIVNIGAGAALKA---GP--------GMGAYAAA  157 (239)
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCC---CC--------CCHHHHHH
T ss_conf             97789999904499999999999996999999999999998769986999977786777---99--------96899999


Q ss_pred             HHHHHHHHCCCCCCCC--CCCCCCCEECCCCCCCCE-EECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             5666653101222322--355542000368632000-2011246652153045545445223689999999984
Q gi|254780921|r  128 KLAGEEKVASYTNNYV--ILRTAWVYSIFGSNFLLS-MLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       128 K~~~E~~v~~~~~~~~--IlR~~~vyG~~~~~~v~~-~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      |.+...+.+..+..+.  =+|...| .|+   ++.+ +.+.......   + ..+   ...+|+|+++..++..
T Consensus       158 Kaal~~ltk~lA~e~~~~gIrVN~V-~PG---~v~T~~~~~~~~~~~---~-~r~---~~p~diA~~v~fL~Sd  220 (239)
T PRK12828        158 KAGVARLTEALAAELLDRGITVNAV-LPS---IIDTPPNRADMPDAD---F-SRW---VTPEQIAAVIAFLLSD  220 (239)
T ss_pred             HHHHHHHHHHHHHHHHHHCEEEEEE-EEC---CCCCCCHHCCCCHHH---C-CCC---CCHHHHHHHHHHHHCC
T ss_conf             9999999999999861309089999-738---788820024185646---1-798---9999999999999584


No 151
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=99.20  E-value=2.4e-11  Score=83.08  Aligned_cols=128  Identities=22%  Similarity=0.238  Sum_probs=96.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------------CCCCCHHHHHHHHHH-----CCCCEEEE
Q ss_conf             4999978897889999999-6498599961367-------------------087899999999975-----59989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------------IDLLKPKDFASFFLS-----FSPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------------~D~~~~~~~~~~l~~-----~~pd~Vih   56 (290)
                      .+|||||++=||.++++.| .+|.+|+.+++.+                   +|++|++++++++++     -++|++||
T Consensus        10 valVTGas~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iDilVN   89 (251)
T PRK12481         10 VAIITGCNTGLGQGMAIGLAKAGADIVGVGVAEAPETQAQVEALGRKFHFITADLIQQKDIDSIVSQAVEVMGHIDILIN   89 (251)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             89994867689999999999869999997898719999999975994799991279999999999999998199989998


Q ss_pred             CCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----C--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             8634454----32233221024201222110001122----3--333334455321113575544211112222111012
Q gi|254780921|r   57 PAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----S--IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        57 ~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~--~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      .|++...    +..+.+.+..+++|+.++-.+++.+.    +  .+-++|.+||..-+.|...           ...|+.
T Consensus        90 NAG~~~~~~~~~~~~~~w~~~~~vNl~~~~~~~q~~~~~m~~~~~~G~IVnisS~~~~~~~~~-----------~~~Y~a  158 (251)
T PRK12481         90 NAGIIRRQDLLEFGNKDWDDVININQKTVFFLSQAVAKQFVKQGNGGKIINIASMLSFQGGIR-----------VPSYTA  158 (251)
T ss_pred             CCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCC-----------CCHHHH
T ss_conf             998999999034999999999999837799999999999998569934874021333368898-----------714799


Q ss_pred             HHHHHHHHHCCCCC
Q ss_conf             45666653101222
Q gi|254780921|r  127 SKLAGEEKVASYTN  140 (290)
Q Consensus       127 sK~~~E~~v~~~~~  140 (290)
                      +|.+.+.+.+..+.
T Consensus       159 sKaav~~ltr~lA~  172 (251)
T PRK12481        159 SKSAVMGLTRALAT  172 (251)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999


No 152
>PRK06523 short chain dehydrogenase; Provisional
Probab=99.20  E-value=2.6e-11  Score=82.89  Aligned_cols=130  Identities=15%  Similarity=0.170  Sum_probs=94.5

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------CCCCCHHHHHHHHHHC-----CCCEEEECCCCCCC
Q ss_conf             4999978897889999999-6498599961367------------0878999999999755-----99899978634454
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------IDLLKPKDFASFFLSF-----SPDVIINPAAYTAV   63 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------~D~~~~~~~~~~l~~~-----~pd~Vih~Aa~~~~   63 (290)
                      ++|||||++=||.++++.| .+|.+|+.++|+.            +|++|++++++++++.     ++|++||.|+.+.+
T Consensus        11 ~alITG~s~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~~~~~Dv~~~~~v~~~v~~~~~~~g~iDiLVnNAG~~~~   90 (260)
T PRK06523         11 RALVTGGTKGIGAATVARFREAGARVVTTARSRPDDLPEGVEFVAADLTTAEGCAAVARAVLERLGGVDILVHVLGGSSA   90 (260)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCC
T ss_conf             89994757699999999999879999999488401379862899837999999999999999974999799989988767


Q ss_pred             ------CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             ------32233221024201222110001122----333-3334455321113575544211112222111012456666
Q gi|254780921|r   64 ------DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGE  132 (290)
Q Consensus        64 ------~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E  132 (290)
                            +..+.+.+..+++|+.++..+++++.    +.+ -++|++||..-.     .|..     .....|+.+|.+.+
T Consensus        91 ~~~~~~~~~~~~w~~~~~~Nl~~~~~~~q~~~p~m~~~~~G~IinisS~~~~-----~~~~-----~~~~~Y~asKaal~  160 (260)
T PRK06523         91 PAGGFAALTDEEWQDELNLNLLAAVRLDRALLPAMIARGSGVIIHVTSIQRR-----LPLP-----ESTTAYAAAKAALS  160 (260)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHC-----CCCC-----CCCHHHHHHHHHHH
T ss_conf             9988031999999999999849999999999999998399866999552214-----6888-----65088999999999


Q ss_pred             HHHCCCCCC
Q ss_conf             531012223
Q gi|254780921|r  133 EKVASYTNN  141 (290)
Q Consensus       133 ~~v~~~~~~  141 (290)
                      .+.+..+..
T Consensus       161 ~ltk~lA~e  169 (260)
T PRK06523        161 TYSKSLSKE  169 (260)
T ss_pred             HHHHHHHHH
T ss_conf             999999999


No 153
>PRK06138 short chain dehydrogenase; Provisional
Probab=99.19  E-value=2.5e-11  Score=83.01  Aligned_cols=127  Identities=17%  Similarity=0.157  Sum_probs=95.0

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHHC-----CCCEEEE
Q ss_conf             999978897889999999-6498599961367--------------------0878999999999755-----9989997
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLSF-----SPDVIIN   56 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~~-----~pd~Vih   56 (290)
                      +|||||++=||.++++.| .+|.+|+.++|++                    +|++|++++++++++.     +.|++||
T Consensus         8 alVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~iDiLVN   87 (252)
T PRK06138          8 AIVTGAGSGIGRATAKLFAREGARVVVADRDAEAAERVAAAIAAGGRAFARQGDVGSAEAVEALVDFVAARWGRLDVLVN   87 (252)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             99947467999999999998799899996887899999999837991999994289999999999999998299989998


Q ss_pred             CCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             8634454----32233221024201222110001122----333-33344553211135755442111122221110124
Q gi|254780921|r   57 PAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKS  127 (290)
Q Consensus        57 ~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~s  127 (290)
                      +|++...    +..+.+.+..+++|+.++-.+++++.    +.+ -++|.+||..-+-+   .|        ....|+.+
T Consensus        88 NAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IInisS~~~~~~---~~--------~~~~Y~as  156 (252)
T PRK06138         88 NAGFGCGGTVVTTDEADWDAVMRVNVGGVFLWAKYAIPIMQRQGGGSIVNTASQLALAG---GR--------GRAAYVAS  156 (252)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CC--------CCHHHHHH
T ss_conf             98899999801099999999999996999999999999999819967999765665778---99--------97789999


Q ss_pred             HHHHHHHHCCCCC
Q ss_conf             5666653101222
Q gi|254780921|r  128 KLAGEEKVASYTN  140 (290)
Q Consensus       128 K~~~E~~v~~~~~  140 (290)
                      |.+...+.+..+.
T Consensus       157 Kaav~~lTk~lA~  169 (252)
T PRK06138        157 KGAIASLTRAMAL  169 (252)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999999


No 154
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=99.19  E-value=2.4e-11  Score=83.06  Aligned_cols=128  Identities=19%  Similarity=0.241  Sum_probs=94.1

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH--------------------HCCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             4999978897889999999-649859996136--------------------70878999999999755-----998999
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP--------------------DIDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~--------------------~~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      .+|||||++=||.++++.| .+|.+|+..++.                    ++|++|++++++++++.     +.|++|
T Consensus        17 valVTGas~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~v~~~~~~~G~iDiLV   96 (258)
T PRK06935         17 VAIVTGGNTGLGQGYAVALAKAGADIIITTHGTNWDETRRLIEKEGRKVTFVQLDLTKKESAEAVVAEALEKFGKIDILV   96 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             89994857589999999999879999997299789999999996699379999048999999999999999749999999


Q ss_pred             ECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             78634454----3223322102420122211000112----2333-3334455321113575544211112222111012
Q gi|254780921|r   56 NPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAA----DSIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        56 h~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~----~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      |.|+....    +..+.+.+..+++|+.++-.+++++    .+.+ -++|.+||..-+-|   .|.        ...|+.
T Consensus        97 NNAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IInisS~~~~~g---~~~--------~~~Y~a  165 (258)
T PRK06935         97 NNAGTIRRAPLLEYKDEDWQAVIDINLNSVYHLSQAVAKVMAKQGSGKIINIASMLSFQG---GKF--------VPPYTA  165 (258)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHCCC---CCC--------CHHHHH
T ss_conf             899999999802399999999999864789999999999999838981899953201678---888--------766999


Q ss_pred             HHHHHHHHHCCCCC
Q ss_conf             45666653101222
Q gi|254780921|r  127 SKLAGEEKVASYTN  140 (290)
Q Consensus       127 sK~~~E~~v~~~~~  140 (290)
                      ||.+...+.+..+.
T Consensus       166 sKaav~~lTr~lA~  179 (258)
T PRK06935        166 SKHGVAGLTKAFAN  179 (258)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999


No 155
>PRK12743 acetoin dehydrogenase; Provisional
Probab=99.19  E-value=3.2e-11  Score=82.37  Aligned_cols=130  Identities=21%  Similarity=0.168  Sum_probs=92.2

Q ss_pred             CE--EEEECCCCHHHHHHHHHH-HCCCEEEEEC-HH---------------------HCCCCCHHHHHHHHHHC-----C
Q ss_conf             94--999978897889999999-6498599961-36---------------------70878999999999755-----9
Q gi|254780921|r    1 MK--CLVIGNNGQIAQSLSSMC-VQDVEIIRVG-RP---------------------DIDLLKPKDFASFFLSF-----S   50 (290)
Q Consensus         1 Mk--iLVtG~~G~iG~~l~~~l-~~~~~v~~~~-r~---------------------~~D~~~~~~~~~~l~~~-----~   50 (290)
                      |+  +|||||++=||+++++.| .+|.+|+... ++                     ++|++|+++++.++++.     +
T Consensus         1 M~KValITGgs~GIG~a~a~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~   80 (253)
T PRK12743          1 MAQVAIVTASDSGIGKACALLLAQQGFDIGITWHSDEEGAKETAEEVVSHGVRAEIVHLDLSNLPEGAQAIEKLIQRLGR   80 (253)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             99989990758899999999999879989997489979999999999945991899990489999999999999998199


Q ss_pred             CCEEEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9899978634454----32233221024201222110001122----33--33334455321113575544211112222
Q gi|254780921|r   51 PDVIINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SI--GIPCIYISTDYVFDGLSRTPIDEFSPTNP  120 (290)
Q Consensus        51 pd~Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~--~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P  120 (290)
                      .|++||+|+....    +..+.+.+..+++|+.++-.+++.+.    +.  +-++|++||...+-+   .|        .
T Consensus        81 iDilVNnAG~~~~~~~~~~~~~~w~~~~~vNl~~~f~~~~~~~~~m~k~~~~G~IVnisS~~~~~~---~~--------~  149 (253)
T PRK12743         81 LDVLVNNAGAMTKAPFLDMAFDEWRKIFTVDVDGAFLCSQIAARHMVKQGQGGRIINITSVHEHTP---LP--------D  149 (253)
T ss_pred             CCEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEHHHCCC---CC--------C
T ss_conf             989998998999998002999999999999859999999999999997589963899963665578---89--------8


Q ss_pred             CCCCHHHHHHHHHHHCCCCCC
Q ss_conf             111012456666531012223
Q gi|254780921|r  121 LNIYGKSKLAGEEKVASYTNN  141 (290)
Q Consensus       121 ~~~Yg~sK~~~E~~v~~~~~~  141 (290)
                      ...|+.+|...+.+.+..+..
T Consensus       150 ~~~Y~asKaal~~ltk~lA~e  170 (253)
T PRK12743        150 ASAYTAAKHALGGLTKAMALE  170 (253)
T ss_pred             CHHHHHHHHHHHHHHHHHHHH
T ss_conf             589999999999999999999


No 156
>PRK07063 short chain dehydrogenase; Provisional
Probab=99.19  E-value=2.6e-11  Score=82.85  Aligned_cols=128  Identities=15%  Similarity=0.143  Sum_probs=95.1

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------------CCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             4999978897889999999-6498599961367----------------------0878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------------IDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------------~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      .+|||||++=||.++++.| .+|.+|+.++|++                      +|++|++++++++++.     +.|+
T Consensus         9 valVTGa~~GIG~aiA~~~a~~Ga~V~i~~~~~~~~~~~~~~l~~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDi   88 (259)
T PRK07063          9 VALVTGAAQGIGAAIARAFVREGAAVALADLDAALAERAAAAIARQTGARVLALPADVTRAASVRAAVARAEAAFGPLDV   88 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89995878789999999999879989999798789999999998850991899983689999999999999998199889


Q ss_pred             EEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9978634454----32233221024201222110001122----333-33344553211135755442111122221110
Q gi|254780921|r   54 IINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        54 Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      +||.|+....    +..+.+.+..+++|+.++-.+++++.    +.+ -++|.+||..-+   ...|.        ...|
T Consensus        89 LVNNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~~~---~~~~~--------~~~Y  157 (259)
T PRK07063         89 LVNNAGINVFADPLAMTDEDWRRCFAVDLDGAWNCCRAVLPGMVERGRGSIVNIASTHAF---KIIPG--------CFPY  157 (259)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC---CCCCC--------CHHH
T ss_conf             998997789999044999999999987528899999999999998699669998776656---77999--------6679


Q ss_pred             HHHHHHHHHHHCCCCC
Q ss_conf             1245666653101222
Q gi|254780921|r  125 GKSKLAGEEKVASYTN  140 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~  140 (290)
                      +.+|.+...+.+..+.
T Consensus       158 ~asKaav~~lTr~lA~  173 (259)
T PRK07063        158 PVAKHGLLGLTRALGI  173 (259)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999


No 157
>PRK06484 short chain dehydrogenase; Validated
Probab=99.19  E-value=2.9e-11  Score=82.60  Aligned_cols=128  Identities=19%  Similarity=0.203  Sum_probs=94.4

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEEEC
Q ss_conf             4999978897889999999-6498599961367------------------0878999999999755-----99899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vih~   57 (290)
                      .+||||+++=||.++++.| .+|.+|+.++|++                  +|++|++++++++++.     +.|++||+
T Consensus         7 valVTGas~GIG~aiA~~la~~Ga~V~~~dr~~~~~~~~~~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G~iDiLVNN   86 (530)
T PRK06484          7 VVLVTGAAGGIGRACCQRFARAGDRVVMADRDLAACTEEAERLGSRHVALQLDVSDEAQVEHAMDGLLQQFGRIDVLVNN   86 (530)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             99997836689999999999879999999688899999999709971799984899999999999999972999899989


Q ss_pred             CCCCCC-----CCCCCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             634454-----32233221024201222110001122----333333445532111357554421111222211101245
Q gi|254780921|r   58 AAYTAV-----DKAEDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        58 Aa~~~~-----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
                      |++...     +..+.+.+..+++|+.++.++++++.    +.+..+|.+||..-+   ...|        ....|+.+|
T Consensus        87 AGi~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~p~m~~~gg~IInisS~~g~---~~~~--------~~~~Y~asK  155 (530)
T PRK06484         87 AGIGPTMRATLDTPLEDFDRAIAVNLEGPYLVAREALRLMGRHGAAIVNVASLAGL---VANP--------KRAAYSASK  155 (530)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCC---CCCC--------CCHHHHHHH
T ss_conf             98998898610099999999999872999999999999877625738999833104---5799--------968899999


Q ss_pred             HHHHHHHCCCCC
Q ss_conf             666653101222
Q gi|254780921|r  129 LAGEEKVASYTN  140 (290)
Q Consensus       129 ~~~E~~v~~~~~  140 (290)
                      .+...+.+..+.
T Consensus       156 aal~~lTkslA~  167 (530)
T PRK06484        156 AGVISLTRSLAC  167 (530)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 158
>PRK06172 short chain dehydrogenase; Provisional
Probab=99.19  E-value=3.1e-11  Score=82.49  Aligned_cols=127  Identities=17%  Similarity=0.179  Sum_probs=93.8

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             999978897889999999-6498599961367---------------------0878999999999755-----998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      +|||||++=||.++++.| .+|.+|+.++|++                     +|++|++++++++++.     +.|++|
T Consensus        10 alVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~iDiLV   89 (253)
T PRK06172         10 ALVTGGAAGIGRATAIAFAREGAKVVVADRDAAGGEETVALIREAGGEALFIACDVTRDAEVKALVEKTIAAYGRLDYAF   89 (253)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99937576899999999998799899997988999999999996499379998189999999999999999829999999


Q ss_pred             ECCCCCC-----CCCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             7863445-----432233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   56 NPAAYTA-----VDKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        56 h~Aa~~~-----~~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      |.|++..     .+..+.+.+..+++|+.++-.+++++.    +.+ -++|.+||..-+   ...|        ....|+
T Consensus        90 NNAGi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IVnisS~~g~---~~~~--------~~~~Y~  158 (253)
T PRK06172         90 NNAGIEIEQGRLAEGSEAEFDAIMGVNVKGVWLCMKYQIPLMLAQGGGAIVNTASVAGL---GAAP--------KMSIYA  158 (253)
T ss_pred             ECCCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHC---CCCC--------CCHHHH
T ss_conf             89888999999013999999999999739999999999999998599589997666647---6899--------977899


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+...+.+..+.
T Consensus       159 asKaal~~ltr~lA~  173 (253)
T PRK06172        159 ASKHAVIGLTKSAAI  173 (253)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 159
>PRK06346 consensus
Probab=99.19  E-value=3.3e-11  Score=82.32  Aligned_cols=127  Identities=15%  Similarity=0.173  Sum_probs=93.9

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             999978897889999999-6498599961367---------------------0878999999999755-----998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      ++||||++=||.++++.| .+|.+|+.++|++                     .|+++++++++++++.     +.|++|
T Consensus         8 ~lITGgs~GIG~a~a~~la~~Ga~V~i~~r~~e~~~~~~~~l~~~~~~~~~~~~Dv~~~~~v~~~i~~~~~~fg~iDiLV   87 (251)
T PRK06346          8 AIVTGAASGMGKSIAELFAKEGAKVVVADLNLERAQKVVEEITSNGGTAIAVVANVTKQEDIENMVDTAVDTYGTLDILV   87 (251)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99947578899999999998799899997989999999999996399089997788989999999999999829997999


Q ss_pred             ECCCCCCC-----CCCCCCCCEEEEECCCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             78634454-----322332210242012221100011223----33-333445532111357554421111222211101
Q gi|254780921|r   56 NPAAYTAV-----DKAEDEPEIAFSINAEGAGAIAKAADS----IG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        56 h~Aa~~~~-----~~~e~~~~~~~~~Nv~~~~~l~~~~~~----~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      |.|++...     +..+.+.+..+++|+.++.++++.+..    .+ -++|++||..-+.|   .|        ....|+
T Consensus        88 nNAgi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IInisS~~~~~~---~~--------~~~~Y~  156 (251)
T PRK06346         88 NNAGIMDNFVPVGELTDELWDKVFAVNTTGVMRATRKALPIFEEKGSGVIVNIASVGGLNG---SR--------AGAAYT  156 (251)
T ss_pred             ECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCC---CC--------CCHHHH
T ss_conf             8998899998711289999999999970999999999999999859954999945654788---98--------875899


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+...+.+..+.
T Consensus       157 asK~al~~ltr~lA~  171 (251)
T PRK06346        157 ASKHAVIGLTKNTGF  171 (251)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 160
>PRK08265 short chain dehydrogenase; Provisional
Probab=99.18  E-value=3e-11  Score=82.55  Aligned_cols=129  Identities=16%  Similarity=0.107  Sum_probs=95.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEEEC
Q ss_conf             4999978897889999999-6498599961367------------------0878999999999755-----99899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vih~   57 (290)
                      .+|||||++=||.++++.| .+|.+|+.++|++                  +|++|.++++++++..     +.|++||+
T Consensus         8 valVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~i~~~~~~~~~~fG~iDiLVNN   87 (261)
T PRK08265          8 VAIVTGGATLIGAAVARALVAAGACVAILDIDADNGAAVAASLGERARFIATDITDDAAIERAVATAVARFGGLDILVNL   87 (261)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             89994877689999999999879989999798899999999819972899813899999999999999981998789985


Q ss_pred             CCCCCCC---CCCCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             6344543---2233221024201222110001122----33333344553211135755442111122221110124566
Q gi|254780921|r   58 AAYTAVD---KAEDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLA  130 (290)
Q Consensus        58 Aa~~~~~---~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~  130 (290)
                      |+.....   ..+.+.+..+++|+.++..+++.+.    +.+-++|.+||-...-+   .|        +...|+.+|.+
T Consensus        88 Ag~~~~~~~~~~~e~w~~~~~vNl~~~~~~~q~~~~~m~~~~G~IInisS~~~~~~---~~--------~~~~Y~asKaa  156 (261)
T PRK08265         88 ACTYVDDGLASSRADWLAALDVNLVSAAMLAQAAHPHLKRGGGAIVNFTSISAKVA---QT--------GRWLYPASKAA  156 (261)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCC---CC--------CCCHHHHHHHH
T ss_conf             75578873439999999999998399999999999999876977999965330457---88--------85067999999


Q ss_pred             HHHHHCCCCCC
Q ss_conf             66531012223
Q gi|254780921|r  131 GEEKVASYTNN  141 (290)
Q Consensus       131 ~E~~v~~~~~~  141 (290)
                      .+.+.+..+..
T Consensus       157 l~~ltk~lA~e  167 (261)
T PRK08265        157 IRQLTRSMAMD  167 (261)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 161
>PRK08177 short chain dehydrogenase; Provisional
Probab=99.18  E-value=3.2e-11  Score=82.36  Aligned_cols=175  Identities=14%  Similarity=0.132  Sum_probs=109.5

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------CCCCCHHHHHHHHHH---CCCCEEEECCCCC
Q ss_conf             4999978897889999999-6498599961367----------------087899999999975---5998999786344
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------IDLLKPKDFASFFLS---FSPDVIINPAAYT   61 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------~D~~~~~~~~~~l~~---~~pd~Vih~Aa~~   61 (290)
                      ++||||++.=||.++++.| .+|++|+.+.|+.                +|+++.++++++++.   .+.|++||.|++.
T Consensus         3 ~~lITGas~GIG~aia~~l~~~G~~V~~~~R~~~~~~~~~~~~~~~~~~~D~~~~~~i~~~~~~~~~~~iDvlinNAGi~   82 (225)
T PRK08177          3 TALIIGASRGLGLGLVDRLLERGWQVTATVRGPQQDTALQALPGVHIERLDMNDPASLDQLLQRLQGQRFDLLFVNAGIS   82 (225)
T ss_pred             EEEECCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCC
T ss_conf             89992734299999999999886999999798877899872548728998458889999999996067788899878436


Q ss_pred             CCCC------CCCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             5432------233221024201222110001122----333333445532111357554421111222211101245666
Q gi|254780921|r   62 AVDK------AEDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAG  131 (290)
Q Consensus        62 ~~~~------~e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~  131 (290)
                      .+..      ...+....+.+|+.++..+++.+.    ....+++++||..   |.-..|..     .....|+.||.+.
T Consensus        83 ~~~~~~~~~~~~~~~~~~~~~N~~~~~~l~~~~~~~l~~~~g~iv~isS~~---g~~~~~~~-----~~~~~Y~aSKaAl  154 (225)
T PRK08177         83 GPAHQSAADATAAEIGQLFLTNAIAPIRLARRLLGQVRPGQGVLAFMSSQL---GSVELPDG-----GEMPLYKASKAAL  154 (225)
T ss_pred             CCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEE---EEECCCCC-----CCCHHHHHHHHHH
T ss_conf             767678465999999999999878999999999888631678775333013---32014898-----8636779999999


Q ss_pred             HHHHCCCCCCCC--CCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             653101222322--3555420003686320002011246652153045545445223689999999984420
Q gi|254780921|r  132 EEKVASYTNNYV--ILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIE  201 (290)
Q Consensus       132 E~~v~~~~~~~~--IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~  201 (290)
                      +.+.+..+..+-  =+|...| .|   +++.+=+.    +         ...|..+++-|+.++.+++.+..
T Consensus       155 ~~lt~sla~El~~~gI~Vn~i-~P---G~v~T~M~----~---------~~a~~~~e~~a~~~~~~i~~~~~  209 (225)
T PRK08177        155 NSMTRSFVAELGEPDLTVLSM-HP---GWVKTDMG----G---------DAAPLDVETSTKGLVEQIEAASG  209 (225)
T ss_pred             HHHHHHHHHHHCCCCEEEEEE-EE---CCCCCCCC----C---------CCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             999999999846578299999-71---88816999----9---------99997999999999999972798


No 162
>PRK08945 short chain dehydrogenase; Provisional
Probab=99.18  E-value=4.7e-11  Score=81.45  Aligned_cols=129  Identities=15%  Similarity=0.158  Sum_probs=89.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------------CCC--CCHHHHHHHHHH-----CCC
Q ss_conf             4999978897889999999-6498599961367----------------------087--899999999975-----599
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------------IDL--LKPKDFASFFLS-----FSP   51 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------------~D~--~~~~~~~~~l~~-----~~p   51 (290)
                      .+|||||++=||.++++.| .+|.+|+.++|++                      +|+  ++.+.++++++.     .+.
T Consensus        15 ~~lITGas~GIG~aiA~~la~~Ga~Vil~~r~~~~l~~~~~el~~~~~~~~~~~~~d~~~~~~~~~~~~~~~i~~~~g~i   94 (245)
T PRK08945         15 IILVTGAGDGIGREAALTYARHGATVILLGRTEEKLEAVYDEIEAAGGPQPAIIPLDLLGATEQNYQDLADTIEEQFGRL   94 (245)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             89994886189999999999879989999698899999999999747984489994467599999999999999980998


Q ss_pred             CEEEECCCCCCCC-----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             8999786344543-----2233221024201222110001122----333-33344553211135755442111122221
Q gi|254780921|r   52 DVIINPAAYTAVD-----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPL  121 (290)
Q Consensus        52 d~Vih~Aa~~~~~-----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~  121 (290)
                      |++||+||+....     ..+.+.+..+++|+.++..+++++.    +.+ .++|++||..-.   ...|        -.
T Consensus        95 D~lVnNAG~~~~~~~~~~~~~~~~~~~~~vNl~g~~~l~~~~~p~m~~~~~G~Ii~isS~~g~---~~~~--------~~  163 (245)
T PRK08945         95 DGVLHNAGLLGELGPMEQQDPEVWQDVMQVNVNATFMLTQALLPLLLKSPAASLVFTSSSVGR---QGRA--------FW  163 (245)
T ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC---CCCC--------CC
T ss_conf             799988875578988266999999998756759999999999999987799789997862106---7888--------86


Q ss_pred             CCCHHHHHHHHHHHCCCCCC
Q ss_conf             11012456666531012223
Q gi|254780921|r  122 NIYGKSKLAGEEKVASYTNN  141 (290)
Q Consensus       122 ~~Yg~sK~~~E~~v~~~~~~  141 (290)
                      +.|+.+|.+.+.+.+..+..
T Consensus       164 ~~Y~asKaal~~lt~~la~E  183 (245)
T PRK08945        164 GAYAVSKFATEGMMQVLADE  183 (245)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
T ss_conf             68999999999999999998


No 163
>PRK09134 short chain dehydrogenase; Provisional
Probab=99.18  E-value=4.2e-11  Score=81.69  Aligned_cols=176  Identities=12%  Similarity=0.057  Sum_probs=109.2

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEE-ECHH---------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             999978897889999999-64985999-6136---------------------70878999999999755-----99899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIR-VGRP---------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~-~~r~---------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      +||||+++-||.++++.| .+|++|+. ++++                     ++|++|.+++++++++.     ++|++
T Consensus        12 alVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~i~~~g~~~~~~~~Dl~~~~~~~~~v~~~~~~~G~iDiL   91 (256)
T PRK09134         12 ALVTGAARRIGRAIALDLAAHGFDVAVHYNRSRDEAEALAAEIRALGRRAVALQADLADEAQVRALVARASAALGPITLL   91 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99948867899999999998799899984999899999999999649918999755899999999999999982998789


Q ss_pred             EECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             9786344543----2233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||.|+....+    ..+.+.+..+++|+.++..+++.+.    +.+ .++|.+||..++.+...           ...|+
T Consensus        92 VnNAg~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~q~~~~~m~~~~~G~IVni~s~~~~~~~~~-----------~~~Y~  160 (256)
T PRK09134         92 VNNASLFEYDSAASFTRASWDRHMATNLRAPFVLAQAFARALPADARGLVVNMIDQRVWNLNPD-----------FLSYT  160 (256)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHCCCCCC-----------CHHHH
T ss_conf             9887116899702099999999975401059999999999988607806999800765478997-----------15169


Q ss_pred             HHHHHHHHHHCCCCCCCC-CCCCCCCEECC--CCCC--CCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             245666653101222322-35554200036--8632--000201124665215304554544522368999999998
Q gi|254780921|r  126 KSKLAGEEKVASYTNNYV-ILRTAWVYSIF--GSNF--LLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAH  197 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~~~~-IlR~~~vyG~~--~~~~--v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~  197 (290)
                      .+|.+.+.+.+..+..+- =+|...| .|+  ..+.  .....+...+..++    ..+   ...+|+|+++..++.
T Consensus       161 asKaal~~ltr~lA~ela~~IrVN~V-aPG~~~~~~~~~~~~~~~~~~~~pl----~R~---~~pediA~~v~fLas  229 (256)
T PRK09134        161 LSKAALWTATRTLAQALAPRIRVNAI-GPGPTLPSGRQSPEDFARQHAATPL----GRG---PNPEEIGAALRYLLD  229 (256)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEE-ECCCCCCCCCCCHHHHHHHHHCCCC----CCC---CCHHHHHHHHHHHHC
T ss_conf             99999999999999997799989999-4250056876799999999837998----899---699999999999974


No 164
>PRK07677 short chain dehydrogenase; Provisional
Probab=99.18  E-value=3.6e-11  Score=82.11  Aligned_cols=127  Identities=15%  Similarity=0.191  Sum_probs=93.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++-||.++++.| .+|.+|+.++|++                     +|++|++++++++++.     +.|++
T Consensus         5 ~alVTGgs~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~g~iDiL   84 (254)
T PRK07677          5 VVIITGGSSGMGKAMAKRFAEEGANVVITGRTKEKLEEAKLEIEQFPGQVLTVQMDVRNPDDVQKMIEQIDEKFGRIDAL   84 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995876789999999999879999999699999999999998569909999803899999999999999983998889


Q ss_pred             EECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCCC----C--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             978634454----322332210242012221100011223----3--333344553211135755442111122221110
Q gi|254780921|r   55 INPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAADS----I--GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        55 ih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~~----~--~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      ||.|+....    +..+.+.+..+++|+.++-++.+++..    .  +.++|.+||...+.     +.      .+...|
T Consensus        85 VnNAg~~~~~~~~~~t~~~~~~~~~vnl~g~~~~~~~~~~~m~~~~~~G~IInisS~~~~~-----~~------~~~~~y  153 (254)
T PRK07677         85 INNAAGNFICPAEDLSVNGWKSVIDIVLNGTFYCSQAVGKYWIEKGIKGNIINMVATYAWD-----AG------AGVIHS  153 (254)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC-----CC------CCCHHH
T ss_conf             9757557788826599999999999972318899999999999828995399995110056-----88------982889


Q ss_pred             HHHHHHHHHHHCCCC
Q ss_conf             124566665310122
Q gi|254780921|r  125 GKSKLAGEEKVASYT  139 (290)
Q Consensus       125 g~sK~~~E~~v~~~~  139 (290)
                      +.+|.+.+.+.+..+
T Consensus       154 ~asKaal~~ltk~lA  168 (254)
T PRK07677        154 AAAKAGVLAMTRTLA  168 (254)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 165
>PRK07814 short chain dehydrogenase; Provisional
Probab=99.18  E-value=3.1e-11  Score=82.50  Aligned_cols=127  Identities=19%  Similarity=0.205  Sum_probs=94.3

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++=||.++++.| .+|.+|+..+|++                     +|++|++++++++++.     +.|++
T Consensus        12 valITGgs~GIG~aia~~la~~Ga~V~i~~~~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iDiL   91 (263)
T PRK07814         12 VAVVTGAGRGLGAAIALAFAEAGADVLIAARTESQLDEVAEQIRAAGRRAHVVAADLAHPEATAGLAGQAVEAFGRLDIV   91 (263)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995896689999999999879989999698999999999998529928999815899999999999999982998899


Q ss_pred             EECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCCC-----C-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             978634454----322332210242012221100011223-----3-333344553211135755442111122221110
Q gi|254780921|r   55 INPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAADS-----I-GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        55 ih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~~-----~-~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      ||.||....    +..+.+.+..+++|+.++-.+++.+..     . +-++|.+||..-+   ...|        ....|
T Consensus        92 VnNAg~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~IInisS~~~~---~~~~--------~~~~Y  160 (263)
T PRK07814         92 VNNVGGTMPNPLLSTSTKDLADAFTFNVATAHALTRAAVPLMLEHSGGGSIINITSTMGR---LAGR--------GFAAY  160 (263)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHC---CCCC--------CCHHH
T ss_conf             989866788844548899999999997199999999999999984799469998126547---7899--------84889


Q ss_pred             HHHHHHHHHHHCCCC
Q ss_conf             124566665310122
Q gi|254780921|r  125 GKSKLAGEEKVASYT  139 (290)
Q Consensus       125 g~sK~~~E~~v~~~~  139 (290)
                      +.+|.+.+.+.+..+
T Consensus       161 ~asKaal~~ltk~lA  175 (263)
T PRK07814        161 GTAKAALAHYTRLAA  175 (263)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 166
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]
Probab=99.17  E-value=1.1e-10  Score=79.38  Aligned_cols=182  Identities=16%  Similarity=0.174  Sum_probs=112.5

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------------CCCCCHHHHHHHHHH----C-CCCEEEEC
Q ss_conf             999978897889999999-6498599961367-------------------087899999999975----5-99899978
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------------IDLLKPKDFASFFLS----F-SPDVIINP   57 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------------~D~~~~~~~~~~l~~----~-~pd~Vih~   57 (290)
                      +||||+++=||.+.++.| .+|++|+...|++                   +|++|.++++++++.    + +.|++||-
T Consensus         9 ~lITGASSGiG~A~A~~l~~~G~~vvl~aRR~drL~~la~~~~~~~~~~~~~DVtD~~~~~~~i~~~~~~~g~iDiLvNN   88 (246)
T COG4221           9 ALITGASSGIGEATARALAEAGAKVVLAARREERLEALADEIGAGAALALALDVTDRAAVEAAIEALPEEFGRIDILVNN   88 (246)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             99946865688999999997899699986368899999986256743789613678899999999999751760589966


Q ss_pred             CCCCCCCCC-C---CCCCEEEEECCCCCCCCCCCC----CCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             634454322-3---322102420122211000112----23333-33445532111357554421111222211101245
Q gi|254780921|r   58 AAYTAVDKA-E---DEPEIAFSINAEGAGAIAKAA----DSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        58 Aa~~~~~~~-e---~~~~~~~~~Nv~~~~~l~~~~----~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
                      |+....+.. +   .+.+.-+.+|+.|..+..++.    .+.+. .+|.+||-+   |  ..||.-      -+.|+.||
T Consensus        89 AGl~~g~~~~~~~~~dw~~Mid~Ni~G~l~~~~avLP~m~~r~~G~IiN~~SiA---G--~~~y~~------~~vY~ATK  157 (246)
T COG4221          89 AGLALGDPLDEADLDDWDRMIDTNVKGLLNGTRAVLPGMVERKSGHIINLGSIA---G--RYPYPG------GAVYGATK  157 (246)
T ss_pred             CCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCC---C--CCCCCC------CCCCHHHH
T ss_conf             877768703548999999999988899999998866688864796399953513---3--366799------86002369


Q ss_pred             HHHHHHHCCCCCCC--CCCCCCCCEECCCCCCC-CEEECCCCCCCCEEECCC--CCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             66665310122232--23555420003686320-002011246652153045--5454452236899999999844
Q gi|254780921|r  129 LAGEEKVASYTNNY--VILRTAWVYSIFGSNFL-LSMLRLAKERREISVVCD--QFGTPTSALQIARAIIQIAHNL  199 (290)
Q Consensus       129 ~~~E~~v~~~~~~~--~IlR~~~vyG~~~~~~v-~~~l~~~~~~~~i~~~~d--~~~~p~~v~D~a~~i~~~~~~~  199 (290)
                      ++..++........  .=+|...++ |+   .+ .........++.-.-...  +...++.-+|+|+++..++++.
T Consensus       158 ~aV~~fs~~LR~e~~g~~IRVt~I~-PG---~v~~~~~s~v~~~g~~~~~~~~y~~~~~l~p~dIA~~V~~~~~~P  229 (246)
T COG4221         158 AAVRAFSLGLRQELAGTGIRVTVIS-PG---LVETTEFSTVRFEGDDERADKVYKGGTALTPEDIAEAVLFAATQP  229 (246)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEC-CC---EECCEECCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             9999999999987337984699863-76---021000343468740666777760587799899999999998599


No 167
>PRK06227 consensus
Probab=99.17  E-value=4e-11  Score=81.85  Aligned_cols=128  Identities=19%  Similarity=0.187  Sum_probs=94.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++=||.++++.| .+|.+|+..++++                     +|++|++++++++++.     +.|++
T Consensus         7 valVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~iDiL   86 (256)
T PRK06227          7 VAIVTGGGQGIGAAIAQTFAENGAKVVIADIDEEAGLEREEMLRSNGLDALFVKTDVSDEEDVKNMVRKTVERYGGIDIL   86 (256)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             89995866889999999999879999999698889999999999559918999816899999999999999982999799


Q ss_pred             EECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             9786344543----2233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||.|++....    ..+.+.+..+++|+.++-.+++++.    +.+ -++|.+||..-+-+   .|.        ...|+
T Consensus        87 VNNAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~~~~~---~~~--------~~~Y~  155 (256)
T PRK06227         87 INNAGIFSGKSIFERTLEEWERVIRVNLTGPYLCSKYAAEEMIKNGGGVIINIASTRAFQS---EPN--------TEPYS  155 (256)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CCC--------CHHHH
T ss_conf             9899899998903498999999999982999999999999999849977999622554568---998--------68899


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+...+.+..+.
T Consensus       156 asKaav~~lTr~lA~  170 (256)
T PRK06227        156 ASKGGIIALTHSLAV  170 (256)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 168
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.17  E-value=2.9e-11  Score=82.65  Aligned_cols=127  Identities=20%  Similarity=0.147  Sum_probs=93.3

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------CCCCCHHHHHHHHHHC-CCCEEEECCCCCCC----
Q ss_conf             4999978897889999999-6498599961367------------0878999999999755-99899978634454----
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------IDLLKPKDFASFFLSF-SPDVIINPAAYTAV----   63 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------~D~~~~~~~~~~l~~~-~pd~Vih~Aa~~~~----   63 (290)
                      .+|||||++=||.++++.| .+|.+|+++++.+            +|++|. .+++++++. ++|++||+|++...    
T Consensus         7 ~alVTGas~GIG~aia~~~a~~Ga~V~~~d~~~~~~~~~~~~~~~~Dv~~~-~v~~~~~~~g~iDiLvNnAGi~~~~~~~   85 (237)
T PRK06550          7 TVLVTGAASGIGLAQARAFLEQGAHVYGVDKSDKPDLSGNFHFIQLDLSSD-KLEPLFKVVPSVDILCNTAGILDDYKPL   85 (237)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHCCCCEEEEECCCCHH-HHHHHHHHCCCCCEEEECCCCCCCCCCH
T ss_conf             999937477999999999998799999970861243069738998638889-9999999759997999898889999990


Q ss_pred             -CCCCCCCCEEEEECCCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             -322332210242012221100011223----33-333445532111357554421111222211101245666653101
Q gi|254780921|r   64 -DKAEDEPEIAFSINAEGAGAIAKAADS----IG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVAS  137 (290)
Q Consensus        64 -~~~e~~~~~~~~~Nv~~~~~l~~~~~~----~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~  137 (290)
                       +..+.+.+..+++|+.++.++++++..    .+ -++|.+||-.-+   ...|        ....|+.||.+...+.+.
T Consensus        86 ~~~~~e~w~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IVnisS~~g~---~~~~--------~~~~Y~asKaal~~lTrs  154 (237)
T PRK06550         86 LDTSDEEWQHIFDINLFSTFLLTRAYLPQMLEKKSGVIINMCSIAGF---VAGG--------GGVAYTASKHALAGFTKQ  154 (237)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHC---CCCC--------CCHHHHHHHHHHHHHHHH
T ss_conf             55999999999999729999999999999998099189995463435---5799--------868899999999999999


Q ss_pred             CCC
Q ss_conf             222
Q gi|254780921|r  138 YTN  140 (290)
Q Consensus       138 ~~~  140 (290)
                      .+.
T Consensus       155 lA~  157 (237)
T PRK06550        155 LAL  157 (237)
T ss_pred             HHH
T ss_conf             999


No 169
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
Probab=99.17  E-value=2.6e-11  Score=82.89  Aligned_cols=128  Identities=13%  Similarity=0.150  Sum_probs=93.3

Q ss_pred             EEEECCCCHHHHHHHHHHHC-CC-EEEEECHH------------------------HCCCCCHHHHHHHHHHC-----CC
Q ss_conf             99997889788999999964-98-59996136------------------------70878999999999755-----99
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMCVQ-DV-EIIRVGRP------------------------DIDLLKPKDFASFFLSF-----SP   51 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l~~-~~-~v~~~~r~------------------------~~D~~~~~~~~~~l~~~-----~p   51 (290)
                      +||||++|=||..+++.|.+ +. +++.++|+                        .+|++|++++++++++.     ++
T Consensus         3 vlVTGas~GIG~~~a~~la~~Ga~~vvl~~R~~~~~~~~~~~~~~~~~~g~~v~~~~~Dv~~~~~~~~~v~~~~~~~g~i   82 (180)
T smart00822        3 YLITGGLGGLGLELARWLAERGARHLVLLSRSGPDAPGAAELLAELEALGAEVTVVACDVADRAALAAALAAIPARLGPL   82 (180)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHCCCE
T ss_conf             99978787999999999998799889998689878188999999999569969999802688677666777679973983


Q ss_pred             CEEEECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             89997863445432----2332210242012221100011223333-334455321113575544211112222111012
Q gi|254780921|r   52 DVIINPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        52 d~Vih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      |++||+|+......    .+.+.+..+++|+.|+.+|.+++..... .+|++||-.=+-|   .|        -.+.|+.
T Consensus        83 d~lvn~AG~~~~~~~~~~~~~~~~~~~~vnv~g~~~l~~~~~~~~~~~iV~~SSiag~~g---~~--------g~~~Y~A  151 (180)
T smart00822       83 RGVIHAAGVLDDGLLANLTPERFAAVLAPKVDGAWNLHELTRDLPLDFFVLFSSVAGVLG---NP--------GQANYAA  151 (180)
T ss_pred             EEEEEECCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHCCC---CC--------CCHHHHH
T ss_conf             799942466699772559999999999999999999999833678856999765876578---99--------8689999


Q ss_pred             HHHHHHHHHCCCCCC
Q ss_conf             456666531012223
Q gi|254780921|r  127 SKLAGEEKVASYTNN  141 (290)
Q Consensus       127 sK~~~E~~v~~~~~~  141 (290)
                      +|..-|.+.++...+
T Consensus       152 ak~~l~~la~~~~~~  166 (180)
T smart00822      152 ANAFLDALAAHRRAR  166 (180)
T ss_pred             HHHHHHHHHHHHHHC
T ss_conf             999999999999856


No 170
>PRK12935 acetoacetyl-CoA reductase; Provisional
Probab=99.17  E-value=4.9e-11  Score=81.33  Aligned_cols=127  Identities=15%  Similarity=0.073  Sum_probs=91.0

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEE-CHH---------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             999978897889999999-649859996-136---------------------70878999999999755-----99899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRV-GRP---------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~-~r~---------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      +|||||++=||.++++.| .+|.+|+.. +++                     ++|++|++++++++++.     ++|++
T Consensus         9 alVTG~s~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~~~~~v~~~~~~~G~iDiL   88 (247)
T PRK12935          9 AIVTGGAKGIGKAITVALAQEGAKVVINYNSSKEAAENLVNELGKEGHDVYAVQADVSKVEDANRLVEEAVNHFGKVDIL   88 (247)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99917276899999999998799899976999899999999998439958999857999999999999999983999899


Q ss_pred             EECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             9786344543----2233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||+|++....    ..+.+.+..+++|+.++-.+++++.    +.+ -++|.+||..-.   ...|        ....|+
T Consensus        89 VNNAGi~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~p~m~~~~~G~IVnisS~~g~---~g~~--------~~~~Y~  157 (247)
T PRK12935         89 VNNAGITRDRTFKKLNREDWERVIDVNLSSVFNTTSAVLPYITEAEEGRIISISSIIGQ---AGGF--------GQTNYS  157 (247)
T ss_pred             EECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC---CCCC--------CCHHHH
T ss_conf             98998899999044999999999999769999999997687422799528995554645---6899--------858999


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .||.+...+.+..+.
T Consensus       158 asKaal~~ltk~lA~  172 (247)
T PRK12935        158 AAKAGMLGFTKSLAL  172 (247)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 171
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.16  E-value=8.8e-11  Score=79.91  Aligned_cols=181  Identities=14%  Similarity=0.104  Sum_probs=110.0

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             999978897889999999-649859996136----------------------70878999999999755-----99899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      +|||||++=||.++++.| .+|.+|+...+.                      ++|+++.+++++++++.     ++|++
T Consensus         6 alITGgs~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~g~iDiL   85 (249)
T PRK06077          6 VVVTGSGRGIGRAIAVRLAKEGAKVVVNAKKRAEEMNETLRMVKEYGGEGIGVLADVSTREGCRTLAKAALDNFGVVDIL   85 (249)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99926367899999999998799899984887689999999999759958999847999999999999999981998889


Q ss_pred             EECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             978634454----322332210242012221100011223---3333344553211135755442111122221110124
Q gi|254780921|r   55 INPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKS  127 (290)
Q Consensus        55 ih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~s  127 (290)
                      ||.|++...    +..+.+.+..+.+|+.++..+++++..   .+-++|.+||..-+   ...|        ....|+.+
T Consensus        86 VnNAG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m~~~G~IInisS~~~~---~~~~--------~~~~Y~as  154 (249)
T PRK06077         86 VNNAGLGLFSPFLNADDRLIEKHISTDLKSVIYCSQEAAKVMREGGEIINIASIAGI---RPFV--------GLSIYGAM  154 (249)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCHHHC---CCCC--------CCHHHHHH
T ss_conf             985775788750109999999999886218999999999996169789982676545---6899--------97789999


Q ss_pred             HHHHHHHHCCCCCCC--CCCCCCCCEECC--CCCCCCEEECCCCCCCCEEECCC--CCCCCCCHHHHHHHHHHHHH
Q ss_conf             566665310122232--235554200036--86320002011246652153045--54544522368999999998
Q gi|254780921|r  128 KLAGEEKVASYTNNY--VILRTAWVYSIF--GSNFLLSMLRLAKERREISVVCD--QFGTPTSALQIARAIIQIAH  197 (290)
Q Consensus       128 K~~~E~~v~~~~~~~--~IlR~~~vyG~~--~~~~v~~~l~~~~~~~~i~~~~d--~~~~p~~v~D~a~~i~~~~~  197 (290)
                      |.+...+.+..+..+  - +|...| .|+  ...+...+.+.....+. .....  ..+.....+|+|+++..++.
T Consensus       155 Kaal~~ltr~lA~ela~~-IrVN~V-~PG~i~T~~~~~~~~~~~~~~~-~~~~~~~~~~R~~~peeia~~v~fLas  227 (249)
T PRK06077        155 KAAVINLTQYLALELAPR-IRVNAV-APGVVKTKMGESLVKLLGMTEE-EFAKKHTLTGKILDPEDVAELVWALVK  227 (249)
T ss_pred             HHHHHHHHHHHHHHHCCC-CEEEEE-EECCCCCCHHHHHHHCCCCCHH-HHHHCCCCCCCCCCHHHHHHHHHHHHC
T ss_conf             999999999999998699-889999-8468987425555540486789-998607987897399999999999964


No 172
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional
Probab=99.16  E-value=4e-11  Score=81.87  Aligned_cols=127  Identities=19%  Similarity=0.119  Sum_probs=86.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHH-----CCCCEEEEC
Q ss_conf             4999978897889999999-6498599961367------------------087899999999975-----599899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLS-----FSPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~-----~~pd~Vih~   57 (290)
                      .+|||||++-||.++++.| .+|.+|+.++|++                  +|++|.+++++++++     -++|++||+
T Consensus         8 ~alVTGas~GIG~aia~~l~~~Ga~V~~~~r~~~~l~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~iDiLVnn   87 (263)
T PRK06200          8 VALITGGGSGIGRALVERFLAEGARVAVLERSAEKCASLRQRFGDDVLVVEGDVTSYADNQRAVAQTVDRFGKLDCFVGN   87 (263)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             89995866799999999999879999999799999999999818864687179999999999999999984998889975


Q ss_pred             CCCCCCCC-----C----CCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             63445432-----2----33221024201222110001122----33333344553211135755442111122221110
Q gi|254780921|r   58 AAYTAVDK-----A----EDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        58 Aa~~~~~~-----~----e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      |+......     .    +...+..+++|+.++.++++++.    +.+-.+|++||..-+-+   .+        ....|
T Consensus        88 AG~~~~~~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~p~m~~~~g~iI~~~S~~~~~~---~~--------~~~~Y  156 (263)
T PRK06200         88 AGIWDYYTSLVDIPAETLDTAFDEIFRVNVKGYLLGAKAALPALKASGGSIIFTLSNSSFYP---GG--------GGPLY  156 (263)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCHHHCCC---CC--------CCHHH
T ss_conf             75467777603399789999999999998799999999998988607977999822021258---89--------85678


Q ss_pred             HHHHHHHHHHHCCCC
Q ss_conf             124566665310122
Q gi|254780921|r  125 GKSKLAGEEKVASYT  139 (290)
Q Consensus       125 g~sK~~~E~~v~~~~  139 (290)
                      +.+|.+.+.+.+..+
T Consensus       157 ~asKaal~~ltr~lA  171 (263)
T PRK06200        157 TASKHAVVGLVRQLA  171 (263)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 173
>PRK08085 gluconate 5-dehydrogenase; Provisional
Probab=99.15  E-value=5.7e-11  Score=80.98  Aligned_cols=128  Identities=17%  Similarity=0.076  Sum_probs=93.9

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH---------------------HCCCCCHHHHHHHHHH-----CCCCEE
Q ss_conf             4999978897889999999-649859996136---------------------7087899999999975-----599899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP---------------------DIDLLKPKDFASFFLS-----FSPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~---------------------~~D~~~~~~~~~~l~~-----~~pd~V   54 (290)
                      .+|||||++=||+++++.| .+|.+|+..+++                     ++|++|.+.+++++++     -++|++
T Consensus        11 ~alVTG~~~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g~~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDil   90 (254)
T PRK08085         11 NILITGSAQGIGFLLATGLAEYGAEIIINDITAERAEKAVAKLRQEGIKAHAAAFNVTHKQEIEAAIEHIEKDIGPIDVL   90 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89996856789999999999869999999698899999999998449818999826899999999999999983998699


Q ss_pred             EECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             978634454----32233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||+|++...    +..+.+.+..+++|+.++-.+++.+.    +.+ -++|++||..-.   ...|        ....|+
T Consensus        91 VnNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~q~~~~~m~~~~~G~IInisS~~~~---~~~~--------~~~~Y~  159 (254)
T PRK08085         91 INNAGIQRRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVARYMVKRQAGKIINICSMQSE---LGRD--------TITPYA  159 (254)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEHHHC---CCCC--------CCHHHH
T ss_conf             98986788877010989999999999849999999998599887399729999773014---4789--------856789


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+.+.+.+..+.
T Consensus       160 asKaai~~ltr~lA~  174 (254)
T PRK08085        160 ASKGAVKMLTRGMCV  174 (254)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 174
>PRK12829 short chain dehydrogenase; Provisional
Probab=99.15  E-value=5.7e-11  Score=80.97  Aligned_cols=128  Identities=21%  Similarity=0.201  Sum_probs=94.1

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------------CCCCCHHHHHHHHHHC-----CCCEEEE
Q ss_conf             4999978897889999999-6498599961367-------------------0878999999999755-----9989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------------IDLLKPKDFASFFLSF-----SPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------------~D~~~~~~~~~~l~~~-----~pd~Vih   56 (290)
                      .+|||||++=||.++++.| .+|.+|+.++|++                   +|++|++++++++++.     +.|++||
T Consensus        13 valVTGgs~GIG~aiA~~la~~Ga~V~i~~r~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiLVN   92 (264)
T PRK12829         13 RVLVTGGASGIGRAIAEAFAEAGARVHVCDVSEAALAATAARLPGAKVTATVADVADPAQVERVFDTAVERFGGLDVLVN   92 (264)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             79994737689999999999879989999799899999999747997599996289999999999999997399989998


Q ss_pred             CCCCCCC-----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             8634454-----32233221024201222110001122----333--333445532111357554421111222211101
Q gi|254780921|r   57 PAAYTAV-----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG--IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        57 ~Aa~~~~-----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~--~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      .|++..+     +..+.+.+..+++|+.++-.+++++.    +.+  ..+|.+||..-.   ...|        ....|+
T Consensus        93 NAGi~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~~IinisS~~~~---~~~~--------~~~~Y~  161 (264)
T PRK12829         93 NAGIAGPTGGIDEITPEQWEQTLAVNLNGQFYFARAAVPLLRASGHGGVIIALSSVAGR---LGYP--------GRTPYA  161 (264)
T ss_pred             CCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHC---CCCC--------CCHHHH
T ss_conf             99899999980239999999999998487899999999999873998089998026547---7998--------867899


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+...+.+..+.
T Consensus       162 asKaal~~ltr~lA~  176 (264)
T PRK12829        162 ASKWAVVGLVKSLAI  176 (264)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 175
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional
Probab=99.15  E-value=6.8e-11  Score=80.52  Aligned_cols=128  Identities=16%  Similarity=0.128  Sum_probs=94.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++-||.++++.| .+|.+|+.++|++                     +|++|++++++++++.     ++|++
T Consensus         9 valVTGgs~GIG~a~A~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiL   88 (262)
T PRK13394          9 TAVVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVADEINKAGGKAIGVAMDVTNEDAVNAGIDKVAERFGSVDIL   88 (262)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995857789999999999879999999798899999999999629939999815899999999999999981999999


Q ss_pred             EECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             97863445432----2332210242012221100011223------3333344553211135755442111122221110
Q gi|254780921|r   55 INPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAADS------IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        55 ih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~~------~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      ||.|+......    ...+.+..+++|+.++-++++.+..      .+-++|++||..-+   ...|        ..+.|
T Consensus        89 VnnAG~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~M~k~~~~G~IVnisS~~~~---~~~~--------~~~~Y  157 (262)
T PRK13394         89 VSNAGIQIVNPIENYSFADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSH---EASP--------LKSAY  157 (262)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC---CCCC--------CCHHH
T ss_conf             989988999991659999999999997589999999999999983799689997457767---6799--------97689


Q ss_pred             HHHHHHHHHHHCCCCC
Q ss_conf             1245666653101222
Q gi|254780921|r  125 GKSKLAGEEKVASYTN  140 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~  140 (290)
                      +.+|.+...+.+..+.
T Consensus       158 ~asKaal~~ltk~lA~  173 (262)
T PRK13394        158 VTAKHGLLGLARVLAK  173 (262)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999


No 176
>PRK06125 short chain dehydrogenase; Provisional
Probab=99.15  E-value=9.3e-11  Score=79.79  Aligned_cols=128  Identities=10%  Similarity=0.062  Sum_probs=94.0

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------------CCCCCHHHHHHHHHHC-CCCEEEEC
Q ss_conf             4999978897889999999-6498599961367----------------------0878999999999755-99899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------------IDLLKPKDFASFFLSF-SPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------------~D~~~~~~~~~~l~~~-~pd~Vih~   57 (290)
                      ++||||+++=||.++++.| .+|.+|+.++|++                      +|+++.+.+++++++. ++|++||.
T Consensus         9 ~alITG~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~g~iDiLVnn   88 (259)
T PRK06125          9 RVLITGASKGIGAAAAEAFAAEGCHLVLAARDADALAALAADLRAAHGVDVAVHALDLSSPEAREQLAAEAGDIDILVNN   88 (259)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEC
T ss_conf             89996877689999999999879989999798899999999998700986699988899999999999985899899976


Q ss_pred             CCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             6344543----2233221024201222110001122----333-333445532111357554421111222211101245
Q gi|254780921|r   58 AAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        58 Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
                      |+.....    ..+.+.+..+++|+.++.++++++.    +.+ .++|.+||..-.   ...        .+...|+.+|
T Consensus        89 AG~~~~~~~~~~~~~~w~~~~~vnl~~~~~l~~~~~p~m~~~~~G~Iini~s~~~~---~~~--------~~~~~y~asK  157 (259)
T PRK06125         89 AGAIPGGSLDDVDDAAWRAGWELKVFGYINLTRLFYPRMKARGSGVIVNVIGAAGE---NPD--------AGYICGSAGN  157 (259)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCC---CCC--------CCCHHHHHHH
T ss_conf             87789986454999999999998634378899999997653498199999421337---888--------7648999999


Q ss_pred             HHHHHHHCCCCC
Q ss_conf             666653101222
Q gi|254780921|r  129 LAGEEKVASYTN  140 (290)
Q Consensus       129 ~~~E~~v~~~~~  140 (290)
                      .+.+.+.+..+.
T Consensus       158 aal~~ltr~lA~  169 (259)
T PRK06125        158 AALMAFTRALGG  169 (259)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 177
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase. Members of this family occur as the BphD protein of biphenyl catabolism and as the TodD protein of toluene catabolism. Members catalyze the second step in each pathway and proved interchangeable when tested; the first and fourth enzymes in each pathway confer metabolic specificity. In the context of biphenyl degradation, the enzyme acts as cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (EC 1.3.1.56), while in toluene degradation it acts as cis-toluene dihydrodiol dehydrogenase.
Probab=99.14  E-value=5.8e-11  Score=80.94  Aligned_cols=125  Identities=18%  Similarity=0.147  Sum_probs=86.1

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHH-----CCCCEEEECC
Q ss_conf             999978897889999999-6498599961367------------------087899999999975-----5998999786
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLS-----FSPDVIINPA   58 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~-----~~pd~Vih~A   58 (290)
                      +|||||++=||+++++.| .+|.+|+.++|++                  +|+++.+++++++++     -+.|++||.|
T Consensus         8 alITGgs~GIG~aia~~~a~~Ga~V~i~~r~~~~l~~~~~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~~G~iDiLVnNA   87 (262)
T TIGR03325         8 VLVTGGASGLGRAIVDRFVAEGARVAVLDKSAAGLQELEAAHGDAVVGVEGDVRSLDDHKEAVARCVAAFGKIDCLIPNA   87 (262)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             99906787899999999998799999998998999999986799679998457999999999999999849988899726


Q ss_pred             CCCCCCC---------CCCCCCEEEEECCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             3445432---------233221024201222110001122----33-333344553211135755442111122221110
Q gi|254780921|r   59 AYTAVDK---------AEDEPEIAFSINAEGAGAIAKAAD----SI-GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        59 a~~~~~~---------~e~~~~~~~~~Nv~~~~~l~~~~~----~~-~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      +......         .+.+.+..+++|+.++.++++++.    +. |..++-+||...+.+            .....|
T Consensus        88 G~~~~~~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~p~m~~~~g~iI~~~S~~~~~~~------------~~~~~Y  155 (262)
T TIGR03325        88 GIWDYSTALVDIPDDRIDEAFDEVFHINVKGYLLAVKAALPALVASRGSVIFTISNAGFYPN------------GGGPLY  155 (262)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCC------------CCCHHH
T ss_conf             51687764345862414999999999974999999999999999709818999871032488------------996689


Q ss_pred             HHHHHHHHHHHCCCC
Q ss_conf             124566665310122
Q gi|254780921|r  125 GKSKLAGEEKVASYT  139 (290)
Q Consensus       125 g~sK~~~E~~v~~~~  139 (290)
                      +.+|.+...+.+..+
T Consensus       156 ~asKaal~~ltr~lA  170 (262)
T TIGR03325       156 TAAKHAVVGLVKELA  170 (262)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 178
>PRK05855 short chain dehydrogenase; Validated
Probab=99.14  E-value=1e-10  Score=79.54  Aligned_cols=124  Identities=15%  Similarity=0.193  Sum_probs=91.9

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             999978897889999999-6498599961367---------------------0878999999999755-----998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      ++|||+++=||++++..| .+|.+|+..++++                     +|++|.++++++.+..     ++|++|
T Consensus       318 AvVTGA~sGIGrA~A~~fA~~GA~Vvl~Dr~~~~l~eta~ei~~~G~~a~~~~~DVtd~~av~al~~~v~~~~G~iDILV  397 (582)
T PRK05855        318 VVVTGAGSGIGRATALAFAREGAEVVASDIDEAAAERTAALIRAAGAVAHAYRVDVSDADAMEALAEWVGAEHGVPDIVV  397 (582)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99958757899999999997799999960799999999999995198489997558999999999999999769999999


Q ss_pred             ECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCC----CCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             78634454----3223322102420122211000112----2333--333445532111357554421111222211101
Q gi|254780921|r   56 NPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAA----DSIG--IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        56 h~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~----~~~~--~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      |.||+...    +....+.+..+++|+.|+.+.++++    .+.|  -.+|.+||-.=|   ...|        -.+.|+
T Consensus       398 NNAGI~~~g~~~d~s~e~w~~v~dVNl~Gv~~~~ra~lp~M~~rg~gG~IVNiSSiag~---~~~p--------~~~aY~  466 (582)
T PRK05855        398 NNAGIGMAGGFLDTSAEEWDRVLDVNLWGVIHGCRLFGRQMVERGTGGHIVNVASAAAY---APSR--------SLPAYA  466 (582)
T ss_pred             ECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHC---CCCC--------CCHHHH
T ss_conf             89875899780329999999999886499999999999999964998089996786457---7898--------864689


Q ss_pred             HHHHHHHHHHCC
Q ss_conf             245666653101
Q gi|254780921|r  126 KSKLAGEEKVAS  137 (290)
Q Consensus       126 ~sK~~~E~~v~~  137 (290)
                      .||.+...+...
T Consensus       467 ASKaAV~gftes  478 (582)
T PRK05855        467 TSKAAVLMLSEC  478 (582)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 179
>PRK07576 short chain dehydrogenase; Provisional
Probab=99.13  E-value=7.2e-11  Score=80.41  Aligned_cols=128  Identities=16%  Similarity=0.147  Sum_probs=94.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      ++|||||++=||.++++.| .+|.+|+.++|++                     +|++|.++++++++..     +.|++
T Consensus        10 ~alVTGgs~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~iDiL   89 (260)
T PRK07576         10 NVFVVGGTSGINLGIAQAFARAGANVAVASRSQEKVDAAVAQLQQAGPEALGVSADVRDYAAVEAAFAAIADEFGPIDVL   89 (260)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89995896199999999999879999999798899999999999539948999931899999999999999984999899


Q ss_pred             EECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             978634454----3223322102420122211000112----23333334455321113575544211112222111012
Q gi|254780921|r   55 INPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAA----DSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        55 ih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~----~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      ||.|+...+    +..+.+.+..+++|+.++.++++++    ++.+.++|.+||...+.+   .|        ....|+.
T Consensus        90 VnnAg~~~~~~~~~~~~~~~~~~~~vnl~~~~~~~~~~~p~m~~~~G~IInisS~~~~~~---~~--------~~~~y~a  158 (260)
T PRK07576         90 VSGAAGNFPAPAAGMSANGFKTVVDIDLLGTFNVLKAAYPLLRRPGASIIQISAPQAVVA---MP--------MQAHVCA  158 (260)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECHHCCC---CC--------CHHHHHH
T ss_conf             989867899891559999999999986463899999999998717977999988211367---88--------7189999


Q ss_pred             HHHHHHHHHCCCCC
Q ss_conf             45666653101222
Q gi|254780921|r  127 SKLAGEEKVASYTN  140 (290)
Q Consensus       127 sK~~~E~~v~~~~~  140 (290)
                      +|.+.+.+.+..+.
T Consensus       159 sKaav~~ltk~lA~  172 (260)
T PRK07576        159 AKAGVDMLTRTLAL  172 (260)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999


No 180
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional
Probab=99.13  E-value=6.4e-11  Score=80.67  Aligned_cols=126  Identities=17%  Similarity=0.110  Sum_probs=90.1

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             4999978897889999999-6498599961367--------------------0878999999999755-----998999
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      .+|||||++-||.++++.| .+|.+|+.++|.+                    +|+++.++++++++..     ++|++|
T Consensus        10 valITGas~GIG~aiA~~la~~Ga~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~G~iDiLV   89 (260)
T PRK12823         10 VAVVTGAAQGIGRGVALRAAAEGARVVLVDRSELVHEVAAELVAAGGEALALTADLETYAGAQAVMAAAVEAFGRIDVLI   89 (260)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             89994886789999999999879999999694689999999985499489998126885899999999999839987999


Q ss_pred             ECCCCCCC-----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             78634454-----32233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   56 NPAAYTAV-----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        56 h~Aa~~~~-----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      |.||.+..     +..+.+.+..+++|+.++.++++++.    +.+ .++|++||.... +    + .       ..+|+
T Consensus        90 nnag~~~~~~~~~~~~~~~~~~~~~~nl~~~~~~~~~~~p~m~~~~~G~Ii~isS~~~~-~----~-~-------~~~Y~  156 (260)
T PRK12823         90 NNVGGTIWAKPFEEYEEEQIEAEIRRSLFPTLWCCRAVLPHMLAQGGGAIVNVSSIATR-G----I-N-------RVPYS  156 (260)
T ss_pred             ECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECHHHCC-C----C-C-------CCHHH
T ss_conf             77522457898265999999999999854068999999999998169679998202205-8----8-7-------51269


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+.+.+.+..+.
T Consensus       157 asKaal~~ltr~lA~  171 (260)
T PRK12823        157 AAKGGVNALTASLAF  171 (260)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 181
>PRK06057 short chain dehydrogenase; Provisional
Probab=99.13  E-value=6.8e-11  Score=80.55  Aligned_cols=128  Identities=16%  Similarity=0.107  Sum_probs=92.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------CCCCCHHHHHHHHHHC-----CCCEEEECCC
Q ss_conf             4999978897889999999-6498599961367----------------0878999999999755-----9989997863
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------IDLLKPKDFASFFLSF-----SPDVIINPAA   59 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------~D~~~~~~~~~~l~~~-----~pd~Vih~Aa   59 (290)
                      .+|||||++=||.++++.| .+|.+|+..++++                +|++|++++++++++.     +.|++||+|+
T Consensus         9 valVTGas~GIG~aia~~la~~Ga~Vvi~d~~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iDiLVNnAG   88 (255)
T PRK06057          9 VAVITGGASGIGLATARRMRAEGATVVVGDIDPEAGKAAADELGGLFVQVDVTDEDAVNALFDTAAETYGSVDIAFNNAG   88 (255)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             89996848889999999999869989999698899999998649979998169999999999999998199878998885


Q ss_pred             CCCCC------CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             44543------2233221024201222110001122----333-3334455321-1135755442111122221110124
Q gi|254780921|r   60 YTAVD------KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDY-VFDGLSRTPIDEFSPTNPLNIYGKS  127 (290)
Q Consensus        60 ~~~~~------~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~-Vy~g~~~~p~~E~d~~~P~~~Yg~s  127 (290)
                      +..++      ....+.+..+++|+.++-.+++++.    +.+ -++|.+||.. .. |..          .....|+.+
T Consensus        89 i~~~~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~~-g~~----------~~~~~Y~as  157 (255)
T PRK06057         89 ISPPEDDSILNTGLDAWQRVQDVNLKSVYLCCKAALPHMVEAGKGSIINTASFVAVM-GSA----------TSQISYTAS  157 (255)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCC-CCC----------CCCHHHHHH
T ss_conf             578899862009999999999998299999999999999983995899973765635-888----------652559999


Q ss_pred             HHHHHHHHCCCCC
Q ss_conf             5666653101222
Q gi|254780921|r  128 KLAGEEKVASYTN  140 (290)
Q Consensus       128 K~~~E~~v~~~~~  140 (290)
                      |.+...+.+..+.
T Consensus       158 Kaav~~lTr~lA~  170 (255)
T PRK06057        158 KGGVLAMSRELGV  170 (255)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999999


No 182
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.13  E-value=8.5e-11  Score=80.00  Aligned_cols=178  Identities=17%  Similarity=0.217  Sum_probs=108.1

Q ss_pred             EEEECCC--CHHHHHHHHHH-HCCCEEEEECHH--------------------------------HCCCCCHHHHHHHHH
Q ss_conf             9999788--97889999999-649859996136--------------------------------708789999999997
Q gi|254780921|r    3 CLVIGNN--GQIAQSLSSMC-VQDVEIIRVGRP--------------------------------DIDLLKPKDFASFFL   47 (290)
Q Consensus         3 iLVtG~~--G~iG~~l~~~l-~~~~~v~~~~r~--------------------------------~~D~~~~~~~~~~l~   47 (290)
                      +||||++  |=||.++++.| .+|.+|+.+.++                                ++|+++.++++.+++
T Consensus         8 alVTGasr~~GIG~aiA~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~~~~~~~   87 (257)
T PRK12748          8 AIVTGASRLNGIGAAICRVLAQKGIDIFFTYWSQYDKAMPWGMHDKEPFLLKEEIESYGVRCEMLEIDLSQSYSPNRLFY   87 (257)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHH
T ss_conf             99928899985499999999987999999707525544342346067999999999659828999846899999999999


Q ss_pred             HC-----CCCEEEECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             55-----9989997863445432----233221024201222110001122----33-3333445532111357554421
Q gi|254780921|r   48 SF-----SPDVIINPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SI-GIPCIYISTDYVFDGLSRTPID  113 (290)
Q Consensus        48 ~~-----~pd~Vih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~-~~~~I~iSS~~Vy~g~~~~p~~  113 (290)
                      ..     ++|++||.|+......    .+.+.+..+.+|+.++..+++.+.    .. +.++|.+||..-..   ..|  
T Consensus        88 ~~~~~~G~iDiLVnnAg~~~~~~~~~~~~~~~~~~~~vN~~~~~~l~~~~~~~m~~~~~G~IInisS~~~~~---~~~--  162 (257)
T PRK12748         88 MVSERLGDPSILINNAAYSTHTRIEELDVEQLDKHYAVNVRATMLLSSLFAKQFASKTGGRIINLTSGQSLG---PMP--  162 (257)
T ss_pred             HHHHHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHC---CCC--
T ss_conf             999974999899989988999990559999999999998389999999999988653892799982278606---487--


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHCCCCCCCC--CCCCCCCE-ECCCCCCCC-EEECCCCCCCCEEECCCCCCCCCCHHHHH
Q ss_conf             111222211101245666653101222322--35554200-036863200-02011246652153045545445223689
Q gi|254780921|r  114 EFSPTNPLNIYGKSKLAGEEKVASYTNNYV--ILRTAWVY-SIFGSNFLL-SMLRLAKERREISVVCDQFGTPTSALQIA  189 (290)
Q Consensus       114 E~d~~~P~~~Yg~sK~~~E~~v~~~~~~~~--IlR~~~vy-G~~~~~~v~-~~l~~~~~~~~i~~~~d~~~~p~~v~D~a  189 (290)
                            ....|+.+|.+.+.+.+..+..+.  =+|...|- |+-+..+.. .+.+......++    ..++   ..+|+|
T Consensus       163 ------~~~~Y~asKaal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~Pl----gR~g---~pedia  229 (257)
T PRK12748        163 ------DELAYAATKGAIEAFTKSLAPVLAEKGITVNAVNPGPTDTGWITEELKHHLVPKFPQ----GRVG---EPVDAA  229 (257)
T ss_pred             ------CHHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEEECCCCCCCCCHHHHHHHHHCCCC----CCCC---CHHHHH
T ss_conf             ------604869999999999999999972309499999778789888898999999857998----9985---999999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999984
Q gi|254780921|r  190 RAIIQIAHN  198 (290)
Q Consensus       190 ~~i~~~~~~  198 (290)
                      +++..++..
T Consensus       230 ~~v~fL~S~  238 (257)
T PRK12748        230 RLIAFLASE  238 (257)
T ss_pred             HHHHHHHCC
T ss_conf             999999485


No 183
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.13  E-value=4.5e-11  Score=81.57  Aligned_cols=128  Identities=16%  Similarity=0.149  Sum_probs=91.1

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH-------------------HCCCCCHHHHHHHHHHC-----C-CCEEE
Q ss_conf             4999978897889999999-649859996136-------------------70878999999999755-----9-98999
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-------------------DIDLLKPKDFASFFLSF-----S-PDVII   55 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-------------------~~D~~~~~~~~~~l~~~-----~-pd~Vi   55 (290)
                      .+|||||++=||+++++.| .+|.+|+...++                   ++|++|++++++++++.     + .|++|
T Consensus         8 ~alVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~v~~~~~~~G~~idilV   87 (254)
T PRK08642          8 IVLVTGGSRGLGAAIARAFAREGARVVVNYHRSEDAAEALADELGDRAIAIQADVTDRNQVDAMFATATEHFGKPITTVV   87 (254)
T ss_pred             EEEEECHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             99997811199999999999879999996189889999999981994699980699999999999999999499776998


Q ss_pred             ECCCCCC----------CCCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             7863445----------432233221024201222110001122----333-3334455321113575544211112222
Q gi|254780921|r   56 NPAAYTA----------VDKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNP  120 (290)
Q Consensus        56 h~Aa~~~----------~~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P  120 (290)
                      |.|+...          .+....+.+..+++|+.++.++++.+.    +.+ -++|++||....     .      +..|
T Consensus        88 nnA~~~~~~~~~~~~~~~~~~~e~~~~~~~~nl~~~~~~~~~~~~~m~~~~~G~IinisS~~~~-----~------~~~~  156 (254)
T PRK08642         88 NNALADFSFDGDARPKAEDITWEDFQQQLEGAVKGALNTIQAALPGMRERGFGRIINIGTNLFQ-----N------PVVP  156 (254)
T ss_pred             ECCEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCHHHC-----C------CCCC
T ss_conf             6764224568766689345999999999999999999999999997787489966886003315-----8------8876


Q ss_pred             CCCCHHHHHHHHHHHCCCCC
Q ss_conf             11101245666653101222
Q gi|254780921|r  121 LNIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       121 ~~~Yg~sK~~~E~~v~~~~~  140 (290)
                      ...|+.+|...+.+.+..+.
T Consensus       157 ~~~Y~asKaal~~ltr~lA~  176 (254)
T PRK08642        157 YHDYTAAKAALLSLTRTLAA  176 (254)
T ss_pred             CHHHHHHHHHHHHHHHHHHH
T ss_conf             03778999999999999999


No 184
>PRK05867 short chain dehydrogenase; Provisional
Probab=99.13  E-value=8.4e-11  Score=80.02  Aligned_cols=130  Identities=17%  Similarity=0.109  Sum_probs=93.0

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------0878999999999755-----99899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      .+|||||++-||+++++.| .+|.+|+.++|++                     +|++|++++++++++.     +.|++
T Consensus        11 valVTGas~GIG~aiA~~la~~Ga~V~i~~r~~~~~~~~~~ei~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiL   90 (253)
T PRK05867         11 RALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSGGKVVPVCCDVSQHQQVTSMLDQVTAELGGIDIA   90 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89997956599999999999869999999798899999999998459919999836999999999999999995998599


Q ss_pred             EECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             978634454----32233221024201222110001122----33--333344553211135755442111122221110
Q gi|254780921|r   55 INPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SI--GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        55 ih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~--~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      ||.|++...    +..+.+.+..+++|+.++-.+++++.    +.  +..+|.+||..-+-  ..       .+.....|
T Consensus        91 VnNAG~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~m~~~~~gg~IvnisS~~g~~--~~-------~~~~~~~Y  161 (253)
T PRK05867         91 VCNAGIITVTPMLDMPLEEFQRLQNTNVTGVFLTAQAAAKAMVKQGQGGVIINTASMSGHI--IN-------VPQQVSHY  161 (253)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCC--CC-------CCCCHHHH
T ss_conf             9899778887501099999999999975999999999999999818998038875511126--57-------77402778


Q ss_pred             HHHHHHHHHHHCCCCC
Q ss_conf             1245666653101222
Q gi|254780921|r  125 GKSKLAGEEKVASYTN  140 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~  140 (290)
                      +.+|.+...+.+..+.
T Consensus       162 ~asKaav~~ltr~lA~  177 (253)
T PRK05867        162 CASKAAVIHLTKAMAV  177 (253)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999


No 185
>PRK08589 short chain dehydrogenase; Validated
Probab=99.13  E-value=7.7e-11  Score=80.22  Aligned_cols=127  Identities=16%  Similarity=0.096  Sum_probs=92.2

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHHC-----CCCEEEE
Q ss_conf             999978897889999999-6498599961367--------------------0878999999999755-----9989997
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLSF-----SPDVIIN   56 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~~-----~pd~Vih   56 (290)
                      +|||||++=||.++++.| .+|.+|+..++++                    +|++|++++++++++.     ++|++||
T Consensus         9 alVTGas~GIG~aiA~~la~~Ga~Vv~~d~~~~~~~~~~~i~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G~iDiLVN   88 (272)
T PRK08589          9 AVITGASTGIGQASAIALAQEGAYVLAVDIAEAVSETVDKIKSNGGKAKAYHVDISDEQQVKDFASDIKEQFGHIDVLFN   88 (272)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             99978256999999999998699999983827899999999955994899996079999999999999998299878998


Q ss_pred             CCCCCCCC-----CCCCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             86344543-----2233221024201222110001122----33333344553211135755442111122221110124
Q gi|254780921|r   57 PAAYTAVD-----KAEDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKS  127 (290)
Q Consensus        57 ~Aa~~~~~-----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~s  127 (290)
                      +|++....     ..+.+.+..+++|+.++-.+++++.    +.+-++|.+||..-+   ...|        ....|+.+
T Consensus        89 NAGi~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~p~m~~~gG~IVnisS~~g~---~~~~--------~~~~Y~as  157 (272)
T PRK08589         89 NAGVDNAAGRIHEYPVDVFDKIMAVDMRGTFLMTKMLLPLMMEQGGSIINTSSFSGQ---AADL--------YRSGYNAA  157 (272)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHHC---CCCC--------CCHHHHHH
T ss_conf             986678888710099999999999982999999999999999759907999123436---7789--------86689999


Q ss_pred             HHHHHHHHCCCCC
Q ss_conf             5666653101222
Q gi|254780921|r  128 KLAGEEKVASYTN  140 (290)
Q Consensus       128 K~~~E~~v~~~~~  140 (290)
                      |.+...+.+..+.
T Consensus       158 Kaal~~lTr~lA~  170 (272)
T PRK08589        158 KGAVINFTKSIAI  170 (272)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999999


No 186
>PRK08703 short chain dehydrogenase; Provisional
Probab=99.12  E-value=1.8e-10  Score=78.22  Aligned_cols=174  Identities=18%  Similarity=0.142  Sum_probs=102.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------------CCCCC--HHHHHHH---HH-H--CC
Q ss_conf             4999978897889999999-6498599961367----------------------08789--9999999---97-5--59
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------------IDLLK--PKDFASF---FL-S--FS   50 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------------~D~~~--~~~~~~~---l~-~--~~   50 (290)
                      .+|||||++=||.++++.| .+|.+|+.++|++                      +|+.+  ...++++   +. .  -+
T Consensus         8 ~~lITGas~GIG~aiA~~la~~Ga~V~l~~r~~~~l~~~~~~l~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~G~   87 (239)
T PRK08703          8 TILVTGASQGLGEQVAKAYAAAGATVILVARHQKKLEKVYDAIVEAGHPEPFAIRFDLMSAEEKEFEQFAATIAEATQGK   87 (239)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             89994886289999999999879989999798889999999999737995499998505630789999999999983799


Q ss_pred             CCEEEECCCCCCC----C-CCCCCCCEEEEECCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9899978634454----3-2233221024201222110001122----33-33334455321113575544211112222
Q gi|254780921|r   51 PDVIINPAAYTAV----D-KAEDEPEIAFSINAEGAGAIAKAAD----SI-GIPCIYISTDYVFDGLSRTPIDEFSPTNP  120 (290)
Q Consensus        51 pd~Vih~Aa~~~~----~-~~e~~~~~~~~~Nv~~~~~l~~~~~----~~-~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P  120 (290)
                      .|++||+|++...    + ....+.+..+++|+.++.++++++.    +. +.++|++||...+   ...|+        
T Consensus        88 lD~lvnnAG~~~~~~~~~~~~~~~~~~~~~vN~~~~~~l~~~~~p~m~~~~~g~Ii~isS~~~~---~~~~~--------  156 (239)
T PRK08703         88 LDGIVHCAGYFYALSPLDFQTVAEWVNQYRINTVAPMGLTRALFPLLKQSPDASVIFVGESHGE---TPKAY--------  156 (239)
T ss_pred             CCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHC---CCCCC--------
T ss_conf             7689966654578895332899999999988808999999999999987799089998144547---78988--------


Q ss_pred             CCCCHHHHHHHHHHHCCCCCC---CCCCCCCCCEECCCCCCCCE-EECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             111012456666531012223---22355542000368632000-20112466521530455454452236899999999
Q gi|254780921|r  121 LNIYGKSKLAGEEKVASYTNN---YVILRTAWVYSIFGSNFLLS-MLRLAKERREISVVCDQFGTPTSALQIARAIIQIA  196 (290)
Q Consensus       121 ~~~Yg~sK~~~E~~v~~~~~~---~~IlR~~~vyG~~~~~~v~~-~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~  196 (290)
                      ...|+.+|.+-+.+.+..+..   +--+|... ..|+   ++.+ +......++.       ........|++++++.++
T Consensus       157 ~~~Y~asKaal~~ltk~lA~E~~~~g~IrVN~-i~PG---~i~T~~~~~~~~~~~-------~~~~~~~~dia~a~~~La  225 (239)
T PRK08703        157 WGGFGASKAALNYLCKVAADEWERFGNLRANV-LVPG---PINSPQRIKSHPGEA-------KSERKSYGDVLPAFVWWA  225 (239)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE-EEEC---CCCCCCHHHHCCCCC-------HHCCCCHHHHHHHHHHHH
T ss_conf             66899999999999999999847898989999-9848---897968154586976-------010599999999999983


Q ss_pred             H
Q ss_conf             8
Q gi|254780921|r  197 H  197 (290)
Q Consensus       197 ~  197 (290)
                      .
T Consensus       226 S  226 (239)
T PRK08703        226 S  226 (239)
T ss_pred             C
T ss_conf             8


No 187
>PRK06484 short chain dehydrogenase; Validated
Probab=99.12  E-value=7.5e-11  Score=80.29  Aligned_cols=127  Identities=17%  Similarity=0.196  Sum_probs=95.1

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEEECC
Q ss_conf             999978897889999999-6498599961367------------------0878999999999755-----998999786
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVIINPA   58 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vih~A   58 (290)
                      +|||||++=||+++++.| .+|.+|+..++++                  +|++|.+++++++++.     +.|++||.|
T Consensus       277 alVTGaa~GIG~aiA~~la~~GA~Vvi~d~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~fG~iDiLVNNA  356 (530)
T PRK06484        277 VCVTGGASGIGAAIADRFAALGDRVAIIDSDGEEAVKLREILGGEHLSWQVDITDEASVESAFAGIQGRLGPLDVLVNNA  356 (530)
T ss_pred             EEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99928767899999999998879899995888999999997399736999538999999999999999829988999897


Q ss_pred             CCCCC-----CCCCCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             34454-----32233221024201222110001122----3333334455321113575544211112222111012456
Q gi|254780921|r   59 AYTAV-----DKAEDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        59 a~~~~-----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~  129 (290)
                      ++..+     +..+.+.+..+++|+.++-.+++++.    +.+-++|.+||..-+.+   .        .+...|+.+|.
T Consensus       357 Gi~~~~~~~~e~t~e~w~~v~~vNl~g~f~~~~~~~~~m~~~gG~IVnisS~~~~~~---~--------~~~~~Y~asKa  425 (530)
T PRK06484        357 GIAEPFAPSAEQSLEDFRRTIDVNLKGAFHCSREAARQMGAGGGVIVNLGSITSLLA---L--------PPRHAYGASKA  425 (530)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---C--------CCCHHHHHHHH
T ss_conf             789899980009999999999997199999999999973148976999716443658---8--------99579999999


Q ss_pred             HHHHHHCCCCC
Q ss_conf             66653101222
Q gi|254780921|r  130 AGEEKVASYTN  140 (290)
Q Consensus       130 ~~E~~v~~~~~  140 (290)
                      ....+.+..+.
T Consensus       426 av~~lTr~lA~  436 (530)
T PRK06484        426 AITMLTRCLAA  436 (530)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 188
>KOG1203 consensus
Probab=99.12  E-value=1.1e-09  Score=73.80  Aligned_cols=204  Identities=17%  Similarity=0.178  Sum_probs=112.4

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHHHC---CC------------------CCHHHHHHHHHHCC--CCEEEE
Q ss_conf             94999978897889999999-64985999613670---87------------------89999999997559--989997
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDI---DL------------------LKPKDFASFFLSFS--PDVIIN   56 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~~---D~------------------~~~~~~~~~l~~~~--pd~Vih   56 (290)
                      |.|||+|+||.+|+-+++.| ++|+.|.++-|+.-   |+                  .-.+........+-  -.+++-
T Consensus        80 ~~VlVvGatG~vG~~iv~~llkrgf~vra~VRd~~~a~~~~~~~~~d~~~~~v~~~~~~~~d~~~~~~~~~~~~~~~v~~  159 (411)
T KOG1203          80 TTVLVVGATGKVGRRIVKILLKRGFSVRALVRDEQKAEDLLGVFFVDLGLQNVEADVVTAIDILKKLVEAVPKGVVIVIK  159 (411)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHCCCCCCCCCCEEEECCCCCCCHHHHHHHHCCCCCEEEEE
T ss_conf             74999558873639999999977970234215736554443253334442224302256541225666301345315874


Q ss_pred             CCCCCCCCCCCC-CCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCHHHHHHH
Q ss_conf             863445432233-2210242012221100011223333-33445532111357554421111222211---101245666
Q gi|254780921|r   57 PAAYTAVDKAED-EPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLN---IYGKSKLAG  131 (290)
Q Consensus        57 ~Aa~~~~~~~e~-~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~---~Yg~sK~~~  131 (290)
                      |++-. +   |. |-...+++..+|+.|+.++|+..|+ +++++|+-.   +..-     +.++++..   .+-..|+.+
T Consensus       160 ~~ggr-p---~~ed~~~p~~VD~~g~knlvdA~~~aGvk~~vlv~si~---~~~~-----~~~~~~~~~~~~~~~~k~~~  227 (411)
T KOG1203         160 GAGGR-P---EEEDIVTPEKVDYEGTKNLVDACKKAGVKRVVLVGSIG---GTKF-----NQPPNILLLNGLVLKAKLKA  227 (411)
T ss_pred             CCCCC-C---CCCCCCCCCEECHHHHHHHHHHHHHHCCCEEEEEEEEC---CCCC-----CCCCHHHHHHHHHHHHHHHH
T ss_conf             23477-8---75457884421678889999999983874599997634---7646-----77725555544356787769


Q ss_pred             HHHHCCCCCCCCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCE
Q ss_conf             65310122232235554200036863200020112466521530455454452236899999999844202443344313
Q gi|254780921|r  132 EEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIF  211 (290)
Q Consensus       132 E~~v~~~~~~~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giy  211 (290)
                      |+++.+.+-+|.|+|++..+-..+..-...+.   ..........-  ---+...|+|+.+..++.+.....+.-   ++
T Consensus       228 e~~~~~Sgl~ytiIR~g~~~~~~~~~~~~~~~---~~~~~~~~~~~--~~~i~r~~vael~~~all~~~~~~~k~---~~  299 (411)
T KOG1203         228 EKFLQDSGLPYTIIRPGGLEQDTGGQREVVVD---DEKELLTVDGG--AYSISRLDVAELVAKALLNEAATFKKV---VE  299 (411)
T ss_pred             HHHHHHCCCCCEEEECCCCCCCCCCCCEECCC---CCCCCCCCCCC--CEEEEHHHHHHHHHHHHHHHHHCCCEE---EE
T ss_conf             99998658986799532100488871011145---74211233455--325611468999999873024132416---88


Q ss_pred             EEECCCCCCCHHH
Q ss_conf             7623866678899
Q gi|254780921|r  212 HMTADGGPVSWAD  224 (290)
Q Consensus       212 n~~~~~~~~s~~e  224 (290)
                      .....+++-++++
T Consensus       300 ~v~~~~gpg~~~~  312 (411)
T KOG1203         300 LVLKPEGPGRPYK  312 (411)
T ss_pred             EECCCCCCCCCHH
T ss_conf             6047899985179


No 189
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.11  E-value=1.6e-10  Score=78.51  Aligned_cols=129  Identities=23%  Similarity=0.298  Sum_probs=89.4

Q ss_pred             EEEEECCCC--HHHHHHHHHH-HCCCEEEEECHH--------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             499997889--7889999999-649859996136--------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNG--QIAQSLSSMC-VQDVEIIRVGRP--------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G--~iG~~l~~~l-~~~~~v~~~~r~--------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      ++||||++|  =||.++++.| .+|.+|+.++++                    ++|++|++++++++++.     +.|+
T Consensus         7 ~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~~~~~~~~l~~~~g~~~~~~~Dvs~~~~v~~~~~~i~~~~G~iDi   86 (274)
T PRK08415          7 KGLIVGVANNKSIAYGIAKACFEQGAELAFTYLNDALKKRVEPIAQELGSPYVYELDVSKEEHFKSLAESIKKDLGEIDF   86 (274)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             79998999983799999999998699999984887899999999986299769990289999999999999998589888


Q ss_pred             EEECCCCCCC--------CCCCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9978634454--------322332210242012221100011223---33333445532111357554421111222211
Q gi|254780921|r   54 IINPAAYTAV--------DKAEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN  122 (290)
Q Consensus        54 Vih~Aa~~~~--------~~~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~  122 (290)
                      +||.|++...        +..+.+.+..+++|+.++..+++.+..   .+..+|.+||..   +....|        ..+
T Consensus        87 lVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~~~~~m~~~GsIi~iss~~---~~~~~p--------~~~  155 (274)
T PRK08415         87 IVHSVAFAPKEALEGSFLETSKEAFDIAMEISVYSLIELTRALLPLLNDGGSVLTLSYLG---GVKYVP--------HYN  155 (274)
T ss_pred             EEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC---CCCCCC--------CCH
T ss_conf             853355576433468733389999999999999999999999998743079876422024---656666--------300


Q ss_pred             CCHHHHHHHHHHHCCCCCC
Q ss_conf             1012456666531012223
Q gi|254780921|r  123 IYGKSKLAGEEKVASYTNN  141 (290)
Q Consensus       123 ~Yg~sK~~~E~~v~~~~~~  141 (290)
                      .|+.+|.+.+.+.+..+..
T Consensus       156 ~y~asKaal~~ltk~lA~E  174 (274)
T PRK08415        156 VMGVAKAALESSVRYLAVD  174 (274)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             3677789999999999999


No 190
>PRK06947 glucose-1-dehydrogenase; Provisional
Probab=99.11  E-value=7.7e-11  Score=80.22  Aligned_cols=128  Identities=21%  Similarity=0.200  Sum_probs=90.3

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEE-CHH---------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             999978897889999999-649859996-136---------------------70878999999999755-----99899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRV-GRP---------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~-~r~---------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      +|||||++=||+++++.| .+|++|... .|+                     ++|++|.+++++++++.     ++|++
T Consensus         9 alVTGa~~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~iD~l   88 (252)
T PRK06947          9 VLITGASRGIGRATAVLAAARGWSVGINYARDAAAAEETADAVRAAGGRACVVAGDVANEADVIAMFDAVQAAFGRLDAL   88 (252)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99938835899999999998799899980898789999999999649928999847999999999999999984998899


Q ss_pred             EECCCCCCC-----CCCCCCCCEEEEECCCCCCCCCCCCC----C----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             978634454-----32233221024201222110001122----3----3333344553211135755442111122221
Q gi|254780921|r   55 INPAAYTAV-----DKAEDEPEIAFSINAEGAGAIAKAAD----S----IGIPCIYISTDYVFDGLSRTPIDEFSPTNPL  121 (290)
Q Consensus        55 ih~Aa~~~~-----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~----~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~  121 (290)
                      ||.||+..+     +..+.+.+..+++|+.++-.+++.+.    +    .+..+|++||..-+-|   .|       ++.
T Consensus        89 VnNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~~~~~~g~IinisS~~~~~~---~~-------~~~  158 (252)
T PRK06947         89 VNNAGIVAPSMPLADMDAARLRRMFDTNVLGAYLCAREAARRLSTDRGGRGGAIVNVSSIASRLG---SP-------NEY  158 (252)
T ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEHHHCCC---CC-------CCH
T ss_conf             98764357999812399999999999985799999999999999845799858999856654558---88-------730


Q ss_pred             CCCHHHHHHHHHHHCCCCC
Q ss_conf             1101245666653101222
Q gi|254780921|r  122 NIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       122 ~~Yg~sK~~~E~~v~~~~~  140 (290)
                      ..|+.+|.+.+.+.+..+.
T Consensus       159 ~~Y~~sK~al~~ltr~lA~  177 (252)
T PRK06947        159 VDYAGSKGAVDTLTLGLAK  177 (252)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             6679999999999999999


No 191
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.10  E-value=1.8e-10  Score=78.22  Aligned_cols=129  Identities=18%  Similarity=0.208  Sum_probs=88.1

Q ss_pred             EEEEECCCC--HHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             499997889--7889999999-6498599961367--------------------0878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNG--QIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G--~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      ++||||++|  =||.++++.| .+|.+|+.+.|++                    +|++|.+++++++++.     +.|+
T Consensus         9 ~alITGaa~~~GIG~aiA~~La~~GA~V~i~~~~e~~~~~~~~~~~~~g~~~~~~~Dvsd~~~v~~~v~~~~~~~G~iDi   88 (271)
T PRK06505          9 RGLIMGVANDHSIAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAESLGSDLVLPCDVEDIASVDAVFEALEKKWGKLDF   88 (271)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             79997999985499999999998699999981866889999999996498189983799999999999999998399878


Q ss_pred             EEECCCCCCCC--------CCCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99786344543--------22332210242012221100011223---33333445532111357554421111222211
Q gi|254780921|r   54 IINPAAYTAVD--------KAEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN  122 (290)
Q Consensus        54 Vih~Aa~~~~~--------~~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~  122 (290)
                      +||+|++....        ..+.+.+..+.+|..++..+++.+..   .+-.+|.+||....   ...|        ..+
T Consensus        89 LVnnAG~~~~~~~~~~~~d~~~e~~~~~~~~n~~~~~~~~~~~~~~~~~~Gsii~iss~~~~---~~~p--------~~~  157 (271)
T PRK06505         89 VVHAIGFSDKNELKGRYADTTRENFSRTMVISCFSFTEIAKRAAKLMPDGGSMLTLTYGGST---RVMP--------NYN  157 (271)
T ss_pred             EEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCC---CCCC--------CCC
T ss_conf             98566446754444541226799999999999799999999860012678860246325434---4578--------741


Q ss_pred             CCHHHHHHHHHHHCCCCCC
Q ss_conf             1012456666531012223
Q gi|254780921|r  123 IYGKSKLAGEEKVASYTNN  141 (290)
Q Consensus       123 ~Yg~sK~~~E~~v~~~~~~  141 (290)
                      .|+.+|.+.+.+.+..+..
T Consensus       158 ~Y~asKaal~~ltr~lA~e  176 (271)
T PRK06505        158 VMGVAKAALEASVRYLAAD  176 (271)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             3478787799999999999


No 192
>PRK08628 short chain dehydrogenase; Provisional
Probab=99.10  E-value=1.1e-10  Score=79.29  Aligned_cols=129  Identities=16%  Similarity=0.074  Sum_probs=93.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             4999978897889999999-6498599961367--------------------0878999999999755-----998999
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      .+|||||++=||.++++.| .+|..|+.++|++                    +|++|++.+++++++.     +.|++|
T Consensus         9 valVTG~s~GIG~a~a~~la~~Ga~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~v~~~~~~~g~iDiLV   88 (258)
T PRK08628          9 VVIVTGGASGIGAAISLRLAEEGAIPVVFGRSAPDDEFAEELRALQPRAEFVQVDLQDDAQCRDAVAQTVAKFGRIDGLV   88 (258)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             89992777789999999999879989998088023999999995399789999527999999999999999829988999


Q ss_pred             ECCCCCCCCC---CCCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             7863445432---233221024201222110001122----333333445532111357554421111222211101245
Q gi|254780921|r   56 NPAAYTAVDK---AEDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        56 h~Aa~~~~~~---~e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
                      |+|++.....   ...+.+..+++|+.++..+++++.    +.+-++|.+||..-+.+   .|        ....|+.+|
T Consensus        89 nnAGi~~~~~~e~~~e~~~~~~~~Nl~~~~~l~~~~~p~l~~~~GsIInisS~~a~~~---~~--------~~~~Y~asK  157 (258)
T PRK08628         89 NNAGVNDGVGLDAGRDAFVASLERNLIHYYVMAHYCLPHLKASRGAIVNISSKTALTG---QG--------GTSGYAAAK  157 (258)
T ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECHHCCCC---CC--------CCHHHHHHH
T ss_conf             8882278877789999999999987499999999999988854954999812210167---99--------848899999


Q ss_pred             HHHHHHHCCCCCC
Q ss_conf             6666531012223
Q gi|254780921|r  129 LAGEEKVASYTNN  141 (290)
Q Consensus       129 ~~~E~~v~~~~~~  141 (290)
                      .+...+.+..+..
T Consensus       158 aal~~ltr~lA~e  170 (258)
T PRK08628        158 GAQLGLTREWAVA  170 (258)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999999


No 193
>PRK08339 short chain dehydrogenase; Provisional
Probab=99.10  E-value=1.6e-10  Score=78.42  Aligned_cols=127  Identities=15%  Similarity=0.152  Sum_probs=94.4

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------------CCCCCHHHHHHHHHH----CCCCEEE
Q ss_conf             999978897889999999-6498599961367----------------------087899999999975----5998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------------IDLLKPKDFASFFLS----FSPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------------~D~~~~~~~~~~l~~----~~pd~Vi   55 (290)
                      +|||||++=||.++++.| .+|.+|+.++|++                      +|+++++.+++++++    .++|++|
T Consensus        11 alITG~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~~~v~~~~~~~~~~g~~dilv   90 (263)
T PRK08339         11 AFTTASSKGIGFGVARVLARAGADVIILSRNEENLKRAKEKIKSESDVEVHYIVADLTKREDLERTVKELKNIGDPDIFF   90 (263)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99916260999999999998699999997988999999999985049857999848999999999999999569998999


Q ss_pred             ECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             786344543----2233221024201222110001122----333-3334455321113575544211112222111012
Q gi|254780921|r   56 NPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        56 h~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      |+|+...+.    ....+.+..+++|+.++.++++++.    +.+ -++|++||.....+   .|        -...|+.
T Consensus        91 ~nag~~~~~~~~~~~~e~w~~~~~vnl~~~~~~~~~~~p~m~~~~~G~II~isS~a~~~~---~~--------~~~~y~a  159 (263)
T PRK08339         91 FSTGGPKPGYFMEMSMEDWEEAVKLLLYPAVYLTRALVPGMERKGFGRIIYSTSVAIKEP---IP--------NIALSNV  159 (263)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CC--------CHHHHHH
T ss_conf             899999998915599999999999986999999999987652438963999554243478---98--------6177899


Q ss_pred             HHHHHHHHHCCCCC
Q ss_conf             45666653101222
Q gi|254780921|r  127 SKLAGEEKVASYTN  140 (290)
Q Consensus       127 sK~~~E~~v~~~~~  140 (290)
                      +|.+.+.+.+..+.
T Consensus       160 sKaal~~ltk~lA~  173 (263)
T PRK08339        160 VRIAMAGLVRTLAK  173 (263)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999


No 194
>PRK06198 short chain dehydrogenase; Provisional
Probab=99.10  E-value=1.3e-10  Score=79.02  Aligned_cols=129  Identities=18%  Similarity=0.205  Sum_probs=94.4

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCE-EEEECHH---------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             4999978897889999999-64985-9996136---------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVE-IIRVGRP---------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~-v~~~~r~---------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      .+|||||++=||.++++.| .+|.+ |+.++|+                     ++|++|.++++++++..     +.|+
T Consensus         8 ~alVTGas~GIG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~fG~iDi   87 (268)
T PRK06198          8 IALVTGGTQGLGAAIARLFAERGAAGLVICGRSAEKGEAKAAELEALGAKAVFVQADLAKVEDCRAVVAAADEAFGRLDA   87 (268)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89995857789999999999879938999629888999999999954996799982689999999999999998399989


Q ss_pred             EEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9978634454----32233221024201222110001122----333--3334455321113575544211112222111
Q gi|254780921|r   54 IINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG--IPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        54 Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~--~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      +||+|++...    +..+.+.+..+++|+.++-.+++++.    +.+  -++|.+||-.-+.   ..|.        ...
T Consensus        88 LVNnAG~~~~~~~~~~~~e~w~~~~~vNl~~~~~~~~~~~~~m~~~~~~G~IVnisS~~~~~---~~~~--------~~~  156 (268)
T PRK06198         88 LVNAAGLTDRGTILDTSPELFDRMFAVNVRAPFFLMQEAIKLMRRRRAEGTIVNIGSMSAHG---GQPF--------IAA  156 (268)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHCC---CCCC--------CHH
T ss_conf             99899789999826599999999999872699999999999999759992799991545456---8998--------568


Q ss_pred             CHHHHHHHHHHHCCCCCC
Q ss_conf             012456666531012223
Q gi|254780921|r  124 YGKSKLAGEEKVASYTNN  141 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~~~  141 (290)
                      |+.+|.+...+.+..+..
T Consensus       157 Y~asKaal~~ltkslA~e  174 (268)
T PRK06198        157 YCASKGALATLTRNVAYA  174 (268)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999


No 195
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]
Probab=99.10  E-value=1.3e-10  Score=78.89  Aligned_cols=179  Identities=19%  Similarity=0.181  Sum_probs=105.1

Q ss_pred             EEEEECCCCHHHHHHHHHHH-CCCEEEEECHHH----------------------CCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             49999788978899999996-498599961367----------------------087899999999975-----59989
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRPD----------------------IDLLKPKDFASFFLS-----FSPDV   53 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~~----------------------~D~~~~~~~~~~l~~-----~~pd~   53 (290)
                      ++||||+|+=||.++++.|. +|++++-+.|++                      +|+++++.++.+...     .+.|+
T Consensus         8 ~~lITGASsGIG~~~A~~lA~~g~~liLvaR~~~kL~~la~~l~~~~~v~v~vi~~DLs~~~~~~~l~~~l~~~~~~Idv   87 (265)
T COG0300           8 TALITGASSGIGAELAKQLARRGYNLILVARREDKLEALAKELEDKTGVEVEVIPADLSDPEALERLEDELKERGGPIDV   87 (265)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHHCCCCCCE
T ss_conf             79997788648999999999779979999676999999999998730862799977678836799999999824885238


Q ss_pred             EEECCCCCCCC-CCC---CCCCEEEEECCCCCCCCCCC----CCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99786344543-223---32210242012221100011----223333-3344553211135755442111122221110
Q gi|254780921|r   54 IINPAAYTAVD-KAE---DEPEIAFSINAEGAGAIAKA----ADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        54 Vih~Aa~~~~~-~~e---~~~~~~~~~Nv~~~~~l~~~----~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      +||+||+.... .++   .+-+..+++|+.++..|..+    ..+.+. .+|.|+|-.=|   ...|+        .+.|
T Consensus        88 LVNNAG~g~~g~f~~~~~~~~~~mi~lN~~a~~~LT~~~lp~m~~~~~G~IiNI~S~ag~---~p~p~--------~avY  156 (265)
T COG0300          88 LVNNAGFGTFGPFLELSLDEEEEMIQLNILALTRLTKAVLPGMVERGAGHIINIGSAAGL---IPTPY--------MAVY  156 (265)
T ss_pred             EEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHC---CCCCC--------HHHH
T ss_conf             997787477665421885899999999999999999999999986589669998434532---88863--------2799


Q ss_pred             HHHHHHHHH----HHCCCCCCCCCCCCCCCE-ECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             124566665----310122232235554200-036863200020112466521530455454452236899999999844
Q gi|254780921|r  125 GKSKLAGEE----KVASYTNNYVILRTAWVY-SIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNL  199 (290)
Q Consensus       125 g~sK~~~E~----~v~~~~~~~~IlR~~~vy-G~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~  199 (290)
                      +.||...=.    +-.+.....+  +...|. ||-..+|.. - . . .+.......   ...+..+|+|+..+..+.+.
T Consensus       157 ~ATKa~v~~fSeaL~~EL~~~gV--~V~~v~PG~~~T~f~~-~-~-~-~~~~~~~~~---~~~~~~~~va~~~~~~l~~~  227 (265)
T COG0300         157 SATKAFVLSFSEALREELKGTGV--KVTAVCPGPTRTEFFD-A-K-G-SDVYLLSPG---ELVLSPEDVAEAALKALEKG  227 (265)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCE--EEEEEECCCCCCCCCC-C-C-C-CCCCCCCCH---HHCCCHHHHHHHHHHHHHCC
T ss_conf             99999999999999998358984--9999965733355333-4-4-4-432112321---23069999999999998509


Q ss_pred             H
Q ss_conf             2
Q gi|254780921|r  200 I  200 (290)
Q Consensus       200 ~  200 (290)
                      .
T Consensus       228 k  228 (265)
T COG0300         228 K  228 (265)
T ss_pred             C
T ss_conf             8


No 196
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.09  E-value=1.6e-10  Score=78.45  Aligned_cols=128  Identities=17%  Similarity=0.168  Sum_probs=94.7

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEEECC
Q ss_conf             999978897889999999-6498599961367------------------0878999999999755-----998999786
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVIINPA   58 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vih~A   58 (290)
                      .||||++.=||.++++.| .+|.+|+++++++                  +|+++.+.++++++..     +.|++||.|
T Consensus       210 ALVTGAArGIG~AIA~~LAreGA~VVi~Di~~a~~~l~~~a~elgg~al~~DVt~~~a~~~lv~~~~~~~G~lDILVnNA  289 (447)
T PRK08261        210 ALVTGAARGIGAAIAEVLARDGAHVVCLDVPQAGDDLAAVAARLGGTALALDITAPDAPAKIAEHLAERHGGLDIVVHNA  289 (447)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             99917257899999999998699999982711489999999870980899536899999999999999649998999899


Q ss_pred             CCCCC----CCCCCCCCEEEEECCCCCCCCCCCCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             34454----322332210242012221100011223-----333334455321113575544211112222111012456
Q gi|254780921|r   59 AYTAV----DKAEDEPEIAFSINAEGAGAIAKAADS-----IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        59 a~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~~-----~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~  129 (290)
                      +++..    +..+.+.+..+++|+.++..+.+++..     .+-++|.+||..-+-|..           ....|+.||.
T Consensus       290 Gi~~~~~l~~~~~e~Wd~v~~vNl~g~~~l~qall~~m~~~~gG~IVnIsSiag~~g~~-----------g~~~YaaSKa  358 (447)
T PRK08261        290 GITRDKTLANMDEARWDSVIAVNLLAPLRITEALLDNGALGDGGRIVCVSSISGIAGNR-----------GQTNYAASKA  358 (447)
T ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCEECCCCCC-----------CCHHHHHHHH
T ss_conf             78999771119999999999998699999999999977654795799850200046788-----------7428799999


Q ss_pred             HHHHHHCCCCCC
Q ss_conf             666531012223
Q gi|254780921|r  130 AGEEKVASYTNN  141 (290)
Q Consensus       130 ~~E~~v~~~~~~  141 (290)
                      +...+.+..+..
T Consensus       359 Av~~ltrslA~e  370 (447)
T PRK08261        359 GVIGLVQALAPL  370 (447)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 197
>PRK06500 short chain dehydrogenase; Provisional
Probab=99.09  E-value=1.6e-10  Score=78.40  Aligned_cols=128  Identities=14%  Similarity=0.104  Sum_probs=93.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEEEC
Q ss_conf             4999978897889999999-6498599961367------------------0878999999999755-----99899978
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVIINP   57 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vih~   57 (290)
                      .+|||||++=||.++++.| .+|.+|+.++|++                  +|++|.++++++++..     +.|++||.
T Consensus         8 ~~lITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iDiLvnn   87 (249)
T PRK06500          8 TALITGGTSGIGLETARQFAAEGARVAITGRDAATLEAARAELGEDALVIRNDAGSVAAQRALAQALAEAGGRLDAVFIN   87 (249)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEC
T ss_conf             89993768789999999999879999999699899999999858975999951799999999999999976999899989


Q ss_pred             CCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             6344543----22332210242012221100011223---3333344553211135755442111122221110124566
Q gi|254780921|r   58 AAYTAVD----KAEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLA  130 (290)
Q Consensus        58 Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~  130 (290)
                      ||.....    ..+.+.+..+++|+.++-.+++++..   .+..+|.+||....   ...|        ....|+.+|.+
T Consensus        88 AG~~~~~~~~~~~~e~w~~~~~vNl~~~f~~~~~~~p~m~~~g~iI~~sS~~~~---~~~~--------~~~aY~asKaa  156 (249)
T PRK06500         88 AGVAKFAPLEDWDEAMFDRSFNTNVKGPYFLIQALLPLLNNPASIVLNGSINAH---IGMP--------NSSVYAASKAA  156 (249)
T ss_pred             CCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECEEE---ECCC--------CCHHHHHHHHH
T ss_conf             987899991669999999999986456999999999986229818998223076---1689--------73778999999


Q ss_pred             HHHHHCCCCC
Q ss_conf             6653101222
Q gi|254780921|r  131 GEEKVASYTN  140 (290)
Q Consensus       131 ~E~~v~~~~~  140 (290)
                      .+.+.+..+.
T Consensus       157 l~~ltk~lA~  166 (249)
T PRK06500        157 LLSLAKTLSG  166 (249)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999999


No 198
>PRK06197 short chain dehydrogenase; Provisional
Probab=99.09  E-value=3e-10  Score=76.88  Aligned_cols=138  Identities=19%  Similarity=0.152  Sum_probs=92.9

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH-----------------------HCCCCCHHHHHHHHHH-----CCCCE
Q ss_conf             999978897889999999-649859996136-----------------------7087899999999975-----59989
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-----------------------DIDLLKPKDFASFFLS-----FSPDV   53 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-----------------------~~D~~~~~~~~~~l~~-----~~pd~   53 (290)
                      ++||||++=||.+.++.| ..|++|+...|+                       ++|+.+.++++++.++     .+.|+
T Consensus        19 ~lITGa~sGIG~~~A~~La~~ga~Vil~~R~~~k~~~a~~~i~~~~~~~~i~~~~lDLssl~sV~~~a~~~~~~~~~lDv   98 (306)
T PRK06197         19 AVVTGANTGLGYETAAALAAKGAHVVLAVRNLDKGNAAAARITAAHPGADVTLQELDLASLASVRAAADALRAAYPRIDL   98 (306)
T ss_pred             EEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCCCE
T ss_conf             99916895999999999997849899997989999999999997689985799976643077899999999961898768


Q ss_pred             EEECCCCCCCCC--CCCCCCEEEEECCCCCCCC----CCCCCC-CCCCCCCCCCCCC-CCCCCCC-CCCCCCCCCCCCCC
Q ss_conf             997863445432--2332210242012221100----011223-3333344553211-1357554-42111122221110
Q gi|254780921|r   54 IINPAAYTAVDK--AEDEPEIAFSINAEGAGAI----AKAADS-IGIPCIYISTDYV-FDGLSRT-PIDEFSPTNPLNIY  124 (290)
Q Consensus        54 Vih~Aa~~~~~~--~e~~~~~~~~~Nv~~~~~l----~~~~~~-~~~~~I~iSS~~V-y~g~~~~-p~~E~d~~~P~~~Y  124 (290)
                      +||.||+..+..  .+...+..+.+|..|.--|    +...+. .+.|+|.+||..= +.+.-+. ....+...+|...|
T Consensus        99 LinNAGi~~~~~~~T~dG~E~~f~vN~lghflLt~lLl~~l~~~~~~RIV~vsS~~h~~~~~~~~ddl~~~~~y~~~~aY  178 (306)
T PRK06197         99 LINNAGVMYTPKQTTADGFELQFGTNHLGHFALTGLLLDRLLPVPGSRVVTVSSGGHRIRAAIHFDDLQWERRYNRVAAY  178 (306)
T ss_pred             EEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECHHHHCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             99778445688722676533333331368888888777875315788269994457605778884245765678747888


Q ss_pred             HHHHHHHHHHHCCCCC
Q ss_conf             1245666653101222
Q gi|254780921|r  125 GKSKLAGEEKVASYTN  140 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~  140 (290)
                      +.||++.-.+.+++..
T Consensus       179 ~~SKLanilft~eL~r  194 (306)
T PRK06197        179 GQSKLANLLFTYELQR  194 (306)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             8889999999999999


No 199
>PRK07062 short chain dehydrogenase; Provisional
Probab=99.09  E-value=2e-10  Score=77.93  Aligned_cols=128  Identities=16%  Similarity=0.153  Sum_probs=93.3

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-----------------------CCCCCHHHHHHHHHH-----CCCC
Q ss_conf             4999978897889999999-6498599961367-----------------------087899999999975-----5998
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-----------------------IDLLKPKDFASFFLS-----FSPD   52 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-----------------------~D~~~~~~~~~~l~~-----~~pd   52 (290)
                      .+|||||++=||.++++.| .+|.+|+.++|++                       +|++|++++++++++     -+.|
T Consensus        10 ~alITG~s~GIG~a~a~~la~~Ga~Vvi~~r~~~~l~~~~~~l~~~~~~~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iD   89 (265)
T PRK07062         10 VAVVTGGSSGIGLATVELLLEAGASVAICGRDEERLASAEARLREKFPGARLLAARCDVLDEADVAAFAAAVEARFGGVD   89 (265)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             89995757799999999999879999999798899999999998736996599997579999999999999999839988


Q ss_pred             EEEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99978634454----322332210242012221100011223----33-3334455321113575544211112222111
Q gi|254780921|r   53 VIINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAADS----IG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        53 ~Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~~----~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      ++||+|+....    +..+.+.+..+++|+.++-++++++..    .+ .++|.+||...+.+   .|        ....
T Consensus        90 iLVnNAg~~~~~~~~~~~~e~w~~~~~~nl~~~~~~~~~~~p~m~~~~~G~IInisS~~~~~~---~~--------~~~~  158 (265)
T PRK07062         90 MLVNNAGQGRVSTFADTTDDAWRDELELKYFSVIRPTRAFLPLLRASAAPSITCVNSLLALQP---EP--------HMVA  158 (265)
T ss_pred             EEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCC---CC--------CCHH
T ss_conf             899778888988848799999999998721458999999999999629962999934423578---99--------9689


Q ss_pred             CHHHHHHHHHHHCCCCC
Q ss_conf             01245666653101222
Q gi|254780921|r  124 YGKSKLAGEEKVASYTN  140 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~~  140 (290)
                      |+.+|.+...+.+..+.
T Consensus       159 Y~asKaal~~ltk~lA~  175 (265)
T PRK07062        159 TSAARAGLLNLVKSLAT  175 (265)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999


No 200
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.08  E-value=3e-10  Score=76.93  Aligned_cols=129  Identities=19%  Similarity=0.280  Sum_probs=90.0

Q ss_pred             EEEEECCCC--HHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             499997889--7889999999-6498599961367--------------------0878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNG--QIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G--~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      ++||||++|  =||..+++.| .+|.+|+...|.+                    +|++|+++++++++..     +.|+
T Consensus        12 ~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~~~~~~~~l~~~~g~~~~~~~Dvtd~~~v~~~v~~~~~~~G~iDi   91 (272)
T PRK08159         12 RGLILGVANNRSIAWGIAKACRAAGAELAFTYQGDALKKRVEPLAAELGAFVVGHCDVTDEASIDAVFETLEKKWGKLDF   91 (272)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             99998899986899999999998699999974866899999999986498189983789999999999999998699788


Q ss_pred             EEECCCCCCC--------CCCCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9978634454--------322332210242012221100011223---33333445532111357554421111222211
Q gi|254780921|r   54 IINPAAYTAV--------DKAEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN  122 (290)
Q Consensus        54 Vih~Aa~~~~--------~~~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~  122 (290)
                      +||+|+++..        +..+.+....+.+|+.+...+++.+..   .+..+|.+||..   +....|        ..+
T Consensus        92 LVnnag~~~~~~~~~~~~d~~~~~~~~~~~vn~~~~~~~~~~~~~~m~~ggsIv~iss~~---~~~~~p--------~~~  160 (272)
T PRK08159         92 VVHAIGFSDKDELTGRYVDTSEDNFSMTMLISVYSLTAVAQRAEKLMTDGGSILTLTYYG---AEKVMP--------HYN  160 (272)
T ss_pred             EEECCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEC---CCCCCC--------CCC
T ss_conf             985354466644566543288999999998886899999988765404787034787541---233477--------520


Q ss_pred             CCHHHHHHHHHHHCCCCCC
Q ss_conf             1012456666531012223
Q gi|254780921|r  123 IYGKSKLAGEEKVASYTNN  141 (290)
Q Consensus       123 ~Yg~sK~~~E~~v~~~~~~  141 (290)
                      .|+.+|.+.+.+.+..+..
T Consensus       161 ~y~~sKaAl~~ltr~lA~e  179 (272)
T PRK08159        161 VMGVAKAALEASVRYLAVD  179 (272)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             2567899999999999997


No 201
>PRK08936 glucose-1-dehydrogenase; Provisional
Probab=99.08  E-value=1.4e-10  Score=78.77  Aligned_cols=127  Identities=16%  Similarity=0.102  Sum_probs=92.3

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             999978897889999999-649859996136----------------------70878999999999755-----99899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      +|||||++=||+++++.| .+|.+|+...+.                      ++|++|.+++++++++.     +.|++
T Consensus        10 alVTGa~~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iDiL   89 (261)
T PRK08936         10 VVITGGSTGLGRAMAVRFGKEKAKVVINYRSDESEANDVAEEIKKVGGEAIAVKGDVTVESDVVNLIQSAVKEFGTLDVM   89 (261)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99968477899999999998799999972898789999999999659938999827999999999999999982998899


Q ss_pred             EECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCC----CCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9786344543----223322102420122211000112----2333--33344553211135755442111122221110
Q gi|254780921|r   55 INPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAA----DSIG--IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        55 ih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~----~~~~--~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      ||.||.....    ..+.+.+..+++|+.++-.+++.+    .+.+  -++|.+||..-.     .+.      .+...|
T Consensus        90 VNNAg~~~~~~~~~~~~e~w~~~~~iNl~~~f~~~k~~~~~m~~~~~~G~IInisS~~~~-----~~~------~~~~~Y  158 (261)
T PRK08936         90 INNAGIENAVPSHEMPLEDWNKVINTNLTGAFLGSREAIKYFVEHDIKGSIINMSSVHEQ-----IPW------PLFVHY  158 (261)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEHHCC-----CCC------CCCCHH
T ss_conf             989978999881339999999999997164999999999999981886147887331005-----789------986007


Q ss_pred             HHHHHHHHHHHCCCCC
Q ss_conf             1245666653101222
Q gi|254780921|r  125 GKSKLAGEEKVASYTN  140 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~  140 (290)
                      +.+|.+.+.+.+..+.
T Consensus       159 ~asKaav~~ltk~lA~  174 (261)
T PRK08936        159 AASKGGVKLMTETLAM  174 (261)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999


No 202
>PRK07074 short chain dehydrogenase; Provisional
Probab=99.08  E-value=1.4e-10  Score=78.77  Aligned_cols=127  Identities=17%  Similarity=0.162  Sum_probs=92.7

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------------------CCCCCHHHHHHHHHH----CCCCEEEECC
Q ss_conf             999978897889999999-6498599961367-------------------087899999999975----5998999786
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------------------IDLLKPKDFASFFLS----FSPDVIINPA   58 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------------------~D~~~~~~~~~~l~~----~~pd~Vih~A   58 (290)
                      +|||||++-||+++++.| .+|.+|+.++|++                   +|++|.+.++.+.+.    -++|++||.|
T Consensus         5 alITGgs~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~l~~~~~~~~~~Dv~~~~~~~~~~~~i~~~g~iDiLVNNA   84 (256)
T PRK07074          5 ALVTGAAGGIGQALARRFLAAGDRVLALDIDRAALAAFVDALGDAAVAPVICDLTDAASVERLAAALANEGPVDVLVANA   84 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             99988468999999999998699999997988999999998269977999972799999999999999859987999888


Q ss_pred             CCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             34454----32233221024201222110001122----333-3334455321113575544211112222111012456
Q gi|254780921|r   59 AYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        59 a~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~  129 (290)
                      +....    +....+.+..+++|+.++-.+++++.    +.+ -++|++||..-+.+     .     ..|  .|+.+|.
T Consensus        85 G~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IInisS~~~~~~-----~-----~~~--~Y~asKa  152 (256)
T PRK07074         85 GAARAATLHDTTSASWRADNALNLEATYLCVEAVEAGMKARSRGAIVNIGSVNGMAA-----L-----GHP--AYSAAKA  152 (256)
T ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCC-----C-----CCH--HHHHHHH
T ss_conf             778998915599999999999985999999999999998759976999966565676-----8-----857--8999999


Q ss_pred             HHHHHHCCCCCC
Q ss_conf             666531012223
Q gi|254780921|r  130 AGEEKVASYTNN  141 (290)
Q Consensus       130 ~~E~~v~~~~~~  141 (290)
                      +...+.+..+..
T Consensus       153 al~~ltk~lA~e  164 (256)
T PRK07074        153 GLISYTKSLAIE  164 (256)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 203
>PRK08226 short chain dehydrogenase; Provisional
Probab=99.08  E-value=1.6e-10  Score=78.45  Aligned_cols=128  Identities=17%  Similarity=0.207  Sum_probs=93.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             4999978897889999999-6498599961367--------------------0878999999999755-----998999
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      .+|||||++=||.++++.| .+|.+|+.+++++                    +|++|++++++++++.     +.|++|
T Consensus         8 valVTGas~GIG~aiA~~la~~Ga~Vvi~d~~~~~~~~~~~~~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G~iDiLV   87 (263)
T PRK08226          8 TALITGALQGIGEGIARVFARHGANLILLDISPEIEKLADELCGRGHRCTAVVADVRDPASVAAAIKRAKEKEGRIDILV   87 (263)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             89994737799999999999879989999698799999999983699179999417999999999999999839986999


Q ss_pred             ECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             78634454----32233221024201222110001122----333-3334455321-11357554421111222211101
Q gi|254780921|r   56 NPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDY-VFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        56 h~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~-Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      |.|++...    +..+.+.+..+++|+.++-++++++.    +.+ -++|.+||.. .+.+   .|        ....|+
T Consensus        88 NNAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IInisS~~g~~~~---~~--------~~~~Y~  156 (263)
T PRK08226         88 NNAGVCRLGNFLDMSDEDRDFHIDINIKGVWNVTKAVLPEMIARKDGRIVMMSSVTGDMVA---DP--------GETAYA  156 (263)
T ss_pred             ECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHCCCC---CC--------CCHHHH
T ss_conf             8997789999012999999999999729999999999999998389989999765330448---99--------738899


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+...+.+..+.
T Consensus       157 asKaav~~lTr~lA~  171 (263)
T PRK08226        157 LTKAAIVGLTKSLAV  171 (263)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 204
>PRK06114 short chain dehydrogenase; Provisional
Probab=99.08  E-value=1.6e-10  Score=78.41  Aligned_cols=129  Identities=16%  Similarity=0.079  Sum_probs=92.3

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             999978897889999999-649859996136----------------------70878999999999755-----99899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      +|||||++-||.++++.| .+|.+|+.++++                      .+|++|++++++++++.     +.|++
T Consensus        19 alVTGa~~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiL   98 (262)
T PRK06114         19 AFVTGAGSGIGQRIAIGLAQAGADVALFDLRTDDGLAETAEHIEAAGRRAIQIAADVTSKSDLAAAVARTEAELGALTLA   98 (262)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99968478999999999998799899995897469999999999659958999816899999999999999981999899


Q ss_pred             EECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             9786344543----223322102420122211000112----2333-333445532111357554421111222211101
Q gi|254780921|r   55 INPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAA----DSIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        55 ih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~----~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      ||+|++....    ..+.+.+..+++|+.++-.+++++    .+.+ -++|.+||..-+-+  ...       -+...|+
T Consensus        99 VNnAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~m~~~~~G~IVnisS~~g~~~--~~g-------~~~~~Y~  169 (262)
T PRK06114         99 VNAAGIANANPAEEMEEEQWQTVMDINLTGVFLSCQAEARAMLENGGGSIVNIASMSGVIV--NRG-------LLQAHYN  169 (262)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHCCC--CCC-------CCHHHHH
T ss_conf             9899899998815599999999999973669999999999999728978999786223047--888-------5318899


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+...+.+..+.
T Consensus       170 asKaav~~lTr~lA~  184 (262)
T PRK06114        170 ASKAGVIHMSKSLAM  184 (262)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 205
>PRK06128 oxidoreductase; Provisional
Probab=99.08  E-value=2e-10  Score=77.91  Aligned_cols=128  Identities=18%  Similarity=0.134  Sum_probs=92.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECH--H---------------------HCCCCCHHHHHHHHHH-----CCCC
Q ss_conf             4999978897889999999-64985999613--6---------------------7087899999999975-----5998
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGR--P---------------------DIDLLKPKDFASFFLS-----FSPD   52 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r--~---------------------~~D~~~~~~~~~~l~~-----~~pd   52 (290)
                      ++|||||++=||+++++.| .+|.+|+..++  .                     .+|++|++.+++++++     -+.|
T Consensus        57 vAlVTGgssGIG~AiA~~lA~eGA~Vvi~~~~~~~~~a~~~~~~i~~~G~~a~~v~~Dvsd~~~~~~~v~~~~~~~G~iD  136 (300)
T PRK06128         57 KALITGADSGIGRATAIAFAREGADIVLNYLPEEEQDAAEVVQLIQAEGRKAVAVPGDLKDEAFCRQLVERAVKELGGLD  136 (300)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             58991736699999999999869999994299556789999999996598189997478999999999999999809999


Q ss_pred             EEEECCCCCCC-----CCCCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99978634454-----322332210242012221100011223---3333344553211135755442111122221110
Q gi|254780921|r   53 VIINPAAYTAV-----DKAEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        53 ~Vih~Aa~~~~-----~~~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      ++||.||....     +..+.+.+..+++|+.++-.+++++..   .+.++|.+||..-+.+.   |        -...|
T Consensus       137 iLVNNAG~~~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~aa~p~m~~gGsIInisSi~~~~~~---~--------~~~~Y  205 (300)
T PRK06128        137 ILVNIAGKQTARKDIADITTEQFDATFKTNVYAMFWLCKAAIPHLPPGASIINTGSIQSYQPS---P--------TLLDY  205 (300)
T ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCC---C--------CCHHH
T ss_conf             899899997789991779999999998661158999999999987538714787421240578---8--------61778


Q ss_pred             HHHHHHHHHHHCCCCC
Q ss_conf             1245666653101222
Q gi|254780921|r  125 GKSKLAGEEKVASYTN  140 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~  140 (290)
                      +.+|.+...+.+..+.
T Consensus       206 ~asKaav~~lTrslA~  221 (300)
T PRK06128        206 ASTKAAIVNFTKGLAQ  221 (300)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999


No 206
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.08  E-value=2.6e-10  Score=77.25  Aligned_cols=179  Identities=15%  Similarity=0.156  Sum_probs=100.9

Q ss_pred             EEEEECCCC--HHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CC
Q ss_conf             499997889--7889999999-649859996136----------------------70878999999999755-----99
Q gi|254780921|r    2 KCLVIGNNG--QIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SP   51 (290)
Q Consensus         2 kiLVtG~~G--~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~p   51 (290)
                      .+||||++|  =||.++++.| .+|.+|+.++|.                      ++|++|++++++++++.     +.
T Consensus         8 ~~lVTGaag~rGIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~g~i   87 (256)
T PRK08594          8 TYVVMGVANKRSIAWGIARSLHNAGAKLVFTYAGERLEKEVRELAETLEQQESLVLPCDVTSDEEITACFETIKKEVGVI   87 (256)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             89998999996399999999998799999974880669999999987079947999913899999999999999985886


Q ss_pred             CEEEECCCCCCCCCCC-----CC---CCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             8999786344543223-----32---210242012221100011223---333334455321113575544211112222
Q gi|254780921|r   52 DVIINPAAYTAVDKAE-----DE---PEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNP  120 (290)
Q Consensus        52 d~Vih~Aa~~~~~~~e-----~~---~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P  120 (290)
                      |.++|++++...+...     .+   ....+.+|..+...+.+++..   .+..+|.+||..   +....        ..
T Consensus        88 d~lv~na~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GsIv~iss~~---~~~~~--------~~  156 (256)
T PRK08594         88 HGVAHCIAFANKEDLRGEFLETSRDGFLLAQNISAYSLTAVAREAKKLMTEGGSIVTLTYLG---GERVV--------QN  156 (256)
T ss_pred             CEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEC---CEECC--------CC
T ss_conf             74665321023444455300188999999885543677788888876535786699852001---11126--------87


Q ss_pred             CCCCHHHHHHHHHHHCCCCCCC---CC----CCCCCCEECCCCCC--CCEEECCCCCCCCEEECCCCCCCCCCHHHHHHH
Q ss_conf             1110124566665310122232---23----55542000368632--000201124665215304554544522368999
Q gi|254780921|r  121 LNIYGKSKLAGEEKVASYTNNY---VI----LRTAWVYSIFGSNF--LLSMLRLAKERREISVVCDQFGTPTSALQIARA  191 (290)
Q Consensus       121 ~~~Yg~sK~~~E~~v~~~~~~~---~I----lR~~~vyG~~~~~~--v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~  191 (290)
                      .+.|+.+|.+.+.+.+..+..+   -|    +.|+.+..+....+  ...+++...++.++.    .++   ..+|+|++
T Consensus       157 ~~~y~asKaal~~ltr~lA~ela~~gIRVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~Pl~----R~g---~pediA~~  229 (256)
T PRK08594        157 YNVMGVAKASLEASVKYLANDLGKDGIRVNAISAGPIRTLSAKGVGGFNSILKEIEERAPLR----RTT---TQEEVGDT  229 (256)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHCCCCHHHHHHHHHCCCCC----CCC---CHHHHHHH
T ss_conf             41357789999999999999853888399998637787712331557399999999679999----996---99999999


Q ss_pred             HHHHHHH
Q ss_conf             9999984
Q gi|254780921|r  192 IIQIAHN  198 (290)
Q Consensus       192 i~~~~~~  198 (290)
                      +..|+..
T Consensus       230 v~fL~Sd  236 (256)
T PRK08594        230 AAFLFSD  236 (256)
T ss_pred             HHHHHCC
T ss_conf             9999584


No 207
>PRK08278 short chain dehydrogenase; Provisional
Probab=99.07  E-value=2e-10  Score=77.86  Aligned_cols=178  Identities=13%  Similarity=0.090  Sum_probs=109.7

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------------HCCCCCHHHHHHHHHHC----
Q ss_conf             999978897889999999-649859996136----------------------------70878999999999755----
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------------DIDLLKPKDFASFFLSF----   49 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------------~~D~~~~~~~~~~l~~~----   49 (290)
                      +||||+++=||+++++.| .+|.+|+.++|+                            ++|++|++++++++++.    
T Consensus         9 alVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~~~~l~~~~~~~a~e~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~   88 (273)
T PRK08278          9 LFITGASRGIGLAIALRAARDGANIVIAAKTAEPHPKLPGTIHTAAAEIEAAGGQALPLVGDVRDEDQVAAAVAKTVERF   88 (273)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             99948765999999999998799899996772221334548999999999749908999711799999999999999985


Q ss_pred             -CCCEEEECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             -998999786344543----2233221024201222110001122----333-333445532111357554421111222
Q gi|254780921|r   50 -SPDVIINPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTN  119 (290)
Q Consensus        50 -~pd~Vih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~  119 (290)
                       +.|++||.|+.....    ..+.+.+..+++|+.++..+++++.    +.+ .++|.+||..-+.+   .+      ..
T Consensus        89 G~iDiLVNNAG~~~~~~~~~~~~~~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IinisS~~~~~~---~~------~~  159 (273)
T PRK08278         89 GGIDICVNNASAINLTGTEDTPMKRFDLMQGINVRGTFLVSQACLPHLKKSANPHILTLSPPLNLDP---KW------FA  159 (273)
T ss_pred             CCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CC------CC
T ss_conf             9962999878666675077751899999999835599999987656766579978999888787468---77------78


Q ss_pred             CCCCCHHHHHHHHHHHCCCCCCCC--CCCCCCCEECCCCCCCCEEEC-CCCCCCCEEECCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             211101245666653101222322--355542000368632000201-12466521530455454452236899999999
Q gi|254780921|r  120 PLNIYGKSKLAGEEKVASYTNNYV--ILRTAWVYSIFGSNFLLSMLR-LAKERREISVVCDQFGTPTSALQIARAIIQIA  196 (290)
Q Consensus       120 P~~~Yg~sK~~~E~~v~~~~~~~~--IlR~~~vyG~~~~~~v~~~l~-~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~  196 (290)
                      +...|+.+|.+.+.+.+..+..+-  =+|...| .|+.. +....++ ......++    ..+++|   +|+|+++..|+
T Consensus       160 ~~~aY~asKaal~~ltrslA~Ela~~gIrVNaV-aP~~~-~~t~~~~~~~~~~~~l----~R~g~P---ediA~av~FL~  230 (273)
T PRK08278        160 PHTAYTMAKYGMSLCTLGLAEEFREDGIAVNAL-WPRTM-IATAAVQNLLGGDEAM----RRSRTP---EIMADAAHAIL  230 (273)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEE-CCCCC-CCCHHHHHHCCCCCHH----HCCCCH---HHHHHHHHHHH
T ss_conf             847999999999999999999960309899997-27981-7689998410472122----146788---99999999993


Q ss_pred             HH
Q ss_conf             84
Q gi|254780921|r  197 HN  198 (290)
Q Consensus       197 ~~  198 (290)
                      ..
T Consensus       231 Sd  232 (273)
T PRK08278        231 TR  232 (273)
T ss_pred             CC
T ss_conf             87


No 208
>PRK07478 short chain dehydrogenase; Provisional
Probab=99.07  E-value=2.1e-10  Score=77.81  Aligned_cols=128  Identities=15%  Similarity=0.081  Sum_probs=93.0

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             999978897889999999-6498599961367---------------------0878999999999755-----998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      +|||||++=||.++++.| .+|.+|+..+|++                     +|++|++++++++++.     +.|++|
T Consensus         9 alVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~ei~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~~G~iDiLV   88 (254)
T PRK07478          9 AIITGASSGIGRAAAKLFAREGAKVVVGARRQAELDQLVAEIRAEGGEAVALAGDVRDEAYAKALVALAVERFGGLDIAF   88 (254)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99958876899999999998799999997988999999999996499089997689999999999999999849998999


Q ss_pred             ECCCCCCC-----CCCCCCCCEEEEECCCCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             78634454-----32233221024201222110001122----333-333445532111357554421111222211101
Q gi|254780921|r   56 NPAAYTAV-----DKAEDEPEIAFSINAEGAGAIAKAAD----SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        56 h~Aa~~~~-----~~~e~~~~~~~~~Nv~~~~~l~~~~~----~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      |.|+....     +..+.+.+..+++|+.++-.+++++.    +.+ -++|++||..=+  ....|        ....|+
T Consensus        89 NNAG~~~~~~~~~~~~~~~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~g~--~~g~~--------~~~~Y~  158 (254)
T PRK07478         89 NNAGILGEMGPVPELSLEGWRETLATNLTSAFLGAKHQIPAMLARGGGSLIFTSTFVGH--TAGFP--------GMAAYA  158 (254)
T ss_pred             ECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHC--CCCCC--------CCHHHH
T ss_conf             88743689989144999999999999869999999999999988699879998436643--36889--------735679


Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             245666653101222
Q gi|254780921|r  126 KSKLAGEEKVASYTN  140 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~  140 (290)
                      .+|.+...+.+..+.
T Consensus       159 asKaav~~lTr~lA~  173 (254)
T PRK07478        159 ASKAGLIGLTQVLAA  173 (254)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             889999999999999


No 209
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated
Probab=99.07  E-value=2.9e-10  Score=76.97  Aligned_cols=129  Identities=19%  Similarity=0.213  Sum_probs=88.8

Q ss_pred             EEEEECCCC--HHHHHHHHHH-HCCCEEEEECH------H-----------------HCCCCCHHHHHHHHHHC-----C
Q ss_conf             499997889--7889999999-64985999613------6-----------------70878999999999755-----9
Q gi|254780921|r    2 KCLVIGNNG--QIAQSLSSMC-VQDVEIIRVGR------P-----------------DIDLLKPKDFASFFLSF-----S   50 (290)
Q Consensus         2 kiLVtG~~G--~iG~~l~~~l-~~~~~v~~~~r------~-----------------~~D~~~~~~~~~~l~~~-----~   50 (290)
                      ++||||++|  =||..+++.| .+|.+|...++      .                 ++|++|.+++++++++.     +
T Consensus         9 ~alVTGaag~~GiG~aia~~la~~GA~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~   88 (259)
T PRK07370          9 KALVTGIANNRSIAWGIAQQLHAAGAELGITYLPDEKGRFEKKVRELTEPLNPSLFLPCNVQDDAQIEEVFETIKQKWGQ   88 (259)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             89997989985799999999998699999994787013589999999841286489991289999999999999998589


Q ss_pred             CCEEEECCCCCCCC--------CCCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             98999786344543--------22332210242012221100011223---33333445532111357554421111222
Q gi|254780921|r   51 PDVIINPAAYTAVD--------KAEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTN  119 (290)
Q Consensus        51 pd~Vih~Aa~~~~~--------~~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~  119 (290)
                      .|++||+|++....        ..+.+.+..+++|+.++..+++.+..   .+.++|.+||..   +....|        
T Consensus        89 iDilVnna~~~~~~~~~~~~~~~~~~~~~~~~~vn~~~~~~~~~~~~~~~~~~g~Ii~iss~~---~~~~~~--------  157 (259)
T PRK07370         89 LDILVHCLAFAGKEELSGDFSATSREGFARALEISAYSLAPLCRAAKPLMSEGGSIVTLTYLG---GVRAIP--------  157 (259)
T ss_pred             CCEEEEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEC---CCCCCC--------
T ss_conf             877986301146433679925599999999999987999999999988604588531278741---354678--------


Q ss_pred             CCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             2111012456666531012223
Q gi|254780921|r  120 PLNIYGKSKLAGEEKVASYTNN  141 (290)
Q Consensus       120 P~~~Yg~sK~~~E~~v~~~~~~  141 (290)
                      -.+.|+.+|.+.+.+.+..+..
T Consensus       158 ~~~~y~asKaal~~ltr~lA~e  179 (259)
T PRK07370        158 NYNVMGVAKAALEASVRYLAAE  179 (259)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHH
T ss_conf             8520588999999999999998


No 210
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.06  E-value=5.4e-10  Score=75.48  Aligned_cols=128  Identities=13%  Similarity=0.086  Sum_probs=88.9

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHH-----CCCCEEE
Q ss_conf             4999978897889999999-6498599961367--------------------087899999999975-----5998999
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLS-----FSPDVII   55 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~-----~~pd~Vi   55 (290)
                      ++|||||++=||.++++.| .+|.+|+.++|++                    .|+++++++++++++     .+.|++|
T Consensus         7 ~~lVTGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g~~~~~~~Dvs~~~~v~~~~~~~~~~~g~iD~lv   86 (238)
T PRK05786          7 NVLIVGVSPGLGYAVAYFALREGASVYAFARSEEKLKEIKKTLAKYGNVIYVVGDVSKLEGAREAAEKAAKVFGALHGLV   86 (238)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             89992898789999999999879999999698899999999874359779997578999999999999999839988799


Q ss_pred             ECCCCCCCCCCC--CCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             786344543223--32210242012221100011223---333334455321-113575544211112222111012456
Q gi|254780921|r   56 NPAAYTAVDKAE--DEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDY-VFDGLSRTPIDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        56 h~Aa~~~~~~~e--~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~-Vy~g~~~~p~~E~d~~~P~~~Yg~sK~  129 (290)
                      |.|+....+..+  .+.+..+.+|+.++..+++++..   .+..+|.+||.. ++.   ..|       + ...|+.+|.
T Consensus        87 ~naG~~~~~~~~~~~~~~~~~~~nl~~~~~~~~~~~~~m~~g~~ii~iss~~~~~~---~~~-------~-~~~Y~asKa  155 (238)
T PRK05786         87 VTAGGYIEDTVEELAGLEDMLNNHLKAPLYAVNASLPLLREGSSIVLVSSIRGIYK---AWP-------R-QLSYAAAKA  155 (238)
T ss_pred             EECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECHHHCCC---CCC-------C-CHHHHHHHH
T ss_conf             80575678852318999999999858999999999997421677999964454167---898-------6-178999999


Q ss_pred             HHHHHHCCCCC
Q ss_conf             66653101222
Q gi|254780921|r  130 AGEEKVASYTN  140 (290)
Q Consensus       130 ~~E~~v~~~~~  140 (290)
                      +.+.+.+..+.
T Consensus       156 al~~ltk~lA~  166 (238)
T PRK05786        156 GLAKAVEILAA  166 (238)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 211
>PRK07791 short chain dehydrogenase; Provisional
Probab=99.05  E-value=2.5e-10  Score=77.36  Aligned_cols=128  Identities=16%  Similarity=0.136  Sum_probs=92.3

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH------------------------------HCCCCCHHHHHHHHHHC-
Q ss_conf             4999978897889999999-649859996136------------------------------70878999999999755-
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP------------------------------DIDLLKPKDFASFFLSF-   49 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~------------------------------~~D~~~~~~~~~~l~~~-   49 (290)
                      .+||||+++=||+++++.| .+|.+|+..++.                              ..|++|.+++++++++. 
T Consensus         8 valVTGas~GIG~aiA~~lA~~GA~Vvi~D~~~~~~~~~~~~~~a~~~~~ei~~~g~~~~~~~~Dvsd~~~v~~~v~~~~   87 (285)
T PRK07791          8 VVIVTGAGGGIGRAHALAFAAEGARVVVNDIGVGLDGSPASGGAAQAVVDEITAAGGEAVANGDDIADWDQAANLVDAAV   87 (285)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             79992867689999999999869999998376431224456799999999999749839999689999999999999999


Q ss_pred             ----CCCEEEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCCC-------C----CCCCCCCCCCCCCCCCCCC
Q ss_conf             ----99899978634454----322332210242012221100011223-------3----3333445532111357554
Q gi|254780921|r   50 ----SPDVIINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAADS-------I----GIPCIYISTDYVFDGLSRT  110 (290)
Q Consensus        50 ----~pd~Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~~-------~----~~~~I~iSS~~Vy~g~~~~  110 (290)
                          +.|++||+|++...    +..+.+.+..+++|+.++-.+++.+..       .    +.++|.+||..-+-|   .
T Consensus        88 ~~fG~iDiLVNNAGi~~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~~~m~~~~~~g~~~~G~IInisS~~g~~g---~  164 (285)
T PRK07791         88 ETFGGLDVLVNNAGILRDRMFANTSEEEWDAVIRVHLKGHFATLRHAAAYWRDQSKAGKAVDARIINTSSGAGLQG---S  164 (285)
T ss_pred             HHHCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHCCC---C
T ss_conf             9839986999788667888756699999999999983889999999999999986458998459999664453779---9


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             421111222211101245666653101222
Q gi|254780921|r  111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       111 p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~  140 (290)
                      |        ....|+.+|.+...+.+..+.
T Consensus       165 ~--------~~~~Y~asKaav~~lTr~lA~  186 (285)
T PRK07791        165 V--------GQANYSAAKAGIAALTLVAAA  186 (285)
T ss_pred             C--------CCHHHHHHHHHHHHHHHHHHH
T ss_conf             9--------867899999999999999999


No 212
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional
Probab=99.04  E-value=4.3e-10  Score=76.01  Aligned_cols=128  Identities=18%  Similarity=0.211  Sum_probs=85.8

Q ss_pred             EEEEECCCCH--HHHHHHHHH-HCCCEEEEECHH--------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             4999978897--889999999-649859996136--------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNGQ--IAQSLSSMC-VQDVEIIRVGRP--------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G~--iG~~l~~~l-~~~~~v~~~~r~--------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      ++||||++|-  ||..+++.| .+|.+|+.++++                    .+|+++++++++++++.     +.|+
T Consensus         8 ~alVTGaa~g~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~~~~~~~~~G~iDi   87 (254)
T PRK07533          8 RGLVVGIANEQSIAWGCARAFRALGAELAVTYLNDKARPYVEPLAEELDAPLLMPLDVREPGQLEAVFARIAEEWGRLDF   87 (254)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89996888980899999999998799999982887789999999974598189991699999999999999998499778


Q ss_pred             EEECCCCCCC--------CCCCCCCCEEEEECCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9978634454--------32233221024201222110001122---333333445532111357554421111222211
Q gi|254780921|r   54 IINPAAYTAV--------DKAEDEPEIAFSINAEGAGAIAKAAD---SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN  122 (290)
Q Consensus        54 Vih~Aa~~~~--------~~~e~~~~~~~~~Nv~~~~~l~~~~~---~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~  122 (290)
                      +||.|++...        |....+.+..+++|+.+...+++.+.   ..+..+|.+||..   +....|        ..+
T Consensus        88 lVnna~~~~~~~~~~~~~d~~~~~~~~~~~vn~~~~~~~~~~~~~~m~~gG~iv~iss~~---~~~~~~--------~~~  156 (254)
T PRK07533         88 VLHSIAFAPKEDLHGRVVDCSREGFALAMDVSCHSFIRMARLAEPLMTNGGSLLTMSYYG---AEKVVE--------NYN  156 (254)
T ss_pred             EEECCCCCCCHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEHH---HCCCCC--------CCC
T ss_conf             974221266011147601499999999999985999999999888865178315673200---114677--------731


Q ss_pred             CCHHHHHHHHHHHCCCCC
Q ss_conf             101245666653101222
Q gi|254780921|r  123 IYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       123 ~Yg~sK~~~E~~v~~~~~  140 (290)
                      .|+.+|.+.+.+.+..+.
T Consensus       157 ~y~~aKaal~~ltr~lA~  174 (254)
T PRK07533        157 LMGPVKAALESSVRYLAA  174 (254)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             578899999999999999


No 213
>PRK12744 short chain dehydrogenase; Provisional
Probab=99.04  E-value=2.6e-10  Score=77.24  Aligned_cols=128  Identities=19%  Similarity=0.203  Sum_probs=89.7

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH-------------------------HCCCCCHHHHHHHHHH-----CC
Q ss_conf             4999978897889999999-649859996136-------------------------7087899999999975-----59
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-------------------------DIDLLKPKDFASFFLS-----FS   50 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-------------------------~~D~~~~~~~~~~l~~-----~~   50 (290)
                      .+|||||++=||+++++.| .+|.+|+.++++                         ++|+++.+++++++++     -+
T Consensus        10 valVTGgs~GIG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~   89 (257)
T PRK12744         10 VVLIAGGAKNLGGLIARDLAAQGAKAVAIHYNSAATKADAEETVAAVKAAGAKAVAFQADLTTAAAVEKLFDDAKAAFGR   89 (257)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             89992887589999999999879989999378743689999999999973992899976889999999999999998099


Q ss_pred             CCEEEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9899978634454----3223322102420122211000112233---33334455321113575544211112222111
Q gi|254780921|r   51 PDVIINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAADSI---GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        51 pd~Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~~~---~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      +|++||.|+....    +..+.+.+..+++|+.++-.+++.+...   +-++|.++|...-   ...|.        ...
T Consensus        90 iDilVnnAG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m~~~G~ii~i~ss~~~---~~~~~--------~~~  158 (257)
T PRK12744         90 PDIAINTVGKVLKKPIVEISEAEYDEMFAVNSKSAFFFIKEAGRHLNDNGKIVTLVTSLLG---AFTPF--------YSA  158 (257)
T ss_pred             CCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHH---CCCCC--------HHH
T ss_conf             8899976644567723332288888898888766999999999987418949999811544---67895--------188


Q ss_pred             CHHHHHHHHHHHCCCCC
Q ss_conf             01245666653101222
Q gi|254780921|r  124 YGKSKLAGEEKVASYTN  140 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~~  140 (290)
                      |+.+|.+.+.+.+..+.
T Consensus       159 Y~asKaav~~ltr~lA~  175 (257)
T PRK12744        159 YAGSKAPVEHFTRAASK  175 (257)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999


No 214
>PRK12746 short chain dehydrogenase; Provisional
Probab=99.03  E-value=4e-10  Score=76.23  Aligned_cols=129  Identities=18%  Similarity=0.128  Sum_probs=91.9

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEE-ECHH---------------------HCCCCCHHHHHHHHHH----------
Q ss_conf             4999978897889999999-64985999-6136---------------------7087899999999975----------
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIR-VGRP---------------------DIDLLKPKDFASFFLS----------   48 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~-~~r~---------------------~~D~~~~~~~~~~l~~----------   48 (290)
                      .+|||||++=||+++++.| .+|.+|+. ++|+                     +.|+++.++++++++.          
T Consensus         8 valITGga~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~~~~~g   87 (254)
T PRK12746          8 VALVTGASRGIGRAIAMRLANDGALVAIHYGRNKAAADETIREIESNGGKAFLIEADLNSIDGVKKLVEQLKNELQIRVG   87 (254)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             89994847689999999999879999996599989999999999855992899975779999999999999999866416


Q ss_pred             -CCCCEEEECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             -5998999786344543----22332210242012221100011223---333334455321113575544211112222
Q gi|254780921|r   49 -FSPDVIINPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNP  120 (290)
Q Consensus        49 -~~pd~Vih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P  120 (290)
                       -+.|++||.|+.....    ..+.+.+..+++|+.++-++++++..   ..-++|.+||....-+   .  .      .
T Consensus        88 ~g~iDiLVnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~f~~~k~~~p~m~~~G~IVnisS~~~~~~---~--~------~  156 (254)
T PRK12746         88 TSEIDILVNNAGIGTQGTIENTTEEIFDEIMAVNIKAPFFLIQQTLPLLRAEGRVINISSAEVRLG---F--T------G  156 (254)
T ss_pred             CCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECHHHCCC---C--C------C
T ss_conf             898518997997889999144999999999998534689999999999861696699924323357---8--8------7


Q ss_pred             CCCCHHHHHHHHHHHCCCCCC
Q ss_conf             111012456666531012223
Q gi|254780921|r  121 LNIYGKSKLAGEEKVASYTNN  141 (290)
Q Consensus       121 ~~~Yg~sK~~~E~~v~~~~~~  141 (290)
                      ...|+.+|.+.+.+.+..+..
T Consensus       157 ~~~Y~asKaal~~ltr~lA~e  177 (254)
T PRK12746        157 SIAYGLSKGALNTMTLPLAKH  177 (254)
T ss_pred             CHHHHHHHHHHHHHHHHHHHH
T ss_conf             377899999999999999999


No 215
>PRK05876 short chain dehydrogenase; Provisional
Probab=99.03  E-value=3.3e-10  Score=76.65  Aligned_cols=126  Identities=11%  Similarity=0.090  Sum_probs=90.6

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHH-----CCCCEE
Q ss_conf             4999978897889999999-6498599961367---------------------087899999999975-----599899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLS-----FSPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~-----~~pd~V   54 (290)
                      .++||||++=||.++++.| .+|.+|+..++++                     +|+++.+++.+++++     -++|++
T Consensus         8 vavITGaasGIG~a~A~~la~~Ga~Vvi~d~~~~~l~~~~~~l~~~g~~~~~~~~Dvt~~~~v~~l~~~~~~~~G~iDil   87 (275)
T PRK05876          8 GAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDVHGVMCDVRHREEVTHLADEAFRLLGHVDVV   87 (275)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             79992826699999999999879989999798899999999998269847999788899999999999999984898851


Q ss_pred             EECCCCCCCCC----CCCCCCEEEEECCCCCCCCCCCCC----CC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             97863445432----233221024201222110001122----33--333344553211135755442111122221110
Q gi|254780921|r   55 INPAAYTAVDK----AEDEPEIAFSINAEGAGAIAKAAD----SI--GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        55 ih~Aa~~~~~~----~e~~~~~~~~~Nv~~~~~l~~~~~----~~--~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      ||.||+.....    ...+.+..+.+|+.|+.++++.+.    +.  +..+|++||..-+   ...|        ....|
T Consensus        88 vnNAGi~~~~~~~~~~~~~w~~~~~vNl~g~~~~~~~~lP~m~~~g~~G~IvntsS~agl---~~~~--------~~~~Y  156 (275)
T PRK05876         88 FSNAGIVVGGPIVEMTHDDWRWVIDVDLWGSIHTVEAFLPRLLEQGTGGHVVFTASFAGL---VPNA--------GLGAY  156 (275)
T ss_pred             ECCCCCCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHC---CCCC--------CCHHH
T ss_conf             215744689872329999999987641389999999999999981999499996867753---8999--------97469


Q ss_pred             HHHHHHHHHHHCCC
Q ss_conf             12456666531012
Q gi|254780921|r  125 GKSKLAGEEKVASY  138 (290)
Q Consensus       125 g~sK~~~E~~v~~~  138 (290)
                      +.||.+...+.+.+
T Consensus       157 ~asK~av~~lte~L  170 (275)
T PRK05876        157 GVAKYGVVGLAETL  170 (275)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999


No 216
>PRK12747 short chain dehydrogenase; Provisional
Probab=99.03  E-value=5.1e-10  Score=75.60  Aligned_cols=179  Identities=18%  Similarity=0.163  Sum_probs=108.3

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEE-CHH---------------------HCCCCCHHHHHHHHHH----------
Q ss_conf             4999978897889999999-649859996-136---------------------7087899999999975----------
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRV-GRP---------------------DIDLLKPKDFASFFLS----------   48 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~-~r~---------------------~~D~~~~~~~~~~l~~----------   48 (290)
                      .+|||||++=||.++++.| .+|.+|... .++                     ..|+++.++++.+++.          
T Consensus         6 valITGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~g   85 (252)
T PRK12747          6 VALVTGASRGIGRAIAKRLANDGALVAIHYGNRKEEAEETVYEIQSNGGSAFSIGANLESLHGVEALYSSLDNELQKRTG   85 (252)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             99994847789999999999879999996599878999999999964995799833635679999999999999998428


Q ss_pred             -CCCCEEEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             -599899978634454----322332210242012221100011223---333334455321113575544211112222
Q gi|254780921|r   49 -FSPDVIINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNP  120 (290)
Q Consensus        49 -~~pd~Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P  120 (290)
                       .+.|++||.|++...    +..+.+.+..+++|+.++-.+++.+..   .+.++|.+||...+-|   .|        .
T Consensus        86 ~~~iDiLVnnAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~g~IVnisS~~~~~~---~~--------~  154 (252)
T PRK12747         86 STKFDILINNAGIGPGAFIEETTEQFFDRMVSVNAKAPFFIIQQALSRLRDNSRIINISSAATRIS---LP--------D  154 (252)
T ss_pred             CCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCC---CC--------C
T ss_conf             998108998999999988134999999999999756899999999999976697508985111268---89--------7


Q ss_pred             CCCCHHHHHHHHHHHCCCCCCC---C----CCCCCCCEECCCCCCCC-EEECC-CCCCCCEEECCCCCCCCCCHHHHHHH
Q ss_conf             1110124566665310122232---2----35554200036863200-02011-24665215304554544522368999
Q gi|254780921|r  121 LNIYGKSKLAGEEKVASYTNNY---V----ILRTAWVYSIFGSNFLL-SMLRL-AKERREISVVCDQFGTPTSALQIARA  191 (290)
Q Consensus       121 ~~~Yg~sK~~~E~~v~~~~~~~---~----IlR~~~vyG~~~~~~v~-~~l~~-~~~~~~i~~~~d~~~~p~~v~D~a~~  191 (290)
                      ...|+.+|.+.+.+.+..+..+   -    .+-|+++-.+-...+.. ...+. .....++    ..++   ..+|+|++
T Consensus       155 ~~~Y~asKaav~~ltr~lA~ela~~gIrVNaV~PG~i~T~~~~~~~~~~~~~~~~~~~~p~----~R~g---~p~dvA~~  227 (252)
T PRK12747        155 FIAYSMTKGAINTMTFTLAKQLGARGITVNAILPGFIKTDMNAELLSDPMMKQYATTISAF----NRLG---EVEDIADT  227 (252)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCHHHHCCCHHHHHHHHCCCCC----CCCC---CHHHHHHH
T ss_conf             2778999999999999999997333959988877759873221112789999998647887----9985---99999999


Q ss_pred             HHHHHHH
Q ss_conf             9999984
Q gi|254780921|r  192 IIQIAHN  198 (290)
Q Consensus       192 i~~~~~~  198 (290)
                      +..++..
T Consensus       228 v~fL~S~  234 (252)
T PRK12747        228 AAFLASP  234 (252)
T ss_pred             HHHHHCC
T ss_conf             9999584


No 217
>PRK06123 short chain dehydrogenase; Provisional
Probab=99.03  E-value=3.3e-10  Score=76.65  Aligned_cols=128  Identities=16%  Similarity=0.129  Sum_probs=89.4

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             999978897889999999-649859996136----------------------70878999999999755-----99899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      +|||||++=||.++++.| .+|.+|+...++                      .+|+++.++++++++..     ++|++
T Consensus         6 alITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~iDiL   85 (249)
T PRK06123          6 MIITGASRGIGAATALLAAERGYAVCLNYLRNRDAAEAVVQAIRRQGGEALAVAADVADEADVLRLFEAVDRELGRLDAL   85 (249)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99968687999999999998799899980898789999999999649909999847999999999999999982998789


Q ss_pred             EECCCCCCCCC-----CCCCCCEEEEECCCCCCCCCCCCC----CC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             97863445432-----233221024201222110001122----33----333344553211135755442111122221
Q gi|254780921|r   55 INPAAYTAVDK-----AEDEPEIAFSINAEGAGAIAKAAD----SI----GIPCIYISTDYVFDGLSRTPIDEFSPTNPL  121 (290)
Q Consensus        55 ih~Aa~~~~~~-----~e~~~~~~~~~Nv~~~~~l~~~~~----~~----~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~  121 (290)
                      ||.|++.....     .+.+.+..+.+|+.++-.+++.+.    ..    +..+|.+||..-.   ...|       ...
T Consensus        86 VnNAG~~~~~~~~~~~~~~~w~~~~~vNl~~~~~~~~~~~~~m~~~~~g~~g~IInisS~~~~---~~~~-------~~~  155 (249)
T PRK06123         86 VNNAGILEAQMRLEQMDAARLTRIFATNVVGSFLCAREAVKRMSTRHGGRGGAIVNVSSMAAR---LGSP-------GEY  155 (249)
T ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHC---CCCC-------CCH
T ss_conf             988855789997212999999999854069999999999999999708998379997447656---5898-------306


Q ss_pred             CCCHHHHHHHHHHHCCCCC
Q ss_conf             1101245666653101222
Q gi|254780921|r  122 NIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       122 ~~Yg~sK~~~E~~v~~~~~  140 (290)
                      -.|+.+|.+.+.+.+..+.
T Consensus       156 ~~Y~asKaav~~ltr~lA~  174 (249)
T PRK06123        156 IDYAASKGAIDTMTIGLAK  174 (249)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             8789999999999999999


No 218
>PRK05884 short chain dehydrogenase; Provisional
Probab=99.02  E-value=1.9e-10  Score=77.97  Aligned_cols=126  Identities=16%  Similarity=0.092  Sum_probs=86.9

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------CCCCCHHHHHHHHHHC--CCCEEEECCCCC
Q ss_conf             94999978897889999999-6498599961367----------------0878999999999755--998999786344
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------IDLLKPKDFASFFLSF--SPDVIINPAAYT   61 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------~D~~~~~~~~~~l~~~--~pd~Vih~Aa~~   61 (290)
                      ||||||||++-||+++++.| .+|++|+.++|++                +|.+|.++++++.+..  ..|.++|.++..
T Consensus         1 ~~VlVTGgs~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~el~~~~~~~d~~d~~~~~~~~~~~~~~~d~lvn~~~~~   80 (223)
T PRK05884          1 MEVLVTGGDTDLGRTIAEGFRNDGHKVTLVGARRDDLEVAAKELDVDAIVCDNTDPASLEEARGLFPHHLDTIVNVPAPS   80 (223)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHCCEEEEEEEE
T ss_conf             93999878879999999999987999999959878999998534876899852788999999999998619478841230


Q ss_pred             C----CC-----CCCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             5----43-----22332210242012221100011223---333334455321113575544211112222111012456
Q gi|254780921|r   62 A----VD-----KAEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        62 ~----~~-----~~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~  129 (290)
                      .    +.     ....+.+..+++|+.++..+++++..   .+-++|.+||....               ..+.|+.+|.
T Consensus        81 ~~~~~~~~~~~~d~~~~w~~~~~~nl~~~~~~~~~~~~~m~~~G~Iini~s~~~~---------------~~~~~~asKa  145 (223)
T PRK05884         81 WDAGDPRTYSLADTANAWRNALDATVLSAVLTVQSVGDHLRSGGSIINVVPENPP---------------AGSADAAIKA  145 (223)
T ss_pred             CCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCC---------------CCCHHHHHHH
T ss_conf             2478755562121599999999999799999999999861589879999457678---------------8758999999


Q ss_pred             HHHHHHCCCCCC
Q ss_conf             666531012223
Q gi|254780921|r  130 AGEEKVASYTNN  141 (290)
Q Consensus       130 ~~E~~v~~~~~~  141 (290)
                      +...+.+..+..
T Consensus       146 al~~~t~~lA~e  157 (223)
T PRK05884        146 ALSNWTAGQAEV  157 (223)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 219
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=99.01  E-value=5e-10  Score=75.66  Aligned_cols=178  Identities=13%  Similarity=0.143  Sum_probs=106.7

Q ss_pred             EEEECCCC--HHHHHHHHHH-HCCCEEEEEC-------------HH-------------------HCCCCCHHHHHHHHH
Q ss_conf             99997889--7889999999-6498599961-------------36-------------------708789999999997
Q gi|254780921|r    3 CLVIGNNG--QIAQSLSSMC-VQDVEIIRVG-------------RP-------------------DIDLLKPKDFASFFL   47 (290)
Q Consensus         3 iLVtG~~G--~iG~~l~~~l-~~~~~v~~~~-------------r~-------------------~~D~~~~~~~~~~l~   47 (290)
                      +||||++.  =||.++++.| .+|.+|+.+.             ..                   ++|+++.++++.+++
T Consensus         9 alVTGas~~~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dl~~~~~~~~~i~   88 (257)
T PRK12859          9 AVVTGVSRLDGIGAAICKELAEAGYDIFFTYWTAYDKEMPWGVDQSEQIQLQEELLKNGVKVSSMELDLTQNDAPKELIN   88 (257)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHH
T ss_conf             99928899986299999999987998999836520111234537579999999999549859999835899999999999


Q ss_pred             H-----CCCCEEEECCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCC-----CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             5-----5998999786344543----2233221024201222110001122-----333333445532111357554421
Q gi|254780921|r   48 S-----FSPDVIINPAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAAD-----SIGIPCIYISTDYVFDGLSRTPID  113 (290)
Q Consensus        48 ~-----~~pd~Vih~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~-----~~~~~~I~iSS~~Vy~g~~~~p~~  113 (290)
                      +     -++|++||.|++....    ..+.+.+..+.+|+.++..+.+.+.     ..+-++|.+||.....+     ..
T Consensus        89 ~~~~~~g~iDilVnnAg~~~~~~~~~~~~e~~~~~~~vN~~~~~~~~~~~~~~m~~~~~G~IInisS~~~~~~-----~~  163 (257)
T PRK12859         89 KVTEQLGYPHILINNAAYSTNNDFSNLTAEELDKHYMVNIRATTLLSSQFARGFDKKSGGRIVNMTSGQFQGP-----MV  163 (257)
T ss_pred             HHHHHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHCC-----CC
T ss_conf             9999829998999899999999905599999999999983578999999999875537953999942686076-----87


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHCCCCCCCC--CCCCCCCE-ECCCCCCCC-EEECCCCCCCCEEECCCCCCCCCCHHHHH
Q ss_conf             111222211101245666653101222322--35554200-036863200-02011246652153045545445223689
Q gi|254780921|r  114 EFSPTNPLNIYGKSKLAGEEKVASYTNNYV--ILRTAWVY-SIFGSNFLL-SMLRLAKERREISVVCDQFGTPTSALQIA  189 (290)
Q Consensus       114 E~d~~~P~~~Yg~sK~~~E~~v~~~~~~~~--IlR~~~vy-G~~~~~~v~-~~l~~~~~~~~i~~~~d~~~~p~~v~D~a  189 (290)
                            ....|+.+|.+.+.+.+..+..+.  =+|...|- |+-...+.. .+.+......++.    .++.   -+|+|
T Consensus       164 ------~~~~Y~asKaal~~ltrslA~ela~~gIrVN~V~PG~~~T~~~~~~~~~~~~~~~Pl~----R~g~---pediA  230 (257)
T PRK12859        164 ------GELAYATTKGAIDALTSTLSAEVAHLGITVNAINPGPTDTGWMTEEIKQGLKPMFPFG----RIGE---PKDAA  230 (257)
T ss_pred             ------CHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCHHHHHHHHHCCCCC----CCCC---HHHHH
T ss_conf             ------6177899999999999999999855191899997687897877999999898579989----9859---99999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999984
Q gi|254780921|r  190 RAIIQIAHN  198 (290)
Q Consensus       190 ~~i~~~~~~  198 (290)
                      .++..++..
T Consensus       231 ~~v~FL~S~  239 (257)
T PRK12859        231 RLIKFLVSE  239 (257)
T ss_pred             HHHHHHHCC
T ss_conf             999999585


No 220
>KOG1205 consensus
Probab=99.00  E-value=1.3e-09  Score=73.30  Aligned_cols=135  Identities=23%  Similarity=0.228  Sum_probs=93.1

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH-----------------H------CCCCCHHHHHHHHHH-----CCCC
Q ss_conf             4999978897889999999-649859996136-----------------7------087899999999975-----5998
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-----------------D------IDLLKPKDFASFFLS-----FSPD   52 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-----------------~------~D~~~~~~~~~~l~~-----~~pd   52 (290)
                      .++|||+|+=||.+++..| +.|..++-+.|.                 +      +|++|.++++++++.     .+.|
T Consensus        14 vVvITGASsGIG~~lA~~la~~G~~l~lvar~~rrl~~v~~~l~~~~~~~~v~~~~~Dvs~~~~~~~~~~~~~~~fg~vD   93 (282)
T KOG1205          14 VVLITGASSGIGEALAYELAKRGAKLVLVARRARRLERVAEELRKLGSLEKVLVLQLDVSDEESVKKFVEWAIRHFGRVD   93 (282)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             89995787178899999998677734774243202899999999747867647996765887889999999998658888


Q ss_pred             EEEECCCCCCCCCCCC----CCCEEEEECCCCCCCCCCCC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9997863445432233----22102420122211000112----2333-3334455321113575544211112222111
Q gi|254780921|r   53 VIINPAAYTAVDKAED----EPEIAFSINAEGAGAIAKAA----DSIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        53 ~Vih~Aa~~~~~~~e~----~~~~~~~~Nv~~~~~l~~~~----~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      +.||-||++..+..+.    +-...+++|+.|+..+.+++    ++.+ -++|.+||-.   |....|..        +.
T Consensus        94 vLVNNAG~~~~~~~~~~~~~~~~~~mdtN~~G~V~~Tk~alp~m~~r~~GhIVvisSia---G~~~~P~~--------~~  162 (282)
T KOG1205          94 VLVNNAGISLVGFLEDTDIEDVRNVMDTNVFGTVYLTKAALPSMKKRNDGHIVVISSIA---GKMPLPFR--------SI  162 (282)
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCEEEEEECCC---CCCCCCCC--------CC
T ss_conf             89846865655533447689888771000402489999998876632897499980610---15578865--------54


Q ss_pred             CHHHHHHHHHHHCC----CCCCCCCCCC
Q ss_conf             01245666653101----2223223555
Q gi|254780921|r  124 YGKSKLAGEEKVAS----YTNNYVILRT  147 (290)
Q Consensus       124 Yg~sK~~~E~~v~~----~~~~~~IlR~  147 (290)
                      |..||.+-+.+...    +.....+++.
T Consensus       163 Y~ASK~Al~~f~etLR~El~~~~~~i~i  190 (282)
T KOG1205         163 YSASKHALEGFFETLRQELIPLGTIIII  190 (282)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             1567999999999999996405845999


No 221
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional
Probab=98.99  E-value=1.1e-09  Score=73.82  Aligned_cols=128  Identities=17%  Similarity=0.251  Sum_probs=86.1

Q ss_pred             EEEEECCCCHH--HHHHHHHHHC-CCEEEEECHH--------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             49999788978--8999999964-9859996136--------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNGQI--AQSLSSMCVQ-DVEIIRVGRP--------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G~i--G~~l~~~l~~-~~~v~~~~r~--------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      ++||||+++=+  |.++++.+.+ +.+|+...|+                    ++|++|++++++++++.     +.|+
T Consensus        10 ~alVTGaa~g~Gig~aia~~~~~~Ga~V~i~~~~~~~~~~~~~l~~~~g~~~~~~~Dvt~~~~v~~~~~~~~~~~G~iDi   89 (260)
T PRK06603         10 KGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEVLEKRVKPLAEEIGCNFVSELDVTNPKSISNLFDDIKEKWGSFDF   89 (260)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89998999966899999999998799999966867999999999984383769865799999999999999998699778


Q ss_pred             EEECCCCCCCCC--------CCCCCCEEEEECCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             997863445432--------233221024201222110001122---333333445532111357554421111222211
Q gi|254780921|r   54 IINPAAYTAVDK--------AEDEPEIAFSINAEGAGAIAKAAD---SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN  122 (290)
Q Consensus        54 Vih~Aa~~~~~~--------~e~~~~~~~~~Nv~~~~~l~~~~~---~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~  122 (290)
                      +||.|++.....        ...+....+.+|..++..+.+.+.   ..+-.+|.+||....   ...|        -.+
T Consensus        90 LVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~a~~~m~~~GsIi~iss~~~~---~~~p--------~~~  158 (260)
T PRK06603         90 LLHGMAFADKNELKGRYVDTSLENFHNSLHISCYSLLELSRSAEALMHDGGSIVTLTYYGAE---KVIP--------NYN  158 (260)
T ss_pred             EEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC---CCCC--------CCC
T ss_conf             99644237776567751029899999999999899999999977874179730234221001---3478--------642


Q ss_pred             CCHHHHHHHHHHHCCCCC
Q ss_conf             101245666653101222
Q gi|254780921|r  123 IYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       123 ~Yg~sK~~~E~~v~~~~~  140 (290)
                      .|+.+|.+.+.+.+..+.
T Consensus       159 ~Y~asKaal~~ltr~lA~  176 (260)
T PRK06603        159 VMGVAKAALEASVKYLAN  176 (260)
T ss_pred             CHHHHHHHHHHHHHHHHH
T ss_conf             006659999999999999


No 222
>PRK12742 oxidoreductase; Provisional
Probab=98.98  E-value=6.7e-10  Score=74.96  Aligned_cols=130  Identities=16%  Similarity=0.160  Sum_probs=91.9

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH-----------------HCCCCCHHHHHHHHHHC-CCCEEEECCCCCC
Q ss_conf             4999978897889999999-649859996136-----------------70878999999999755-9989997863445
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-----------------DIDLLKPKDFASFFLSF-SPDVIINPAAYTA   62 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-----------------~~D~~~~~~~~~~l~~~-~pd~Vih~Aa~~~   62 (290)
                      ++|||||++=||.++++.| .+|++|+...+.                 ..|..|.+.+.+.+++. +.|++||+|+...
T Consensus         8 ~alITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~g~iD~lVnnAg~~~   87 (237)
T PRK12742          8 SVLVLGGSRGIGAAIVRRFVTDGANVVFTYAGSKDAAERLAAETGATAVFTDSADRDAVIDVVRKSGPLDILVVNAGIAL   87 (237)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCEEEEECCCCHHHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             89992788799999999999879999997799989999998863982899354589999999998699989998997789


Q ss_pred             CC----CCCCCCCEEEEECCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             43----223322102420122211000112233---33334455321113575544211112222111012456666531
Q gi|254780921|r   63 VD----KAEDEPEIAFSINAEGAGAIAKAADSI---GIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKV  135 (290)
Q Consensus        63 ~~----~~e~~~~~~~~~Nv~~~~~l~~~~~~~---~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v  135 (290)
                      ..    ..+.+.+..+++|+.++-++++.+...   +-++|.+||..   +. ..|+.      -...|+.+|.+.+.+.
T Consensus        88 ~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~G~ii~i~S~~---~~-~~~~~------~~~~Y~asKaal~~lt  157 (237)
T PRK12742         88 FGDALELDADAIDRLFKINIHAPYHASVEAARQMPEGGRILIIGSVN---GD-RMPVA------GMAAYAASKSALQGMA  157 (237)
T ss_pred             CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEC---CC-CCCCC------CCHHHHHHHHHHHHHH
T ss_conf             99813499999999998750679999999999712378599999530---02-36888------6078899999999999


Q ss_pred             CCCCCC
Q ss_conf             012223
Q gi|254780921|r  136 ASYTNN  141 (290)
Q Consensus       136 ~~~~~~  141 (290)
                      +..+..
T Consensus       158 k~lA~e  163 (237)
T PRK12742        158 RGLARD  163 (237)
T ss_pred             HHHHHH
T ss_conf             999999


No 223
>PRK07985 oxidoreductase; Provisional
Probab=98.98  E-value=9.1e-10  Score=74.19  Aligned_cols=128  Identities=19%  Similarity=0.122  Sum_probs=93.1

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECH--H---------------------HCCCCCHHHHHHHHHHC-----CCC
Q ss_conf             4999978897889999999-64985999613--6---------------------70878999999999755-----998
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGR--P---------------------DIDLLKPKDFASFFLSF-----SPD   52 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r--~---------------------~~D~~~~~~~~~~l~~~-----~pd   52 (290)
                      .+|||||++=||.++++.| .+|.+|+..++  .                     ..|+++++++++++++.     +.|
T Consensus        51 valVTGas~GIG~aiA~~lA~~GA~Vvi~~~~~~~~~a~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~lv~~~~~~fG~iD  130 (294)
T PRK07985         51 KALVTGGDSGIGRAAAIAYAREGADVAISYLPVEEEDAQDVKKIIEECGRKAVLLPGDLSDEKFARSLVHEAHKALGGLD  130 (294)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             79991726699999999999879999994299666789999999997299589997678999999999999999859988


Q ss_pred             EEEECCCCCC--C---CCCCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9997863445--4---322332210242012221100011223---3333344553211135755442111122221110
Q gi|254780921|r   53 VIINPAAYTA--V---DKAEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        53 ~Vih~Aa~~~--~---~~~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      ++||.|+...  .   +..+.+.+..+++|+.++..+++++..   .+.++|.+||...+.+   .|        ....|
T Consensus       131 iLVnnAG~~~~~~~~~~~s~e~~~~~~~vNl~g~~~~~qaa~p~m~~gGsIInisS~~~~~~---~p--------~~~~Y  199 (294)
T PRK07985        131 IMALVAGKQVAIPDIADLTSEQFQKTFAINVFALFWLTQEAIPLLPKGASIITTSSIQAYQP---SP--------HLLDY  199 (294)
T ss_pred             EEEEECCCCCCCCCHHHCCHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC---CC--------CCHHH
T ss_conf             89980666668888365899999999998653478888876776424877999666465278---88--------73077


Q ss_pred             HHHHHHHHHHHCCCCC
Q ss_conf             1245666653101222
Q gi|254780921|r  125 GKSKLAGEEKVASYTN  140 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~  140 (290)
                      +.+|.+.+.+.+..+.
T Consensus       200 ~asKaav~~lTrslA~  215 (294)
T PRK07985        200 AATKAAILNYSRGLAK  215 (294)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999


No 224
>PRK07453 protochlorophyllide oxidoreductase; Validated
Probab=98.96  E-value=3.9e-09  Score=70.67  Aligned_cols=139  Identities=17%  Similarity=0.131  Sum_probs=90.9

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH---------------------HCCCCCHHHHHHHHHH----C-CCCEEE
Q ss_conf             999978897889999999-649859996136---------------------7087899999999975----5-998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP---------------------DIDLLKPKDFASFFLS----F-SPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~---------------------~~D~~~~~~~~~~l~~----~-~pd~Vi   55 (290)
                      |+|||+++=||.+.++.| +.|.+|+...|+                     ++|+.+.++++++-++    . +.|++|
T Consensus         9 vvITGansGIG~eta~~La~~ga~Vil~~R~~~k~~~a~~~i~~~~~~~~~~~lDLssl~SVr~~a~~~~~~~~~lDiLI   88 (322)
T PRK07453          9 VLITGASSGVGLYAAKALAKRGWHVIMACRSLKKAEAAAQELGIPPDSYTIIHIDLGDLDSVRRFVDDFRALGKPLDALV   88 (322)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             99968886899999999997899899997999999999999618898779998988999999999999998659840898


Q ss_pred             ECCCCCCC-----CCCCCCCCEEEEECCCCCCC----CCCCCCC---CCCCCCCCCCCCC-C---CCCCCC---------
Q ss_conf             78634454-----32233221024201222110----0011223---3333344553211-1---357554---------
Q gi|254780921|r   56 NPAAYTAV-----DKAEDEPEIAFSINAEGAGA----IAKAADS---IGIPCIYISTDYV-F---DGLSRT---------  110 (290)
Q Consensus        56 h~Aa~~~~-----~~~e~~~~~~~~~Nv~~~~~----l~~~~~~---~~~~~I~iSS~~V-y---~g~~~~---------  110 (290)
                      |-||.-.+     .....-.+..+.+|..|.--    |+...+.   .+.|+|.+||..- +   +|.-..         
T Consensus        89 nNAGv~~p~~~~~~~T~dG~E~~f~vNhLghFlLt~lLlp~L~~s~~~~~RIV~vsS~~h~~~~~~~~~~~p~~~d~~dl  168 (322)
T PRK07453         89 CNAAVYKPLLKEPLRSPQGYELSMATNHLGHFLLCNLLLEDLKKSPAPDPRLVILGTVTANPKELGGKIPIPAPADLGDL  168 (322)
T ss_pred             ECCCCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHCCCCCCCCCCCCCCCCCCHH
T ss_conf             65654465567873458876345431058899999988999972789998189981224323023775566777772023


Q ss_pred             ---------CC--CCCCCCCCCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             ---------42--11112222111012456666531012223
Q gi|254780921|r  111 ---------PI--DEFSPTNPLNIYGKSKLAGEEKVASYTNN  141 (290)
Q Consensus       111 ---------p~--~E~d~~~P~~~Yg~sK~~~E~~v~~~~~~  141 (290)
                               |.  .+....+|...||.||++.=.+.+++..+
T Consensus       169 ~~~~~~~~~~~~~~~~~~y~~~~aY~~SKlanilf~~eL~rr  210 (322)
T PRK07453        169 SGFEAGFKAPISMADGKKFKPGKAYKDSKLCNMLTMRELHRR  210 (322)
T ss_pred             HHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             455531467310125775780878999999999999999986


No 225
>PRK07904 short chain dehydrogenase; Provisional
Probab=98.94  E-value=3.1e-09  Score=71.18  Aligned_cols=172  Identities=13%  Similarity=0.138  Sum_probs=98.2

Q ss_pred             EEEEECCCCHHHHHHHHH-HHCCC-EEEEECHH-----------------------HCCCCCHHHHHHHHH----HCCCC
Q ss_conf             499997889788999999-96498-59996136-----------------------708789999999997----55998
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSM-CVQDV-EIIRVGRP-----------------------DIDLLKPKDFASFFL----SFSPD   52 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~-l~~~~-~v~~~~r~-----------------------~~D~~~~~~~~~~l~----~~~pd   52 (290)
                      .||||||++=||.++++. +.+|+ .++..+|+                       ++|++|.++..++++    ..+.|
T Consensus        10 tvlITGassGIG~a~a~~~~~~g~~~v~l~~r~~~~~~~~~~~~~~~~~~~~v~~~~~D~~d~~~~~~~i~~~~~~~~id   89 (253)
T PRK07904         10 TILLLGGTSEIGLAICERYLRNAPARVVLAALPDDPRRDAAVAQMKAAGASSVEVIDFDALDTDSHPKVIDAAFAGGDVD   89 (253)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEE
T ss_conf             89993565099999999999749898999978973269999999985499718999556679899999999998549935


Q ss_pred             EEEECCCCCCCC-CCCCCCC---EEEEECCCCCCCCCCC----CCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             999786344543-2233221---0242012221100011----223333-334455321113575544211112222111
Q gi|254780921|r   53 VIINPAAYTAVD-KAEDEPE---IAFSINAEGAGAIAKA----ADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        53 ~Vih~Aa~~~~~-~~e~~~~---~~~~~Nv~~~~~l~~~----~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      ++|++|++.... ..+.+.+   ...++|+.++.++++.    .++.+. ++|.+||-.   |....|.        ...
T Consensus        90 v~i~~aG~~~~~~~~~~~~~~~~~~~~vN~~~~~~~~~~~~~~m~~~~~G~Iv~isSva---g~~~~~~--------~~~  158 (253)
T PRK07904         90 VAIVAFGLLGDAEELWQNQRKAVQIAEINYTAAVSVGVLLGEKMRAQGFGQIIAMSSAA---GERVRRS--------NFV  158 (253)
T ss_pred             EEEECCCCCCCCHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCC---CCCCCCC--------CCH
T ss_conf             99962445678255402299999999899499999999999999754998699966600---0367999--------726


Q ss_pred             CHHHHHHHHHHHCCCCCC---CCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             012456666531012223---223555420003686320002011246652153045545445223689999999984
Q gi|254780921|r  124 YGKSKLAGEEKVASYTNN---YVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~~~---~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      |+.||.+...+.+.....   +- +|...| -   |+|+.+=+..-....+..         +..+++|+.+...+++
T Consensus       159 Y~ASKaal~~f~~~L~~el~~~g-IrV~~V-~---PG~V~T~mt~~~~~~p~~---------~~~e~vA~~i~~ai~~  222 (253)
T PRK07904        159 YGSTKAGLDGFYLGLGEALREYG-VRVLVI-R---PGQVRTRMSADVKEAPLT---------VDKEDVANLAVTAVAK  222 (253)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCC-CEEEEE-E---CCCCCCCCCCCCCCCCCC---------CCHHHHHHHHHHHHHC
T ss_conf             88999999999999999847728-889999-7---278867656899989976---------8999999999999985


No 226
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=98.92  E-value=1.3e-09  Score=73.32  Aligned_cols=178  Identities=12%  Similarity=0.110  Sum_probs=109.4

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHH----CCCCEE
Q ss_conf             4999978897889999999-649859996136----------------------7087899999999975----599899
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLS----FSPDVI   54 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~----~~pd~V   54 (290)
                      .+||||+++=||+++++.| .+|.+|+..++.                      ..|++|.+.++++++.    -+.|++
T Consensus        11 valVTGas~GIGraiA~~lA~~GA~Vvi~d~~~~~~~~~~~~ei~~~G~~~~~~~~Dvsd~~~v~~lv~~~~~~G~iDiL   90 (303)
T PRK07792         11 VAVVTGAAAGLGRAEALGLARLGATVVVNDIASALDASDVLDEIRAAGAKAVAVAGDISQRATADELVATADGLGGLDIV   90 (303)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             89992886689999999999869999997189724799999999844993899966768999999999999983999699


Q ss_pred             EECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCCC--------CC----CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             978634454----322332210242012221100011223--------33----33344553211135755442111122
Q gi|254780921|r   55 INPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAADS--------IG----IPCIYISTDYVFDGLSRTPIDEFSPT  118 (290)
Q Consensus        55 ih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~~--------~~----~~~I~iSS~~Vy~g~~~~p~~E~d~~  118 (290)
                      ||+|++...    +..+.+.+..+++|+.++-.+++.+..        .+    -++|.+||..-+-|..          
T Consensus        91 VNNAGi~~~~~~~~~t~e~wd~v~~vNL~g~f~~~r~a~~~m~~~~~~~~g~~~G~IInisS~ag~~g~~----------  160 (303)
T PRK07792         91 VNNAGITRDRMLFNMSDEEWDAVIAVHLRGHFLLTRNAAAYWRAKAKEAGGPVYGRIVNTSSEAGLVGPV----------  160 (303)
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCHHHCCCCC----------
T ss_conf             9888556787610099999999998873899999999999999974516998634999974476566899----------


Q ss_pred             CCCCCCHHHHHHHHHHHCCCCCC---CCCCCCCCCEECCCC-CCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHH
Q ss_conf             22111012456666531012223---223555420003686-32000201124665215304554544522368999999
Q gi|254780921|r  119 NPLNIYGKSKLAGEEKVASYTNN---YVILRTAWVYSIFGS-NFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQ  194 (290)
Q Consensus       119 ~P~~~Yg~sK~~~E~~v~~~~~~---~~IlR~~~vyG~~~~-~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~  194 (290)
                       ....|+.+|.....+.+..+..   +-| |.+. ..|+.. .+...+..   ......   .....|..-+|+|.++..
T Consensus       161 -g~~~Y~AsKagv~~lTrslA~Ela~~gI-RVNa-IaP~a~t~~~~~~~~---~~~~~~---~~~~~p~~PeeVA~~v~f  231 (303)
T PRK07792        161 -GQANYGAAKAGITALTLSAARALGRYGV-RANA-ICPRARTAMTADVFG---DAPDVA---AGGIDPLSPEHVVTLVQF  231 (303)
T ss_pred             -CCHHHHHHHHHHHHHHHHHHHHHHHCCE-EEEE-ECCCCCCHHHHHHHH---HCHHHH---HHCCCCCCHHHHHHHHHH
T ss_conf             -8588999999999999999999855196-9999-899998702244420---177779---757799999999999999


Q ss_pred             HHHH
Q ss_conf             9984
Q gi|254780921|r  195 IAHN  198 (290)
Q Consensus       195 ~~~~  198 (290)
                      |..-
T Consensus       232 LaSd  235 (303)
T PRK07792        232 LASP  235 (303)
T ss_pred             HCCC
T ss_conf             7391


No 227
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]
Probab=98.91  E-value=3.2e-09  Score=71.15  Aligned_cols=124  Identities=20%  Similarity=0.257  Sum_probs=84.3

Q ss_pred             EEEECCCCHHHHHHHHHHHC-CCEEEEECHHH-----------------CCCCCHHHHHHHH---HHCCC--CEEEECCC
Q ss_conf             99997889788999999964-98599961367-----------------0878999999999---75599--89997863
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPD-----------------IDLLKPKDFASFF---LSFSP--DVIINPAA   59 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~~-----------------~D~~~~~~~~~~l---~~~~p--d~Vih~Aa   59 (290)
                      ||||||+.-||.+|++.|.+ |.+|+.+.|++                 +|+.|.+++++++   ...-|  +++||+||
T Consensus         8 iLITGG~sGIGl~lak~f~elgN~VIi~gR~e~~L~e~~~~~p~~~t~v~Dv~d~~~~~~lvewLkk~~P~lNvliNNAG   87 (245)
T COG3967           8 ILITGGASGIGLALAKRFLELGNTVIICGRNEERLAEAKAENPEIHTEVCDVADRDSRRELVEWLKKEYPNLNVLINNAG   87 (245)
T ss_pred             EEEECCCCHHHHHHHHHHHHHCCEEEEECCCHHHHHHHHHCCCCHHEEEECCCCHHHHHHHHHHHHHHCCCHHEEEECCC
T ss_conf             99937964365999999998389799965749999999860941315651320356699999999862986113430300


Q ss_pred             CCC-CCCC-----CCCCCEEEEECCCCCCCCCCCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             445-4322-----33221024201222110001122-----333333445532111357554421111222211101245
Q gi|254780921|r   60 YTA-VDKA-----EDEPEIAFSINAEGAGAIAKAAD-----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSK  128 (290)
Q Consensus        60 ~~~-~~~~-----e~~~~~~~~~Nv~~~~~l~~~~~-----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK  128 (290)
                      +-. .|..     -.+.+....+|..+|.+|.....     ...+.+|.+||.--|     .|    +...|  .|..||
T Consensus        88 Iqr~~dlt~~e~~~~~~~~eI~~Nl~API~Lt~~~lphl~~q~~a~IInVSSGLaf-----vP----m~~~P--vYcaTK  156 (245)
T COG3967          88 IQRNEDLTGAEDLLDDAEQEIATNLLAPIRLTALLLPHLLRQPEATIINVSSGLAF-----VP----MASTP--VYCATK  156 (245)
T ss_pred             CCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC-----CC----CCCCC--CCHHHH
T ss_conf             03201115873125678888887510279999999999971977369983255345-----76----54555--202438


Q ss_pred             HHHHHHHCC
Q ss_conf             666653101
Q gi|254780921|r  129 LAGEEKVAS  137 (290)
Q Consensus       129 ~~~E~~v~~  137 (290)
                      .+...+-.+
T Consensus       157 AaiHsyt~a  165 (245)
T COG3967         157 AAIHSYTLA  165 (245)
T ss_pred             HHHHHHHHH
T ss_conf             899998999


No 228
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR011294   This entry represents a subfamily of the short chain dehydrogenases. Characterised members so far as 3-hydroxybutyrate dehydrogenases and are found in species that accumulate ester polymers called polyhydroxyalkanoic acids (PHAs) under certain conditions. Several members of the family are from species not known to accumulate PHAs, including Oceanobacillus iheyensis and Bacillus subtilis. However, polymer formation is not required for there be a role for 3-hydroxybutyrate dehydrogenase; it may be members of this family have the same function in those species.; GO: 0003858 3-hydroxybutyrate dehydrogenase activity.
Probab=98.87  E-value=7e-09  Score=69.21  Aligned_cols=127  Identities=20%  Similarity=0.251  Sum_probs=91.0

Q ss_pred             CE-EEEECCCCHHHHHHHHHH-HCCCEEEEECHH--H---------------------CCCCCHHHHHHHHHHC-----C
Q ss_conf             94-999978897889999999-649859996136--7---------------------0878999999999755-----9
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP--D---------------------IDLLKPKDFASFFLSF-----S   50 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~--~---------------------~D~~~~~~~~~~l~~~-----~   50 (290)
                      || +||||++|=||..+++.| ++|++|+..+.+  +                     +|+||++++...++..     .
T Consensus         1 ~ktalVTGaaSGIG~~iA~~LA~aGa~v~~~d~~~~~~~~~~~~~~~~~~G~~v~~~~~D~T~~~e~~~~~~~~~~~fG~   80 (258)
T TIGR01963         1 GKTALVTGAASGIGLAIAKALAAAGANVVVNDLGEADEGAEAAAKVATDAGGSVIYLVADVTKEEEIADMIQAVAAEFGG   80 (258)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             94899965871678999999987298899846788789999999999961883577514788889999999999998568


Q ss_pred             CCEEEECCCCCCCCCCCCCC----CEEEEECCCCCCCCCCC----CCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             98999786344543223322----10242012221100011----22333--3334455321113575544211112222
Q gi|254780921|r   51 PDVIINPAAYTAVDKAEDEP----EIAFSINAEGAGAIAKA----ADSIG--IPCIYISTDYVFDGLSRTPIDEFSPTNP  120 (290)
Q Consensus        51 pd~Vih~Aa~~~~~~~e~~~----~~~~~~Nv~~~~~l~~~----~~~~~--~~~I~iSS~~Vy~g~~~~p~~E~d~~~P  120 (290)
                      +|+.||-||+=.|.--|.-|    +...++|..++-+..++    +++.|  -|+|+|+|..   |-...||.-----.-
T Consensus        81 ~DiLVNNAG~QhVaPiEeFP~~~w~~iiav~LtsaF~t~raAlP~Mk~~gwGGRIiNIAS~H---GLvASp~KSAYVAAK  157 (258)
T TIGR01963        81 LDILVNNAGIQHVAPIEEFPPEKWDRIIAVMLTSAFHTIRAALPHMKKQGWGGRIINIASVH---GLVASPFKSAYVAAK  157 (258)
T ss_pred             CCEEEECCCEEECCCCCCCCHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCEEEEEEEEC---CCCCCCCHHHHHHHH
T ss_conf             87488446401417654778667873730216888999975064321378553799710100---000353213456774


Q ss_pred             CCCCHHHHHH
Q ss_conf             1110124566
Q gi|254780921|r  121 LNIYGKSKLA  130 (290)
Q Consensus       121 ~~~Yg~sK~~  130 (290)
                      ...=|.||-.
T Consensus       158 HG~~GLTKv~  167 (258)
T TIGR01963       158 HGLIGLTKVL  167 (258)
T ss_pred             HHHHHHHHHH
T ss_conf             3021211555


No 229
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=98.87  E-value=6.8e-09  Score=69.29  Aligned_cols=95  Identities=19%  Similarity=0.268  Sum_probs=69.7

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------CCCCCHHHHHHHHHHC--CCCEEEECCCCCCCCCCCC
Q ss_conf             4999978897889999999-6498599961367----------0878999999999755--9989997863445432233
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------IDLLKPKDFASFFLSF--SPDVIINPAAYTAVDKAED   68 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------~D~~~~~~~~~~l~~~--~pd~Vih~Aa~~~~~~~e~   68 (290)
                      .+||||+++=||.++++.| .+|.+|++++|++          .|++|.+.+++++++.  +.|+++|+|+....    .
T Consensus         7 ~alVTG~s~GIG~aia~~la~~GA~V~~~d~~~~~~~~~~~~~~D~~~~~~v~~~v~~~~g~id~lvn~Ag~~~~----~   82 (261)
T PRK12428          7 TIVVTGVASGIGAEVARLLRFLGARVIGLDRRPPGMTLDGFHQADLGDPASIDAAVAALPGRIDALFNVAGVPGT----G   82 (261)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCEEECCCCCHHHHHHHHHHHCCCCCEEEECCCCCCC----C
T ss_conf             899978577999999999998699999996885545613176737899999999999837988789986777875----4


Q ss_pred             CCCEEEEECCCCCCCCCCCCC---CCCCCCCCCCC
Q ss_conf             221024201222110001122---33333344553
Q gi|254780921|r   69 EPEIAFSINAEGAGAIAKAAD---SIGIPCIYIST  100 (290)
Q Consensus        69 ~~~~~~~~Nv~~~~~l~~~~~---~~~~~~I~iSS  100 (290)
                      +++....+|..++..+.+...   ..+..++.++|
T Consensus        83 ~~~~~~~vn~~g~~~~~~~~~~~~~~~~~ivn~~s  117 (261)
T PRK12428         83 PPELVARVNFLGLRHLTEALLPRLAPGGAIVNVSS  117 (261)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             28899989889999999999998652875999601


No 230
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional
Probab=98.87  E-value=2.9e-09  Score=71.40  Aligned_cols=128  Identities=23%  Similarity=0.198  Sum_probs=84.3

Q ss_pred             EEEEECCCC--HHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             499997889--7889999999-6498599961367------------------0878999999999755-----998999
Q gi|254780921|r    2 KCLVIGNNG--QIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         2 kiLVtG~~G--~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      .+||||++|  =||.++++.| .+|.+|+..++++                  +|++|++++++++++.     +.|++|
T Consensus         9 ~~lVTGaag~~GIG~a~A~~la~~Ga~Vv~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~G~iD~lV   88 (252)
T PRK06079          9 KIVVMGVANKRSIAWGCAQAIKDQGATVIYTYQNDRMKKSLQKLVDEEDLLVECDVASDESIERAFAQIKERFGKIDGIV   88 (252)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             89998999987799999999998699999984887999999985088865999518999999999999999868887344


Q ss_pred             ECCCCCCCCCC--------CCCCCEEEEECCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             78634454322--------33221024201222110001122---33333344553211135755442111122221110
Q gi|254780921|r   56 NPAAYTAVDKA--------EDEPEIAFSINAEGAGAIAKAAD---SIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        56 h~Aa~~~~~~~--------e~~~~~~~~~Nv~~~~~l~~~~~---~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      |.|++.....-        +.+....+++|+.++..+++++.   +.+..+|.+||....   ...|        ..+.|
T Consensus        89 nnag~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~g~Iv~iss~~~~---~~~p--------~~~~y  157 (252)
T PRK06079         89 HAIAYAKKEELGGNVTDTSRDGYALAQDISAYSLIAVAKYARPLLNPPASIVTLTYFGSE---RAIP--------NYNVM  157 (252)
T ss_pred             EEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECC---CCCC--------CCCCH
T ss_conf             332025731024644438899999999888899999998887640357706788644034---5577--------74101


Q ss_pred             HHHHHHHHHHHCCCCC
Q ss_conf             1245666653101222
Q gi|254780921|r  125 GKSKLAGEEKVASYTN  140 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~  140 (290)
                      +.+|.+.+.+.+..+.
T Consensus       158 ~aaKaal~~ltr~lA~  173 (252)
T PRK06079        158 GIAKAALESSVRYLAR  173 (252)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             7789999999999999


No 231
>COG2910 Putative NADH-flavin reductase [General function prediction only]
Probab=98.87  E-value=2e-08  Score=66.67  Aligned_cols=178  Identities=15%  Similarity=0.132  Sum_probs=104.0

Q ss_pred             CEEEEECCCCHHHHHHHH-HHHCCCEEEEECHH-------------HCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             949999788978899999-99649859996136-------------7087899999999975599899978634454322
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSS-MCVQDVEIIRVGRP-------------DIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKA   66 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~-~l~~~~~v~~~~r~-------------~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~~   66 (290)
                      |||-|.|+||-+|+++.+ .+.+||+|+++.|+             +.|+.|++++.+.+..+  |+||..-+....+  
T Consensus         1 mKIaiIgAsG~~Gs~i~~EA~~RGHeVTAivRn~~K~~~~~~~~i~q~Difd~~~~a~~l~g~--DaVIsA~~~~~~~--   76 (211)
T COG2910           1 MKIAIIGASGKAGSRILKEALKRGHEVTAIVRNASKLAARQGVTILQKDIFDLTSLASDLAGH--DAVISAFGAGASD--   76 (211)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEECHHHCCCCCCCEEECCCCCCHHHHHHHHCCC--CEEEEECCCCCCC--
T ss_conf             907899537456799999998679804899807676652235302000222745667663587--6699721578887--


Q ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH--HCCC-CCC
Q ss_conf             332210242012221100011223333-3344553-2111357554421111222211101245666653--1012-223
Q gi|254780921|r   67 EDEPEIAFSINAEGAGAIAKAADSIGI-PCIYIST-DYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEK--VASY-TNN  141 (290)
Q Consensus        67 e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS-~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~--v~~~-~~~  141 (290)
                       .+..     .+.....|.+..+..++ |++-+.- .+.|=.+..  --.+.|..|.-.|...+..+|.+  ++.- .-+
T Consensus        77 -~~~~-----~~k~~~~li~~l~~agv~RllVVGGAGSL~id~g~--rLvD~p~fP~ey~~~A~~~ae~L~~Lr~~~~l~  148 (211)
T COG2910          77 -NDEL-----HSKSIEALIEALKGAGVPRLLVVGGAGSLEIDEGT--RLVDTPDFPAEYKPEALAQAEFLDSLRAEKSLD  148 (211)
T ss_pred             -HHHH-----HHHHHHHHHHHHHHCCCEEEEEECCCCCEEECCCC--EEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             -1577-----88899999999861597059998474205876884--550589985667799987789999986356764


Q ss_pred             CCCCCCCCCEECCCC--CCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             223555420003686--320002011246652153045545445223689999999984
Q gi|254780921|r  142 YVILRTAWVYSIFGS--NFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       142 ~~IlR~~~vyG~~~~--~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      ++-+-|+..|-|+.+  +|.        -++..-+++..=-|.++..|+|-+++..+++
T Consensus       149 WTfvSPaa~f~PGerTg~yr--------lggD~ll~n~~G~SrIS~aDYAiA~lDe~E~  199 (211)
T COG2910         149 WTFVSPAAFFEPGERTGNYR--------LGGDQLLVNAKGESRISYADYAIAVLDELEK  199 (211)
T ss_pred             EEEECCHHHCCCCCCCCCEE--------ECCCEEEECCCCCEEEEHHHHHHHHHHHHHC
T ss_conf             59967178457765568567--------6363577748885034489999999987746


No 232
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]
Probab=98.84  E-value=5.1e-09  Score=70.01  Aligned_cols=128  Identities=17%  Similarity=0.201  Sum_probs=87.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHH-CCCEEEEECHH-------------H-----------CCCCC-HHHHHHHHHHC-----
Q ss_conf             949999788978899999996-49859996136-------------7-----------08789-99999999755-----
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRP-------------D-----------IDLLK-PKDFASFFLSF-----   49 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~-------------~-----------~D~~~-~~~~~~~l~~~-----   49 (290)
                      +.+||||+++-||.++++.|. +|+.++.+.+.             .           +|+++ .+.++.+++..     
T Consensus         6 k~vlITGas~GiG~aia~~l~~~G~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~v~~~~~~~~~~~g   85 (251)
T COG1028           6 KVALVTGASSGIGRAIARALAREGARVVVAARRSEEEAAEALAAAIKEAGGGRAAAVAADVSDDEESVEALVAAAEEEFG   85 (251)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHHHHHHCC
T ss_conf             88999898871899999999988997999967973516999999975457872799972089999999999999999719


Q ss_pred             CCCEEEECCCCCCC-----CCCCCCCCEEEEECCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99899978634454-----322332210242012221100011223333--33445532111357554421111222211
Q gi|254780921|r   50 SPDVIINPAAYTAV-----DKAEDEPEIAFSINAEGAGAIAKAADSIGI--PCIYISTDYVFDGLSRTPIDEFSPTNPLN  122 (290)
Q Consensus        50 ~pd~Vih~Aa~~~~-----~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~--~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~  122 (290)
                      +.|++||+|+....     +....+.+..+++|+.++..+.+.+...-.  ++|.+||-.-.    ..+..       ..
T Consensus        86 ~idvlvnnAg~~~~~~~~~~~~~~~~~~~~~~n~~g~~~~~~~~~~~~~~~~Iv~isS~~~~----~~~~~-------~~  154 (251)
T COG1028          86 RIDILVNNAGIAGPDAPLEELTEEDWDRVIDVNLLGAFLLTRAALPLMKKQRIVNISSVAGL----GGPPG-------QA  154 (251)
T ss_pred             CCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCC----CCCCC-------CH
T ss_conf             98799999867645787233799999999999839999999986366233589998852103----78877-------30


Q ss_pred             CCHHHHHHHHHHHCCCC
Q ss_conf             10124566665310122
Q gi|254780921|r  123 IYGKSKLAGEEKVASYT  139 (290)
Q Consensus       123 ~Yg~sK~~~E~~v~~~~  139 (290)
                      .|+.||.+.+.+.+...
T Consensus       155 ~Y~~sK~al~~~~~~la  171 (251)
T COG1028         155 AYAASKAALIGLTKALA  171 (251)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             79999999999999999


No 233
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional
Probab=98.84  E-value=8.2e-09  Score=68.81  Aligned_cols=128  Identities=20%  Similarity=0.239  Sum_probs=84.7

Q ss_pred             EEEEEC--CCCHHHHHHHHHH-HCCCEEEEECHH--------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             499997--8897889999999-649859996136--------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIG--NNGQIAQSLSSMC-VQDVEIIRVGRP--------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG--~~G~iG~~l~~~l-~~~~~v~~~~r~--------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      ++||||  ++.=||.++++.| .+|.+|...++.                    ++|++|++++++++++.     +.|+
T Consensus         8 ~~lVTGa~~~~GIG~aia~~la~~Ga~v~~~~~~~~~~~~~~~~~~~~g~~~~~~~Dv~~~~~v~~~~~~~~~~~G~iD~   87 (261)
T PRK08690          8 KILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAAELDSELVFRCDVASDDEINQVFADLGKHWDGLDG   87 (261)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89998987863899999999998599999973761559999999987398089988999999999999999999689878


Q ss_pred             EEECCCCCCCCC---------CCCCCCEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             997863445432---------233221024201222110001122----3333334455321113575544211112222
Q gi|254780921|r   54 IINPAAYTAVDK---------AEDEPEIAFSINAEGAGAIAKAAD----SIGIPCIYISTDYVFDGLSRTPIDEFSPTNP  120 (290)
Q Consensus        54 Vih~Aa~~~~~~---------~e~~~~~~~~~Nv~~~~~l~~~~~----~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P  120 (290)
                      +||.|++.....         .+.+.+..+++|..+...+.++++    ..+..+|.+||....   ...|        .
T Consensus        88 LVnnaG~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~Ii~iss~~~~---~~~~--------~  156 (261)
T PRK08690         88 LVHSIGFAPKEALSGDFLDSISREAFNTAHEISAYSLPALAKAARPMMRGRNSAIVALSYLGAV---RAIP--------N  156 (261)
T ss_pred             EEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEEE---CCCC--------C
T ss_conf             9752554763334542475615999999999876778999998768760578414654333200---1566--------3


Q ss_pred             CCCCHHHHHHHHHHHCCCCC
Q ss_conf             11101245666653101222
Q gi|254780921|r  121 LNIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       121 ~~~Yg~sK~~~E~~v~~~~~  140 (290)
                      .+.|+.+|.+.+.+.+..+.
T Consensus       157 ~~~y~~sKaal~~ltr~lA~  176 (261)
T PRK08690        157 YNVMGMAKASLEAGIRFTAA  176 (261)
T ss_pred             CCHHHHHHHHHHHHHHHHHH
T ss_conf             10457889999999999999


No 234
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=98.83  E-value=3.5e-09  Score=70.91  Aligned_cols=129  Identities=16%  Similarity=0.153  Sum_probs=83.4

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEE-CHH----------------------HCCCCCHHHHHHHHHHC-----CCC
Q ss_conf             4999978897889999999-649859996-136----------------------70878999999999755-----998
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRV-GRP----------------------DIDLLKPKDFASFFLSF-----SPD   52 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~-~r~----------------------~~D~~~~~~~~~~l~~~-----~pd   52 (290)
                      ++|||||++-||.++++.| .+|.+|+.. +++                      ++|++|++.++++++..     +.|
T Consensus        10 ~alVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~l~~~~g~~~~~~~~Dv~~~~~~~~~~~~i~~~~g~iD   89 (260)
T PRK08416         10 TLVISGGTRGIGKAIVYEFAQSGVNIAFTYNSNVEEADKIAQDLEKKYGIKARAYPLNILEPETYKELFKKIDADFDRVD   89 (260)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             89996734099999999999879999998599889999999999884198369997788999999999999999819978


Q ss_pred             EEEECCCCCCCCC----------CCCCCCEEEEECCCCCCCCCCC----CCCCC-CCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9997863445432----------2332210242012221100011----22333-3334455321113575544211112
Q gi|254780921|r   53 VIINPAAYTAVDK----------AEDEPEIAFSINAEGAGAIAKA----ADSIG-IPCIYISTDYVFDGLSRTPIDEFSP  117 (290)
Q Consensus        53 ~Vih~Aa~~~~~~----------~e~~~~~~~~~Nv~~~~~l~~~----~~~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~  117 (290)
                      ++||.|++.....          ...+....+.+|+.+...+++.    .++.+ -.+|++||..-+   ...|      
T Consensus        90 ilVnnA~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~m~~~~~GsIv~isS~~~~---~~~~------  160 (260)
T PRK08416         90 FFISNAIISGRAVVGGYTKFMRLKPKGLNNIYTATVLAFVVGAQEAAKRMEKVGGGSIISLSSTGNL---VYIE------  160 (260)
T ss_pred             EEEECCEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCC---CCCC------
T ss_conf             9986434227642357774665989999999999989999999999999997099089997654456---6798------


Q ss_pred             CCCCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             222111012456666531012223
Q gi|254780921|r  118 TNPLNIYGKSKLAGEEKVASYTNN  141 (290)
Q Consensus       118 ~~P~~~Yg~sK~~~E~~v~~~~~~  141 (290)
                        ....|+.+|.+.+.+.+..+..
T Consensus       161 --~~~~Y~asKaal~~ltr~lA~e  182 (260)
T PRK08416        161 --NYAGHGTSKAAVEAMVRYAATE  182 (260)
T ss_pred             --CHHHHHHHHHHHHHHHHHHHHH
T ss_conf             --5177898888999999999999


No 235
>KOG4288 consensus
Probab=98.83  E-value=5.6e-10  Score=75.40  Aligned_cols=184  Identities=21%  Similarity=0.299  Sum_probs=106.8

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-------CCCCC-------------HHHHHHHHHHCCCCEEEECCC
Q ss_conf             94999978897889999999-6498599961367-------08789-------------999999997559989997863
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-------IDLLK-------------PKDFASFFLSFSPDVIINPAA   59 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-------~D~~~-------------~~~~~~~l~~~~pd~Vih~Aa   59 (290)
                      ||+.++||+||+|..++..+ ..+++++..+|+.       .|.-+             +....++++..  .-++|..+
T Consensus         3 ~k~~vfgg~gflg~~ic~~a~~sgy~vvsvsrsgas~~snkid~~~dve~e~tlvlggnpfsgs~vlk~A--~~vv~svg   80 (283)
T KOG4288           3 PKLIVFGGNGFLGKRICQEAVTSGYQVVSVSRSGASPHSNKIDDKQDVEVEWTLVLGGNPFSGSEVLKNA--TNVVHSVG   80 (283)
T ss_pred             CCCEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHHHH--HHHCEEEE
T ss_conf             6450234665323566599974583699713666787677786154535777765427985057999998--75261356


Q ss_pred             C--------------------------CC-----------CCCC---CCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCC
Q ss_conf             4--------------------------45-----------4322---332210242012221100011223333-33445
Q gi|254780921|r   60 Y--------------------------TA-----------VDKA---EDEPEIAFSINAEGAGAIAKAADSIGI-PCIYI   98 (290)
Q Consensus        60 ~--------------------------~~-----------~~~~---e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~i   98 (290)
                      +                          ++           +-.|   ..+.....++|-..-.+-.+++.+.|+ +|+||
T Consensus        81 ilsen~~k~~l~sw~~~vswh~gnsfssn~~k~~l~g~t~v~e~~ggfgn~~~m~~ing~ani~a~kaa~~~gv~~fvyI  160 (283)
T KOG4288          81 ILSENENKQTLSSWPTYVSWHRGNSFSSNPNKLKLSGPTFVYEMMGGFGNIILMDRINGTANINAVKAAAKAGVPRFVYI  160 (283)
T ss_pred             EEECCCCCCHHHCCCCCCCHHHCCCCCCCCCHHHHCCCCCCHHHHCCCCCHHHHHHHCCHHHHHHHHHHHHCCCCEEEEE
T ss_conf             76215670043378766312111301268552220577310888637541679998613766888999997499639998


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCC-CCCCCCCCCCCCCEECCCCC----CC-------CEEECCC
Q ss_conf             532111357554421111222211101245666653101-22232235554200036863----20-------0020112
Q gi|254780921|r   99 STDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVAS-YTNNYVILRTAWVYSIFGSN----FL-------LSMLRLA  166 (290)
Q Consensus        99 SS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~-~~~~~~IlR~~~vyG~~~~~----~v-------~~~l~~~  166 (290)
                      |-+. | |  -.|+      .|. =|=.+|.++|.-++. +.-+.+|||++.+||.+.-+    ++       ..+++.+
T Consensus       161 Sa~d-~-~--~~~~------i~r-GY~~gKR~AE~Ell~~~~~rgiilRPGFiyg~R~v~g~~~pL~~vg~pl~~~~~~a  229 (283)
T KOG4288         161 SAHD-F-G--LPPL------IPR-GYIEGKREAEAELLKKFRFRGIILRPGFIYGTRNVGGIKSPLHTVGEPLEMVLKFA  229 (283)
T ss_pred             EHHH-C-C--CCCC------CCH-HHHCCCHHHHHHHHHHCCCCCEEECCCEEECCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             7543-2-7--9886------622-13043168899999742788626435302145546760240876342699998740


Q ss_pred             -CCCCCEEECCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             -4665215304554544522368999999998
Q gi|254780921|r  167 -KERREISVVCDQFGTPTSALQIARAIIQIAH  197 (290)
Q Consensus       167 -~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~  197 (290)
                       +...++.+.++...-|+.++++|.+.+..++
T Consensus       230 ~k~~~kLp~lg~l~~ppvnve~VA~aal~ai~  261 (283)
T KOG4288         230 LKPLNKLPLLGPLLAPPVNVESVALAALKAIE  261 (283)
T ss_pred             HCHHHCCCCCCCCCCCCCCHHHHHHHHHHHCC
T ss_conf             23122075556424798678999999997424


No 236
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional
Probab=98.82  E-value=1.1e-08  Score=68.20  Aligned_cols=128  Identities=21%  Similarity=0.223  Sum_probs=85.1

Q ss_pred             EEEEEC--CCCHHHHHHHHHH-HCCCEEEEECHH--------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             499997--8897889999999-649859996136--------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIG--NNGQIAQSLSSMC-VQDVEIIRVGRP--------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG--~~G~iG~~l~~~l-~~~~~v~~~~r~--------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      ++||||  ++.=||..+++.| .+|.+|...++.                    ++|++|.+++++++++.     +.|+
T Consensus         8 ~~lVTG~a~~~GIG~aiA~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~g~~~~~~~Dv~~~~~v~~~v~~~~~~~g~iD~   87 (260)
T PRK06997          8 RILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSDLVFPCDVADDAQIDALFASLGTRWDGLDG   87 (260)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             89998998872899999999998599999980880669999999986298479983799999999999999998499898


Q ss_pred             EEECCCCCCCCC---------CCCCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             997863445432---------2332210242012221100011223---3333344553211135755442111122221
Q gi|254780921|r   54 IINPAAYTAVDK---------AEDEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPL  121 (290)
Q Consensus        54 Vih~Aa~~~~~~---------~e~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~  121 (290)
                      +||.|++...+.         .+.+.+..+.+|..++..+.+++..   .+..+|.+||....   ...|        ..
T Consensus        88 LVnNAG~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~k~~~~~~~~~g~iv~iss~~~~---~~~p--------~~  156 (260)
T PRK06997         88 LVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKAALPMLSDDASLLTLSYLGAE---RVVP--------NY  156 (260)
T ss_pred             EEECCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECE---ECCC--------CC
T ss_conf             964477677322353346655899999999988899999999998763167763230122010---0368--------74


Q ss_pred             CCCHHHHHHHHHHHCCCCC
Q ss_conf             1101245666653101222
Q gi|254780921|r  122 NIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       122 ~~Yg~sK~~~E~~v~~~~~  140 (290)
                      +.|+.+|.+.+.+.+..+.
T Consensus       157 ~~y~asKaal~~ltr~lA~  175 (260)
T PRK06997        157 NTMGLAKASLEASVRYLAV  175 (260)
T ss_pred             CHHHHHHHHHHHHHHHHHH
T ss_conf             2237788999999999999


No 237
>KOG1208 consensus
Probab=98.82  E-value=1.8e-08  Score=66.86  Aligned_cols=141  Identities=20%  Similarity=0.146  Sum_probs=95.1

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH-----------------------HCCCCCHHHHHHHHHHC-----CCC
Q ss_conf             4999978897889999999-649859996136-----------------------70878999999999755-----998
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-----------------------DIDLLKPKDFASFFLSF-----SPD   52 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-----------------------~~D~~~~~~~~~~l~~~-----~pd   52 (290)
                      -++|||+++=||.+.++.| ..|.+|+-..|+                       ++|+++.+++.++-+..     +-|
T Consensus        37 ~~vVTGansGIG~eta~~La~~Ga~Vv~~~R~~~~~~~~~~~i~~~~~~~~i~~~~lDLssl~SV~~fa~~~~~~~~~ld  116 (314)
T KOG1208          37 VALVTGATSGIGFETARELALRGAHVVLACRNEERGEEAKEQIQKGKANQKIRVIQLDLSSLKSVRKFAEEFKKKEGPLD  116 (314)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             79995898843799999999579989998477788999999997108776369998799999999999999985178765


Q ss_pred             EEEECCCCCCCCC--CCCCCCEEEEECCCCCCCCCCC----CCCCC-CCCCCCCCCCC-CCCCCCCCCCCCCC-CCCCCC
Q ss_conf             9997863445432--2332210242012221100011----22333-33344553211-13575544211112-222111
Q gi|254780921|r   53 VIINPAAYTAVDK--AEDEPEIAFSINAEGAGAIAKA----ADSIG-IPCIYISTDYV-FDGLSRTPIDEFSP-TNPLNI  123 (290)
Q Consensus        53 ~Vih~Aa~~~~~~--~e~~~~~~~~~Nv~~~~~l~~~----~~~~~-~~~I~iSS~~V-y~g~~~~p~~E~d~-~~P~~~  123 (290)
                      +.||.||+..+..  .+.-.+..+++|..|+..|++.    ++... .|+|.+||..- .+..-+..-.|... .+..-.
T Consensus       117 vLInNAGV~~~~~~~t~DG~E~~~~tN~lg~flLt~lLlp~lk~s~~~RIV~vsS~~~~~~~~~~~l~~~~~~~~~~~~~  196 (314)
T KOG1208         117 VLINNAGVMAPPFSLTKDGLELTFATNYLGHFLLTELLLPLLKRSAPSRIVNVSSILGGGKIDLKDLSGEKAKLYSSDAA  196 (314)
T ss_pred             EEEECCCCCCCCCCCCCCCHHHEEECCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHCCCHHHCCCCHHHH
T ss_conf             89865522367654565441130002329999999999999853789767998065346766533236233135550678


Q ss_pred             CHHHHHHHHHHHCCCCCCC
Q ss_conf             0124566665310122232
Q gi|254780921|r  124 YGKSKLAGEEKVASYTNNY  142 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~~~~  142 (290)
                      |+.||++...+..++..+.
T Consensus       197 Y~~SKla~~l~~~eL~k~l  215 (314)
T KOG1208         197 YALSKLANVLLANELAKRL  215 (314)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             8886998999999999885


No 238
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional
Probab=98.79  E-value=1e-08  Score=68.33  Aligned_cols=127  Identities=20%  Similarity=0.256  Sum_probs=82.8

Q ss_pred             EEEEEC--CCCHHHHHHHHHH-HCCCEEEEECHH-------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             499997--8897889999999-649859996136-------------------70878999999999755-----99899
Q gi|254780921|r    2 KCLVIG--NNGQIAQSLSSMC-VQDVEIIRVGRP-------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         2 kiLVtG--~~G~iG~~l~~~l-~~~~~v~~~~r~-------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      ++||||  +++=||.++++.| .+|.+|+.++++                   ++|++|++++++++++.     +.|.+
T Consensus         9 ~~lVTG~~~~~GIG~a~A~~la~~GA~Vvi~~~~~~~~~~~~~~~~~~~~~~i~~Dv~~~~~v~~~~~~~~~~~G~lD~l   88 (256)
T PRK07889          9 RILVTGVITDSSIAFHIARVAQEQGAEVVLTGFRRLRLTERIAKRLPEPAPVLELDVTNEEHLASLADRVREHIGGLDGV   88 (256)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             79998998856899999999998799999983893589999998658887599942889999999999999986897879


Q ss_pred             EECCCCCCCCC------CC---CCCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             97863445432------23---32210242012221100011223---33333445532111357554421111222211
Q gi|254780921|r   55 INPAAYTAVDK------AE---DEPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN  122 (290)
Q Consensus        55 ih~Aa~~~~~~------~e---~~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~  122 (290)
                      ||+|++.....      .+   .+....+.+|..++..+++++..   .+..+|.+|+.    +....|        ..+
T Consensus        89 Vnnag~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gg~Iv~~s~~----~~~~~p--------~~~  156 (256)
T PRK07889         89 VHSIGFAPQTALGGNPFLDAPWEDVATALHISAYSLASLAKALLPLMNPGGSIVGLDFD----ATVAWP--------AYD  156 (256)
T ss_pred             EECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCC----CCCCCC--------CHH
T ss_conf             74213477443467652003588888899899999999999976542168874674575----554567--------424


Q ss_pred             CCHHHHHHHHHHHCCCCC
Q ss_conf             101245666653101222
Q gi|254780921|r  123 IYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       123 ~Yg~sK~~~E~~v~~~~~  140 (290)
                      .|+.+|.+.+.+.+..+.
T Consensus       157 ~y~asKaal~~ltr~lA~  174 (256)
T PRK07889        157 WMGVAKAALESTNRYLAR  174 (256)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             677789999999999999


No 239
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase; InterPro: IPR013454    Rhamnose is a methyl-pentose sugar which is found as a constituent of pectin within the cell walls of dicotyledonous plants and has also been found in the mucilage of a number of legume plants . RhaD from Rhizobium leguminosarum bv. trifolii is encoded by a gene occurring in a rhamnose utilisation cluster, and is necessary for growth on this compound . This protein is predicted to be a bifunctional NAD-dependent aldolase/dehydrogenase..
Probab=98.78  E-value=2.3e-08  Score=66.27  Aligned_cols=126  Identities=16%  Similarity=0.257  Sum_probs=91.0

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH-----------------------------------HCCCCCHHHHHHHH
Q ss_conf             999978897889999999-649859996136-----------------------------------70878999999999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-----------------------------------DIDLLKPKDFASFF   46 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-----------------------------------~~D~~~~~~~~~~l   46 (290)
                      ++||||.|=||++++..| .+|-.|+..|.+                                   .+|+||++++...|
T Consensus       427 a~VtGGasGIG~~~A~rL~~eGAhvV~aD~d~~~a~~va~~~~~~fG~d~a~AGsdisaCGPaiGl~~DvT~e~~v~~~f  506 (709)
T TIGR02632       427 AFVTGGASGIGRETARRLVDEGAHVVLADLDAEAAEAVAAEIVDKFGADKAVAGSDISACGPAIGLKLDVTDEEAVKAAF  506 (709)
T ss_pred             EEEECCCCCHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEECCCCHHCCCCCEEEEEEECCHHHHHHHH
T ss_conf             88973886526899999973697799962365789999999863138881211432000467100276317589999999


Q ss_pred             HHC-----CCCEEEECCCCCC-CCC---C-CCCCCEEEEECCCCCCCCCCC------CCCCCCCCCCCCC-CCCCCCCCC
Q ss_conf             755-----9989997863445-432---2-332210242012221100011------2233333344553-211135755
Q gi|254780921|r   47 LSF-----SPDVIINPAAYTA-VDK---A-EDEPEIAFSINAEGAGAIAKA------ADSIGIPCIYIST-DYVFDGLSR  109 (290)
Q Consensus        47 ~~~-----~pd~Vih~Aa~~~-~~~---~-e~~~~~~~~~Nv~~~~~l~~~------~~~~~~~~I~iSS-~~Vy~g~~~  109 (290)
                      ++.     .-|+|++.||++. .+.   . .++.++.+.|++.|---+++-      .+..|.-+|||.| .+||-++..
T Consensus       507 ~~v~~~yGGvD~vv~nAGi~~S~p~~~t~r~~~W~l~~di~atG~FLVareA~r~~~~Q~lGG~~VfiaSkNav~A~kn~  586 (709)
T TIGR02632       507 AEVALAYGGVDIVVNNAGIAVSSPLEETERLEEWDLNLDILATGYFLVAREAARLMRKQGLGGNIVFIASKNAVVAGKNA  586 (709)
T ss_pred             HHHHHHHCCEEEEEECCCHHCCCCCHHHHHHHHHHHCCEEEEECCHHHHHHHHHHHHHCCCCCCEEEECCEEEEEECCCC
T ss_conf             99999749847876525301057702322155432012010120035888999999731798556776110001117884


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             4421111222211101245666653101222
Q gi|254780921|r  110 TPIDEFSPTNPLNIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       110 ~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~  140 (290)
                                  +.|..+|.+.-.++|..+-
T Consensus       587 ------------~AY~aaKA~~~Hl~R~LA~  605 (709)
T TIGR02632       587 ------------SAYSAAKAAEAHLARCLAA  605 (709)
T ss_pred             ------------CHHHHHHHHHHHHHHHHHH
T ss_conf             ------------0555899999989999998


No 240
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional
Probab=98.75  E-value=1.4e-08  Score=67.50  Aligned_cols=128  Identities=22%  Similarity=0.236  Sum_probs=81.6

Q ss_pred             EEEEECCCC--HHHHHHHHHH-HCCCEEEEECHHH--------------------CCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             499997889--7889999999-6498599961367--------------------0878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNG--QIAQSLSSMC-VQDVEIIRVGRPD--------------------IDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G--~iG~~l~~~l-~~~~~v~~~~r~~--------------------~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      ++||||++|  =||..+++.| .+|.+|+..+|++                    +|++|.+++++++++.     +.|+
T Consensus         8 ~alVTGaa~~~GiG~aiA~~la~~GA~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~~~~~~g~iD~   87 (262)
T PRK07984          8 RILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDAMFAELGKVWPKFDG   87 (262)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             79998999972599999999998799999982777899999999975498289988899999999999999998387788


Q ss_pred             EEECCCCCCCCCCCC---------CCCEEEEECCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             997863445432233---------2210242012221100011223---3333344553211135755442111122221
Q gi|254780921|r   54 IINPAAYTAVDKAED---------EPEIAFSINAEGAGAIAKAADS---IGIPCIYISTDYVFDGLSRTPIDEFSPTNPL  121 (290)
Q Consensus        54 Vih~Aa~~~~~~~e~---------~~~~~~~~Nv~~~~~l~~~~~~---~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~  121 (290)
                      +||.|++...+.-+.         +....+.+|..+...+.+++..   .+..+|.+||....   ...|        ..
T Consensus        88 lVnnag~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iv~iss~~~~---~~~p--------~~  156 (262)
T PRK07984         88 FVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAE---RAIP--------NY  156 (262)
T ss_pred             EEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHC---CCCC--------CC
T ss_conf             999502276322463178886099999999887899999999888751479759999504432---6678--------72


Q ss_pred             CCCHHHHHHHHHHHCCCCC
Q ss_conf             1101245666653101222
Q gi|254780921|r  122 NIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       122 ~~Yg~sK~~~E~~v~~~~~  140 (290)
                      +.|+.+|...+.+.+..+.
T Consensus       157 ~~y~~sKaal~~ltr~lA~  175 (262)
T PRK07984        157 NVMGLAKASLEANVRYMAN  175 (262)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             0888888899999999999


No 241
>KOG4039 consensus
Probab=98.75  E-value=2.3e-08  Score=66.27  Aligned_cols=139  Identities=20%  Similarity=0.238  Sum_probs=99.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC---CCEEEEECHHHC-C----------CCCHHHHHHHHHHC-CCCEEEECCCCCCCCC
Q ss_conf             9499997889788999999964---985999613670-8----------78999999999755-9989997863445432
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ---DVEIIRVGRPDI-D----------LLKPKDFASFFLSF-SPDVIINPAAYTAVDK   65 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~---~~~v~~~~r~~~-D----------~~~~~~~~~~l~~~-~pd~Vih~Aa~~~~~~   65 (290)
                      |..+|+|+||..|+.|.+.+.+   --.|+.+.|++. |          ..|.+.+++..... .||+.+-|-|-|+ .+
T Consensus        19 ~s~fvlGAtG~~G~~llk~~~E~~~FSKV~~i~RR~~~d~at~k~v~q~~vDf~Kl~~~a~~~qg~dV~FcaLgTTR-gk   97 (238)
T KOG4039          19 MSGFVLGATGLCGGGLLKHAQEAPQFSKVYAILRRELPDPATDKVVAQVEVDFSKLSQLATNEQGPDVLFCALGTTR-GK   97 (238)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCEEEEEEECHHHHHHHHHHHCCCCEEEEEECCCC-CC
T ss_conf             22478853553138999998856562069999731579842136454678326888887765028856899611355-55


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCC-CCCCC
Q ss_conf             23322102420122211000112233333-34455321113575544211112222111012456666531012-22322
Q gi|254780921|r   66 AEDEPEIAFSINAEGAGAIAKAADSIGIP-CIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASY-TNNYV  143 (290)
Q Consensus        66 ~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~-~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~-~~~~~  143 (290)
                      +  -.+.-|++.-.....+++++++.|++ ++.+||.    |  ..|.+       .-.|-.+|-+.|.-+-++ .++++
T Consensus        98 a--GadgfykvDhDyvl~~A~~AKe~Gck~fvLvSS~----G--Ad~sS-------rFlY~k~KGEvE~~v~eL~F~~~~  162 (238)
T KOG4039          98 A--GADGFYKVDHDYVLQLAQAAKEKGCKTFVLVSSA----G--ADPSS-------RFLYMKMKGEVERDVIELDFKHII  162 (238)
T ss_pred             C--CCCCEEEECHHHHHHHHHHHHHCCCEEEEEEECC----C--CCCCC-------CEEEEECCCHHHHHHHHCCCCEEE
T ss_conf             5--6675376153888889999885897089997426----7--88643-------420241034466666641550799


Q ss_pred             CCCCCCCEECCC
Q ss_conf             355542000368
Q gi|254780921|r  144 ILRTAWVYSIFG  155 (290)
Q Consensus       144 IlR~~~vyG~~~  155 (290)
                      |+||+.+.|.+.
T Consensus       163 i~RPG~ll~~R~  174 (238)
T KOG4039         163 ILRPGPLLGERT  174 (238)
T ss_pred             EECCCCEECCCC
T ss_conf             943753313466


No 242
>KOG1209 consensus
Probab=98.71  E-value=3e-08  Score=65.62  Aligned_cols=125  Identities=20%  Similarity=0.239  Sum_probs=88.2

Q ss_pred             EEEEECC-CCHHHHHHHHHH-HCCCEEEEECHH----------------HCCCCCHHHHHHHHHHC------CCCEEEEC
Q ss_conf             4999978-897889999999-649859996136----------------70878999999999755------99899978
Q gi|254780921|r    2 KCLVIGN-NGQIAQSLSSMC-VQDVEIIRVGRP----------------DIDLLKPKDFASFFLSF------SPDVIINP   57 (290)
Q Consensus         2 kiLVtG~-~G~iG~~l~~~l-~~~~~v~~~~r~----------------~~D~~~~~~~~~~l~~~------~pd~Vih~   57 (290)
                      +|||||| +|-||.+|++.+ .+|+.|+++.|+                ++|+++++.+.++....      +.|+.+|-
T Consensus         9 ~VlItgcs~GGIG~ala~ef~~~G~~V~AtaR~~e~M~~L~~~~gl~~~kLDV~~~~~V~~v~~evr~~~~Gkld~L~NN   88 (289)
T KOG1209           9 KVLITGCSSGGIGYALAKEFARNGYLVYATARRLEPMAQLAIQFGLKPYKLDVSKPEEVVTVSGEVRANPDGKLDLLYNN   88 (289)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHCCEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             59996057765349999999867819999702246076678860970587056872778998888861899826888717


Q ss_pred             CCCCC----CCCCCCCCCEEEEECCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             63445----4322332210242012221100011223----333334455321113575544211112222111012456
Q gi|254780921|r   58 AAYTA----VDKAEDEPEIAFSINAEGAGAIAKAADS----IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        58 Aa~~~----~~~~e~~~~~~~~~Nv~~~~~l~~~~~~----~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~  129 (290)
                      |+.+-    .|.--.+-+.++++|+.|..+++++..+    .+-++|++.|-.+|   -..|+.        +.|..||.
T Consensus        89 AG~~C~~Pa~d~~i~ave~~f~vNvfG~irM~~a~~h~likaKGtIVnvgSl~~~---vpfpf~--------~iYsAsKA  157 (289)
T KOG1209          89 AGQSCTFPALDATIAAVEQCFKVNVFGHIRMCRALSHFLIKAKGTIVNVGSLAGV---VPFPFG--------SIYSASKA  157 (289)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHHHCCCEEEEECCEEEE---ECCCHH--------HHHHHHHH
T ss_conf             9987655234687899986402112343438899999998726649974453588---024315--------66667799


Q ss_pred             HHHHHHCC
Q ss_conf             66653101
Q gi|254780921|r  130 AGEEKVAS  137 (290)
Q Consensus       130 ~~E~~v~~  137 (290)
                      +..++.+.
T Consensus       158 Aihay~~t  165 (289)
T KOG1209         158 AIHAYART  165 (289)
T ss_pred             HHHHHHHH
T ss_conf             99986320


No 243
>PRK06940 short chain dehydrogenase; Provisional
Probab=98.69  E-value=2.2e-08  Score=66.44  Aligned_cols=136  Identities=13%  Similarity=0.160  Sum_probs=80.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEECHHH---------------------CCCCCHHHHHHHHHH----CCCCEEEE
Q ss_conf             49999788978899999996498599961367---------------------087899999999975----59989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPD---------------------IDLLKPKDFASFFLS----FSPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~----~~pd~Vih   56 (290)
                      ||+||||+|=||.++++.|.+|..|+.++|++                     +|++|+++++.+++.    -+.|++||
T Consensus         6 kV~v~tGa~GIG~aiA~~la~Ga~vvi~~~~~~~l~~~~~~l~~~g~~~~~~~~Dvs~~~~v~~l~~~~~~~G~idiLVn   85 (277)
T PRK06940          6 EVVVVIGAGGMGQAIARRVGSGKTVLLADYNEENLQAVARTLREAGFDVITQQVDVSSRESVKALAQTAATLGAVTGLVH   85 (277)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             29999781699999999998199899998988999999999872288299998257998999999999998699879998


Q ss_pred             CCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCC---CCCCCCCCCCCCCCC---C--C--------C-----CCCCCC-C
Q ss_conf             863445432233221024201222110001122---333333445532111---3--5--------7-----554421-1
Q gi|254780921|r   57 PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAAD---SIGIPCIYISTDYVF---D--G--------L-----SRTPID-E  114 (290)
Q Consensus        57 ~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~---~~~~~~I~iSS~~Vy---~--g--------~-----~~~p~~-E  114 (290)
                      +|+.+..   +..++...++|..++..+.+...   ..+...+++++-.-+   .  .        .     -..++. -
T Consensus        86 nAG~~~~---~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~  162 (277)
T PRK06940         86 TAGVSPS---QASPEAILKVDLYGTALVLEEFGKVIAPGGAGVVIASMSGHRLPALTAEQEQALATTPTEELLSLPFLQP  162 (277)
T ss_pred             CCCCCCC---CCCHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCC
T ss_conf             8867866---5789999988668899999999999984982899860444311144566654540267652664100023


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             11222211101245666653101222
Q gi|254780921|r  115 FSPTNPLNIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       115 ~d~~~P~~~Yg~sK~~~E~~v~~~~~  140 (290)
                      .....|...|+.+|.+...+.+..+.
T Consensus       163 ~~~~~~~~aY~~sK~a~~~ltk~lA~  188 (277)
T PRK06940        163 DSIEDPLHAYQFAKRANVLRVRAAAV  188 (277)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             33563239999999999999999999


No 244
>PRK08862 short chain dehydrogenase; Provisional
Probab=98.66  E-value=3.8e-08  Score=65.06  Aligned_cols=124  Identities=11%  Similarity=0.098  Sum_probs=77.8

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHH----C-C-CCEE
Q ss_conf             999978897889999999-6498599961367---------------------087899999999975----5-9-9899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLS----F-S-PDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~----~-~-pd~V   54 (290)
                      +|||||++=||+++++.| .+|.+|+.++|++                     +|.+|.++++++++.    + + +|++
T Consensus         8 ~lITGas~GIG~aiA~~~A~~Ga~Vii~~r~~~~l~~~~~~i~~~g~~~~~~~~d~~~~~~v~~~~~~i~~~~g~~iDvL   87 (227)
T PRK08862          8 ILITSAGSVLGRTISCHFARLGATLILCDQDQSALNDTYEQCSALTDNVYSYQLKDFSQESIRHLFDAIEQQFNRAPDVL   87 (227)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99979887999999999998799999996999999999999997589748999516619999999999999958997499


Q ss_pred             EECCCCCCCCC-CCCC----CCEEEEECCCCCCCCCCCC----CCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             97863445432-2332----2102420122211000112----2333--3334455321113575544211112222111
Q gi|254780921|r   55 INPAAYTAVDK-AEDE----PEIAFSINAEGAGAIAKAA----DSIG--IPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        55 ih~Aa~~~~~~-~e~~----~~~~~~~Nv~~~~~l~~~~----~~~~--~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      ||+|+...... .+..    ....+..|..++..+.+.+    ++.+  ..+|.+||...+              .+...
T Consensus        88 VNNa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~m~~~~~~G~IINi~S~~~~--------------~~~~~  153 (227)
T PRK08862         88 VNNWTSSPLPSLFDEQPSESFIQQLTSLASTLFTYGQVAAERMRKRKKKGVIVNVISHDDH--------------QDLTG  153 (227)
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCC--------------CCCHH
T ss_conf             8566457788633458899999999986569999999999999966998799999768766--------------88278


Q ss_pred             CHHHHHHHHHHHCCCCC
Q ss_conf             01245666653101222
Q gi|254780921|r  124 YGKSKLAGEEKVASYTN  140 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~~  140 (290)
                      |+.+|.+.+.+.+..+.
T Consensus       154 y~asKaav~~lTkslA~  170 (227)
T PRK08862        154 VESSTALVSGFTHSWAK  170 (227)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999


No 245
>TIGR02415 23BDH acetoin reductases; InterPro: IPR014007   One member of this family, as characterised in Klebsiella terrigena , is able to interconvert acetoin + NADH with meso-2,3-butanediol + NAD(+). It is also capable of irreversible reduction of diacetyl with NADH to acetoin. There has been a reuctance to classify the enzyme as either 1.1.1.4 from EC, which is (R,R)-butanediol dehydrogenase, or 1.1.1.5 from EC, which is acetoin dehydrogenase without a specified stereochemistry . Another member of this family, from Corynebacterium glutamicum (Brevibacterium flavum), is called L-2,3-butanediol dehydrogenase .    This enzyme is a homotetramer in the family of short chain dehydrogenases (IPR002198 from INTERPRO). .
Probab=98.64  E-value=5e-08  Score=64.42  Aligned_cols=130  Identities=20%  Similarity=0.231  Sum_probs=94.3

Q ss_pred             EEEECCCCHHHHHHHHHHH-CCCEEEEECHH--H---------------------CCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             9999788978899999996-49859996136--7---------------------0878999999999755-----9989
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMCV-QDVEIIRVGRP--D---------------------IDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~--~---------------------~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      -|||||.+=||..+++.|. .|.+|...|-+  +                     +|+++++.+++++++.     .+||
T Consensus         3 AlvTGgAqGIG~gIa~RLa~DGF~vav~D~n~Qe~~A~~t~~~i~~~G~~Ava~~~DV~~k~~~~~~i~~A~~~fG~fdV   82 (258)
T TIGR02415         3 ALVTGGAQGIGKGIAERLAKDGFNVAVADLNNQEETAKETAKEINQKGGKAVAYKLDVSDKSQVFEAIDQAVEKFGGFDV   82 (258)
T ss_pred             EEEECCCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             67856854323899999983461378725666368999999999866973799864734567899999999997089327


Q ss_pred             EEECCCCCCC----CCCCCCCCEEEEECCCCCCCCCCCCC------CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             9978634454----32233221024201222110001122------333-333445532111357554421111222211
Q gi|254780921|r   54 IINPAAYTAV----DKAEDEPEIAFSINAEGAGAIAKAAD------SIG-IPCIYISTDYVFDGLSRTPIDEFSPTNPLN  122 (290)
Q Consensus        54 Vih~Aa~~~~----~~~e~~~~~~~~~Nv~~~~~l~~~~~------~~~-~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~  122 (290)
                      .||-|+...+    +--|.+.++.|.+||.|+.+=+++|.      .++ -|+|-.-|-+   |-      |-.|  -++
T Consensus        83 ~VNNAGva~~~pi~~iteE~l~k~y~vNV~GvlfGIQAA~~~Fkk~~~~tGkIINAaSiA---g~------~G~p--~ls  151 (258)
T TIGR02415        83 MVNNAGVAPVTPILEITEEELEKLYNVNVKGVLFGIQAAARQFKKQGHGTGKIINAASIA---GV------EGNP--VLS  151 (258)
T ss_pred             EEECCCCCCCCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHH---HH------HCCH--HHH
T ss_conf             865241000277454670034234301014566788999987787168987115776575---54------0441--467


Q ss_pred             CCHHHHHHHHHH----HCCCCCCCC
Q ss_conf             101245666653----101222322
Q gi|254780921|r  123 IYGKSKLAGEEK----VASYTNNYV  143 (290)
Q Consensus       123 ~Yg~sK~~~E~~----v~~~~~~~~  143 (290)
                      .|+-||.+.-=+    .+++++++.
T Consensus       152 ~YsstKFAVRgLTQtAA~eLA~~GI  176 (258)
T TIGR02415       152 AYSSTKFAVRGLTQTAAQELAPKGI  176 (258)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             7776788887657999999752487


No 246
>PRK08303 short chain dehydrogenase; Provisional
Probab=98.63  E-value=3.9e-08  Score=64.98  Aligned_cols=129  Identities=12%  Similarity=0.108  Sum_probs=80.8

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH-------------------------------HCCCCCHHHHHHHHHHC-
Q ss_conf             999978897889999999-649859996136-------------------------------70878999999999755-
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP-------------------------------DIDLLKPKDFASFFLSF-   49 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~-------------------------------~~D~~~~~~~~~~l~~~-   49 (290)
                      +||||++.=||+++++.| .+|.+|+.++|+                               ++|++|+++++.++++. 
T Consensus        11 AlVTGasrGIGraiA~~LA~~GA~V~i~~r~~~~~~~~~~~~e~l~e~a~~i~~~Gg~~~~v~~Dvsd~~~v~~~v~~~~   90 (305)
T PRK08303         11 ALVAGATRGAGRGIAVELGAAGATVYVTGRSTRARRSEYDRPETIEETAELVTAAGGRGIAVQVDHLVPEQVRALVERID   90 (305)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             99908875899999999998799899982761100000120679999999999759908999756899999999999999


Q ss_pred             ----CCCEEEECCCCCCC---------CCCCCCCCEEEEECCCCCCCCCCC----CCCCC-CCCCCCCCCC-CCCCCCCC
Q ss_conf             ----99899978634454---------322332210242012221100011----22333-3334455321-11357554
Q gi|254780921|r   50 ----SPDVIINPAAYTAV---------DKAEDEPEIAFSINAEGAGAIAKA----ADSIG-IPCIYISTDY-VFDGLSRT  110 (290)
Q Consensus        50 ----~pd~Vih~Aa~~~~---------~~~e~~~~~~~~~Nv~~~~~l~~~----~~~~~-~~~I~iSS~~-Vy~g~~~~  110 (290)
                          +.|++||.|+....         +.........+.+|+.+.....++    ..+.+ -.+|.+||.. .++.   .
T Consensus        91 ~~~G~lDILVNNa~~~~~~~~~~~~~~~~~~e~~~~~~~vn~~~~~~~~~~a~p~m~~~~~G~IVnisS~~~~~~~---~  167 (305)
T PRK08303         91 REQGRLDILVNDIWGGEKLFEWGKPVWEHSLDKGLRMLRLAVDTHLITSHHALPLLIRRPGGLVVEVTDGTAEYNA---T  167 (305)
T ss_pred             HHCCCCCEEEECCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCC---C
T ss_conf             9529620898558666543446802766179999999999989999999999999987799589998855552277---8


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             421111222211101245666653101222
Q gi|254780921|r  111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTN  140 (290)
Q Consensus       111 p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~  140 (290)
                      .|.      ....|+.+|.+.+.+.+..+.
T Consensus       168 ~~~------~~~~Y~asKaAv~~ltr~lA~  191 (305)
T PRK08303        168 HYR------LSVFYDLAKTAVLRLAFSLAH  191 (305)
T ss_pred             CCC------CCHHHHHHHHHHHHHHHHHHH
T ss_conf             877------519899999999999999999


No 247
>KOG0725 consensus
Probab=98.62  E-value=7e-08  Score=63.59  Aligned_cols=130  Identities=22%  Similarity=0.257  Sum_probs=88.7

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------------CCCCCHHHHHHHH----HH--CC
Q ss_conf             4999978897889999999-6498599961367------------------------0878999999999----75--59
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------------IDLLKPKDFASFF----LS--FS   50 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------------~D~~~~~~~~~~l----~~--~~   50 (290)
                      .+||||++.=||.++++.| ..|..|+.++|++                        +|+++.+.+++++    +.  -+
T Consensus        10 valVTG~s~GIG~aia~~la~~Ga~v~i~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~l~~~~~~~~~Gk   89 (270)
T KOG0725          10 VALVTGGSSGIGKAIALLLAKAGAKVVITGRSEERLEETAQELGGLGYTGGKVLAIVCDVSKEVDVEKLVEFAVEKFFGK   89 (270)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             89997999815899999999879989998454566677899987436777614899755576788999999999984788


Q ss_pred             CCEEEECCCCCC-----CCCCCCCCCEEEEECCCC-CCCCCCCCC----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             989997863445-----432233221024201222-110001122----33-3333445532111357554421111222
Q gi|254780921|r   51 PDVIINPAAYTA-----VDKAEDEPEIAFSINAEG-AGAIAKAAD----SI-GIPCIYISTDYVFDGLSRTPIDEFSPTN  119 (290)
Q Consensus        51 pd~Vih~Aa~~~-----~~~~e~~~~~~~~~Nv~~-~~~l~~~~~----~~-~~~~I~iSS~~Vy~g~~~~p~~E~d~~~  119 (290)
                      .|++||.|+...     .|..+.+++..+++|+.| ...+.+++.    +. +--++++||..-+   ...      ...
T Consensus        90 idiLvnnag~~~~~~~~~~~s~e~~d~~~~~Nl~G~~~~~~~~a~~~~~~~~gg~I~~~ss~~~~---~~~------~~~  160 (270)
T KOG0725          90 IDILVNNAGALGLTGSILDLSEEVFDKIMATNLRGSAFCLKQAARPMLKKSKGGSIVNISSVAGV---GPG------PGS  160 (270)
T ss_pred             CCEEEECCCCCCCCCCHHHCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC---CCC------CCC
T ss_conf             87798726646788744219999998888640312789999999999985389469996664455---667------776


Q ss_pred             CCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             2111012456666531012223
Q gi|254780921|r  120 PLNIYGKSKLAGEEKVASYTNN  141 (290)
Q Consensus       120 P~~~Yg~sK~~~E~~v~~~~~~  141 (290)
                      | ..|+.+|.+.+++.+..+..
T Consensus       161 ~-~~Y~~sK~al~~ltr~lA~E  181 (270)
T KOG0725         161 G-VAYGVSKAALLQLTRSLAKE  181 (270)
T ss_pred             C-CCCCCCHHHHHHHHHHHHHH
T ss_conf             5-20011499999989999999


No 248
>KOG1200 consensus
Probab=98.56  E-value=2e-07  Score=61.08  Aligned_cols=182  Identities=16%  Similarity=0.176  Sum_probs=101.0

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH--------------------HCCCCCHHHHHHHHHHC-----CCCEEEE
Q ss_conf             999978897889999999-649859996136--------------------70878999999999755-----9989997
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP--------------------DIDLLKPKDFASFFLSF-----SPDVIIN   56 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~--------------------~~D~~~~~~~~~~l~~~-----~pd~Vih   56 (290)
                      .+||||+.=||++++..| ++|..+...+++                    ++|..+.+.+...|++.     .|++++|
T Consensus        17 ~~vtGg~sGIGrAia~~la~~Garv~v~dl~~~~A~ata~~L~g~~~h~aF~~DVS~a~~v~~~l~e~~k~~g~psvlVn   96 (256)
T KOG1200          17 AAVTGGSSGIGRAIAQLLAKKGARVAVADLDSAAAEATAGDLGGYGDHSAFSCDVSKAHDVQNTLEEMEKSLGTPSVLVN   96 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             48734875077999999974696799750322447999862688776523530467578899999999984299728997


Q ss_pred             CCCCCCCC----CCCCCCCEEEEECCCCCCCCCCCCCCC-------CCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCC
Q ss_conf             86344543----223322102420122211000112233-------33334455321113575-5442111122221110
Q gi|254780921|r   57 PAAYTAVD----KAEDEPEIAFSINAEGAGAIAKAADSI-------GIPCIYISTDYVFDGLS-RTPIDEFSPTNPLNIY  124 (290)
Q Consensus        57 ~Aa~~~~~----~~e~~~~~~~~~Nv~~~~~l~~~~~~~-------~~~~I~iSS~~Vy~g~~-~~p~~E~d~~~P~~~Y  124 (290)
                      ||+++.-.    -.+.+.+....+|..|+-..++++.+.       +-.+|.+||--=--|+. +..|.-.    --..-
T Consensus        97 cAGItrD~~Llrmkq~qwd~vi~vNL~gvfl~tqaa~r~~~~~~~~~~sIiNvsSIVGkiGN~GQtnYAAs----K~GvI  172 (256)
T KOG1200          97 CAGITRDGLLLRMKQEQWDSVIAVNLTGVFLVTQAAVRAMVMNQQQGLSIINVSSIVGKIGNFGQTNYAAS----KGGVI  172 (256)
T ss_pred             CCCCCCCCCEEECCHHHHHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCEEEEEHHHHCCCCCCCCHHHHHH----CCCEE
T ss_conf             57646530201324888888997512136788899999999716798438864452102456552234453----27555


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             124566665310122232235554200036863200020112466521530455454452236899999999
Q gi|254780921|r  125 GKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIA  196 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~~~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~  196 (290)
                      |.||.++-++.+.. -+.-.+-|+++-.|--.-+.++++..+-...++.-    ++   -.+++|..++.+.
T Consensus       173 gftktaArEla~kn-IrvN~VlPGFI~tpMT~~mp~~v~~ki~~~iPmgr----~G---~~EevA~~V~fLA  236 (256)
T KOG1200         173 GFTKTAARELARKN-IRVNVVLPGFIATPMTEAMPPKVLDKILGMIPMGR----LG---EAEEVANLVLFLA  236 (256)
T ss_pred             EEEHHHHHHHHHCC-CEEEEECCCCCCCHHHHHCCHHHHHHHHCCCCCCC----CC---CHHHHHHHHHHHH
T ss_conf             30098899886548-24767614311681254438789999975587644----58---8899878999881


No 249
>PRK06720 hypothetical protein; Provisional
Probab=98.55  E-value=1.4e-07  Score=61.82  Aligned_cols=107  Identities=12%  Similarity=0.090  Sum_probs=68.0

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH---------------------CCCCCHHHHHHHHHH-----CCCCEEE
Q ss_conf             999978897889999999-6498599961367---------------------087899999999975-----5998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD---------------------IDLLKPKDFASFFLS-----FSPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~---------------------~D~~~~~~~~~~l~~-----~~pd~Vi   55 (290)
                      ++||||++=||+++++.| ++|.+|+.++|++                     +|+++.+++++++++     -+.|++|
T Consensus        19 alITGa~~GIG~a~A~~la~~Ga~Vvi~d~~~~~~~~~~~~i~~~g~~a~~~~~Dvs~~~~v~~~i~~~~~~~g~iDiLv   98 (169)
T PRK06720         19 AIVTGGGIGIGRNTALLLAKQGAKVIVTDIDQESGQATVEEITNLGGEALFVSYDMEKQGDWQRVISITLNAFSRIDMLF   98 (169)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99989754899999999998699899952763659999999997499537897588999999999999999759899899


Q ss_pred             ECCCCCCCCCC----CCCCCEEEEECCCC--CCCCCCCCCCCC-CCCCCCCCC-CCCCCCCC
Q ss_conf             78634454322----33221024201222--110001122333-333445532-11135755
Q gi|254780921|r   56 NPAAYTAVDKA----EDEPEIAFSINAEG--AGAIAKAADSIG-IPCIYISTD-YVFDGLSR  109 (290)
Q Consensus        56 h~Aa~~~~~~~----e~~~~~~~~~Nv~~--~~~l~~~~~~~~-~~~I~iSS~-~Vy~g~~~  109 (290)
                      |.|++...+..    +.+.+..+.+|...  ++..+....+.+ -.+|.+||- .+++.+..
T Consensus        99 NNAGI~~~~~~~~~~~e~~~~v~~vN~v~~~~k~~~~~m~kq~~G~IIN~aSi~Gl~G~~Gq  160 (169)
T PRK06720         99 QNAGLYKIDSIFSRQQENDSNVLCINDVWIEIKQLTSSFMKQQEEVVLSDLPIFGIIGTKGQ  160 (169)
T ss_pred             ECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCC
T ss_conf             89421788760017989999999887599999999999997599789998871512678883


No 250
>KOG1610 consensus
Probab=98.54  E-value=1.6e-07  Score=61.63  Aligned_cols=122  Identities=17%  Similarity=0.154  Sum_probs=86.3

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECH-------------------HHCCCCCHHHHHHHHH-------HCCCCEEE
Q ss_conf             999978897889999999-64985999613-------------------6708789999999997-------55998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGR-------------------PDIDLLKPKDFASFFL-------SFSPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r-------------------~~~D~~~~~~~~~~l~-------~~~pd~Vi   55 (290)
                      |||||+..-.|..|++.| ..|+.|++---                   -++|++++++++++.+       +..-..||
T Consensus        32 VlITGCDSGfG~~LA~~l~~~Gf~V~Agclt~~gae~L~~~~~s~rl~t~~LDVT~~esi~~a~~~V~~~l~~~gLwglV  111 (322)
T KOG1610          32 VLITGCDSGFGRLLAKKLDKKGFRVFAGCLTEEGAESLRGETKSPRLRTLQLDVTKPESVKEAAQWVKKHLGEDGLWGLV  111 (322)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             99834771777999999986588788872067058987632338740247532588789999999999864665513577


Q ss_pred             ECCCCCCC-CCC----CCCCCEEEEECCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             78634454-322----3322102420122211000112----23333334455321113575544211112222111012
Q gi|254780921|r   56 NPAAYTAV-DKA----EDEPEIAFSINAEGAGAIAKAA----DSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        56 h~Aa~~~~-~~~----e~~~~~~~~~Nv~~~~~l~~~~----~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      |+||+..+ ...    -.+.+...++|..|+..+.++.    +...-|+|++||-.   |.-..|        -..+|+.
T Consensus       112 NNAGi~~~~g~~ewl~~~d~~~~l~vNllG~irvT~~~lpLlr~arGRvV~v~S~~---Gr~~~p--------~~g~Y~~  180 (322)
T KOG1610         112 NNAGISGFLGPDEWLTVEDYRKVLNVNLLGTIRVTKAFLPLLRRARGRVVNVSSVL---GRVALP--------ALGPYCV  180 (322)
T ss_pred             ECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCC---CCCCCC--------CCCCCHH
T ss_conf             33664556685111529999998865305489999988877776057089950445---676676--------5665203


Q ss_pred             HHHHHHHHH
Q ss_conf             456666531
Q gi|254780921|r  127 SKLAGEEKV  135 (290)
Q Consensus       127 sK~~~E~~v  135 (290)
                      ||.+.|.+.
T Consensus       181 SK~aVeaf~  189 (322)
T KOG1610         181 SKFAVEAFS  189 (322)
T ss_pred             HHHHHHHHH
T ss_conf             299999999


No 251
>KOG1201 consensus
Probab=98.49  E-value=2.4e-07  Score=60.55  Aligned_cols=123  Identities=16%  Similarity=0.153  Sum_probs=81.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CCEEEEECHH--------------------HCCCCCHHHHHHHHHHC-----CCCEEE
Q ss_conf             499997889788999999964-9859996136--------------------70878999999999755-----998999
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRP--------------------DIDLLKPKDFASFFLSF-----SPDVII   55 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~--------------------~~D~~~~~~~~~~l~~~-----~pd~Vi   55 (290)
                      .+|||||.+=+|++++..+++ +..++..|.+                    .+|++|.+.+.+..++.     .+|++|
T Consensus        40 ~vLITGgg~GlGr~ialefa~rg~~~vl~Din~~~~~etv~~~~~~g~~~~y~cdis~~eei~~~a~~Vk~e~G~V~ILV  119 (300)
T KOG1201          40 IVLITGGGSGLGRLIALEFAKRGAKLVLWDINKQGNEETVKEIRKIGEAKAYTCDISDREEIYRLAKKVKKEVGDVDILV  119 (300)
T ss_pred             EEEEECCCCHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             89996898607899999999707848999556512399999998448525899558988999999999998619954998


Q ss_pred             ECCCCCC----CCCCCCCCCEEEEECCCCCCCCCCC----CCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             7863445----4322332210242012221100011----223-333334455321113575544211112222111012
Q gi|254780921|r   56 NPAAYTA----VDKAEDEPEIAFSINAEGAGAIAKA----ADS-IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK  126 (290)
Q Consensus        56 h~Aa~~~----~~~~e~~~~~~~~~Nv~~~~~l~~~----~~~-~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~  126 (290)
                      |-||+..    .+-...+-++.+++|+.+.-+..++    ..+ .+..+|-++|..   |....+.        ...|+.
T Consensus       120 NNAGI~~~~~ll~~~d~ei~k~~~vN~~~~f~t~kaFLP~M~~~~~GHIV~IaS~a---G~~g~~g--------l~~Yca  188 (300)
T KOG1201         120 NNAGIVTGKKLLDCSDEEIQKTFDVNTIAHFWTTKAFLPKMLENNNGHIVTIASVA---GLFGPAG--------LADYCA  188 (300)
T ss_pred             ECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEHHHH---CCCCCCC--------CHHHHH
T ss_conf             36642448875679989999999876689999999873888745796399835533---1357765--------323565


Q ss_pred             HHHHHHHHH
Q ss_conf             456666531
Q gi|254780921|r  127 SKLAGEEKV  135 (290)
Q Consensus       127 sK~~~E~~v  135 (290)
                      ||.++.-+.
T Consensus       189 SK~a~vGfh  197 (300)
T KOG1201         189 SKFAAVGFH  197 (300)
T ss_pred             HHHHHHHHH
T ss_conf             189999999


No 252
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]
Probab=98.48  E-value=2.8e-07  Score=60.22  Aligned_cols=57  Identities=28%  Similarity=0.440  Sum_probs=49.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-C-CEEEEECHH------------------HCCCCCHHHHHHHHHHCCCCEEEECCCC
Q ss_conf             9499997889788999999964-9-859996136------------------7087899999999975599899978634
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-D-VEIIRVGRP------------------DIDLLKPKDFASFFLSFSPDVIINPAAY   60 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~-~~v~~~~r~------------------~~D~~~~~~~~~~l~~~~pd~Vih~Aa~   60 (290)
                      |||||.|+ |.||+.++..|++ + ++|+..+|.                  ++|..|.+++.+++++.  |+||||+-.
T Consensus         2 ~~ilviGa-G~Vg~~va~~la~~~d~~V~iAdRs~~~~~~i~~~~~~~v~~~~vD~~d~~al~~li~~~--d~VIn~~p~   78 (389)
T COG1748           2 MKILVIGA-GGVGSVVAHKLAQNGDGEVTIADRSKEKCARIAELIGGKVEALQVDAADVDALVALIKDF--DLVINAAPP   78 (389)
T ss_pred             CCEEEECC-CHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCC--CEEEEECCC
T ss_conf             72899898-666799999998578962999848888999987533466316994256758899987257--789992870


No 253
>PRK12367 short chain dehydrogenase; Provisional
Probab=98.37  E-value=7.4e-07  Score=57.82  Aligned_cols=182  Identities=17%  Similarity=0.255  Sum_probs=104.0

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------CCCCCHHHHHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             4999978897889999999-6498599961367----------------0878999999999755998999786344543
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------IDLLKPKDFASFFLSFSPDVIINPAAYTAVD   64 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~   64 (290)
                      +|.||||+|-+|++|.+.| .+|..|+++++.+                +..-+++.+++.+++.  |++|.-.|+..-+
T Consensus        19 tIgITGAsGaLG~AL~k~f~~~GakVIalTh~~~~~~~~~~~~p~~wi~W~cG~E~~L~~~Lkki--DILILNHGIn~~~   96 (250)
T PRK12367         19 RIGITGASGALGKALTKLFRAKGAKVIGLTHSKINNSEISDESPNEWVSWECGKESSLDKTLAKI--DVLILNHGINPGG   96 (250)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHC--CEEEECCCCCCCC
T ss_conf             79996787389999999999889989998368888754556789528984349989999998758--8999838777455


Q ss_pred             C-CCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCC-C-CCHHHHHHHHHHHCCCC-
Q ss_conf             2-23322102420122211000112233333344553211135755442-111122221-1-10124566665310122-
Q gi|254780921|r   65 K-AEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPI-DEFSPTNPL-N-IYGKSKLAGEEKVASYT-  139 (290)
Q Consensus        65 ~-~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~~~~p~-~E~d~~~P~-~-~Yg~sK~~~E~~v~~~~-  139 (290)
                      . ...+...++++|..+.-+|++...+....-  -|.     -.++.++ +-+.+..|- | .|-.||.+.-|+|.--. 
T Consensus        97 ~~~~~~i~~s~EINalS~~RllelF~~~~~~~--~~~-----~~kEiWvNTSEAEi~PA~sP~YEiSKrliGqLVslr~n  169 (250)
T PRK12367         97 RQNSNDINKALEINALSSWRLLQLFEDIALNN--NSQ-----IPKEIWVNTSEAEIQPALSPVYEISKRLIGQLVSLKKN  169 (250)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCC-----CCCEEEEECCHHHCCCCCCCHHHHHHHHHCCEEEEECC
T ss_conf             65978999999877787999999999997366--555-----78358861516641543380378789874031155401


Q ss_pred             --C----CCCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEE
Q ss_conf             --2----3223555420003686320002011246652153045545445223689999999984420244334431376
Q gi|254780921|r  140 --N----NYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHM  213 (290)
Q Consensus       140 --~----~~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~  213 (290)
                        +    +-+++|- .+.||...++           .++.+        ...+.+|+.|..++..          |.+++
T Consensus       170 ~ld~~~~~~~~irK-liLGPFkS~L-----------NPiGi--------Ms~~~VA~~I~~~a~~----------~~~lI  219 (250)
T PRK12367        170 LLDKNERKKLIIRK-LILGPFRSEL-----------NPIGI--------MSADFVAKQIVDQANL----------GLYLI  219 (250)
T ss_pred             CCCCCCCCCCEEEE-EECCCCCCCC-----------CCCCC--------CCHHHHHHHHHHHHHC----------CCCEE
T ss_conf             14522256845899-8426655678-----------87522--------2889999999999844----------89569


Q ss_pred             ECCCCCCCH
Q ss_conf             238666788
Q gi|254780921|r  214 TADGGPVSW  222 (290)
Q Consensus       214 ~~~~~~~s~  222 (290)
                      .-+..++++
T Consensus       220 IVtpNPlty  228 (250)
T PRK12367        220 IVTPNPLTY  228 (250)
T ss_pred             EECCCCCEE
T ss_conf             983787224


No 254
>KOG1210 consensus
Probab=98.24  E-value=1.1e-05  Score=51.33  Aligned_cols=99  Identities=18%  Similarity=0.283  Sum_probs=73.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH-----------------------CCCCCHHHHHHHHHHC-----CCC
Q ss_conf             4999978897889999999-6498599961367-----------------------0878999999999755-----998
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD-----------------------IDLLKPKDFASFFLSF-----SPD   52 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~-----------------------~D~~~~~~~~~~l~~~-----~pd   52 (290)
                      +|+||||+.=+|-.++..+ .+|.+|..+.|+.                       .|+.|.+++...++..     -||
T Consensus        35 hi~itggS~glgl~la~e~~~~ga~Vti~ar~~~kl~~a~~~l~l~~~~~~v~~~S~d~~~Y~~v~~~~~~l~~~~~~~d  114 (331)
T KOG1210          35 HILITGGSSGLGLALALECKREGADVTITARSGKKLLEAKAELELLTQVEDVSYKSVDVIDYDSVSKVIEELRDLEGPID  114 (331)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             69981684156689999999703742999464878999874311444353036753553028999988763233048950


Q ss_pred             EEEECCCCCCCCCC----CCCCCEEEEECCCCCCCCCCCCC-------CCCCCCCCCCCC
Q ss_conf             99978634454322----33221024201222110001122-------333333445532
Q gi|254780921|r   53 VIINPAAYTAVDKA----EDEPEIAFSINAEGAGAIAKAAD-------SIGIPCIYISTD  101 (290)
Q Consensus        53 ~Vih~Aa~~~~~~~----e~~~~~~~~~Nv~~~~~l~~~~~-------~~~~~~I~iSS~  101 (290)
                      .+||||+..-+..-    -.+.+...++|..++-+++.+..       ..| +++.+||.
T Consensus       115 ~l~~cAG~~v~g~f~~~s~~~v~~~m~vNylgt~~v~~~~~~~mk~~~~~g-~I~~vsS~  173 (331)
T KOG1210         115 NLFCCAGVAVPGLFEDLSPEVVEKLMDVNYLGTVNVAKAAARAMKKREHLG-RIILVSSQ  173 (331)
T ss_pred             EEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC-EEEEEHHH
T ss_conf             278706765542001399999999887553446799999999863225684-79984332


No 255
>KOG1611 consensus
Probab=98.20  E-value=3.4e-06  Score=54.08  Aligned_cols=128  Identities=20%  Similarity=0.172  Sum_probs=84.6

Q ss_pred             EEEECCCCHHHHHHHHHHHC--CCEEEEEC-HH---------------------HCCCCCHHHHHHHHHHC-------CC
Q ss_conf             99997889788999999964--98599961-36---------------------70878999999999755-------99
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMCVQ--DVEIIRVG-RP---------------------DIDLLKPKDFASFFLSF-------SP   51 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l~~--~~~v~~~~-r~---------------------~~D~~~~~~~~~~l~~~-------~p   51 (290)
                      ++||||+-=||--|++.|.+  +.+++... |+                     ++|+++.+++.++.++.       ..
T Consensus         6 v~ItGaNRGIGlgLVk~llk~~~i~~iiat~r~~e~a~~~l~~k~~~d~rvHii~Ldvt~deS~~~~~~~V~~iVg~~Gl   85 (249)
T KOG1611           6 VFITGANRGIGLGLVKELLKDKGIEVIIATARDPEKAATELALKSKSDSRVHIIQLDVTCDESIDNFVQEVEKIVGSDGL   85 (249)
T ss_pred             EEEECCCCCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCC
T ss_conf             89962676210778899835788479998447967765787876325885279987336577799999998751466870


Q ss_pred             CEEEECCCCCCCCCCCCC-----CCEEEEECCCCCCCCCCCCC--------C-----C---CCCCCCCCCCCCCCCCCCC
Q ss_conf             899978634454322332-----21024201222110001122--------3-----3---3333445532111357554
Q gi|254780921|r   52 DVIINPAAYTAVDKAEDE-----PEIAFSINAEGAGAIAKAAD--------S-----I---GIPCIYISTDYVFDGLSRT  110 (290)
Q Consensus        52 d~Vih~Aa~~~~~~~e~~-----~~~~~~~Nv~~~~~l~~~~~--------~-----~---~~~~I~iSS~~Vy~g~~~~  110 (290)
                      ++.||.||+...-....+     ....|++|+.++..+.+.+.        +     .   .+.+|++||.+   |.   
T Consensus        86 nlLinNaGi~~~y~~~~~~~r~~~~~~~~tN~v~~il~~Q~~lPLLkkaas~~~gd~~s~~raaIinisS~~---~s---  159 (249)
T KOG1611          86 NLLINNAGIALSYNTVLKPSRAVLLEQYETNAVGPILLTQAFLPLLKKAASKVSGDGLSVSRAAIINISSSA---GS---  159 (249)
T ss_pred             EEEEECCCEEEECCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCC---CC---
T ss_conf             588854600132345668858999987501340399999999999998752246776564313589852111---34---


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             4211112222111012456666531012
Q gi|254780921|r  111 PIDEFSPTNPLNIYGKSKLAGEEKVASY  138 (290)
Q Consensus       111 p~~E~d~~~P~~~Yg~sK~~~E~~v~~~  138 (290)
                        .-.....|...|+.||.+--.+.++.
T Consensus       160 --~~~~~~~~~~AYrmSKaAlN~f~ksl  185 (249)
T KOG1611         160 --IGGFRPGGLSAYRMSKAALNMFAKSL  185 (249)
T ss_pred             --CCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             --57877763456675599999999886


No 256
>KOG1207 consensus
Probab=98.15  E-value=3.4e-06  Score=54.07  Aligned_cols=124  Identities=19%  Similarity=0.262  Sum_probs=88.2

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHHC------------------CCCCHHHHHHHHHHCCC-CEEEECCCCC
Q ss_conf             4999978897889999999-64985999613670------------------87899999999975599-8999786344
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDI------------------DLLKPKDFASFFLSFSP-DVIINPAAYT   61 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~~------------------D~~~~~~~~~~l~~~~p-d~Vih~Aa~~   61 (290)
                      +||+||+.--||++++..| +.|..|+++.|++.                  |+.+.+.+++.+....| |-.+|-||..
T Consensus         9 ~vlvTgagaGIG~~~v~~La~aGA~ViAvaR~~a~L~sLV~e~p~~I~Pi~~Dls~wea~~~~l~~v~pidgLVNNAgvA   88 (245)
T KOG1207           9 IVLVTGAGAGIGKEIVLSLAKAGAQVIAVARNEANLLSLVKETPSLIIPIVGDLSAWEALFKLLVPVFPIDGLVNNAGVA   88 (245)
T ss_pred             EEEEECCCCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCCCHHHHHCCCHHH
T ss_conf             99960566641499999998668879999569889999985297642455751338999997614657513430350144


Q ss_pred             C--C--CCCCCCCCEEEEECCCCCCCCCCCC----CCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             5--4--3223322102420122211000112----23333--33445532111357554421111222211101245666
Q gi|254780921|r   62 A--V--DKAEDEPEIAFSINAEGAGAIAKAA----DSIGI--PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAG  131 (290)
Q Consensus        62 ~--~--~~~e~~~~~~~~~Nv~~~~~l~~~~----~~~~~--~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~  131 (290)
                      -  +  +..+.+.+..|++|+.++.++.+..    ..+.+  -++.+||-+     +.+|++      -.+.|..+|.+-
T Consensus        89 ~~~pf~eiT~q~fDr~F~VNvravi~v~Q~var~lv~R~~~GaIVNvSSqa-----s~R~~~------nHtvYcatKaAL  157 (245)
T KOG1207          89 TNHPFGEITQQSFDRTFAVNVRAVILVAQLVARNLVDRQIKGAIVNVSSQA-----SIRPLD------NHTVYCATKAAL  157 (245)
T ss_pred             HCCHHHHHHHHHHCCEEEEEEEEEEEHHHHHHHHHHHCCCCCEEEEECCHH-----CCCCCC------CCEEEEECHHHH
T ss_conf             316378886876300045421222108999887666405886089740211-----036668------834775138789


Q ss_pred             HHHHC
Q ss_conf             65310
Q gi|254780921|r  132 EEKVA  136 (290)
Q Consensus       132 E~~v~  136 (290)
                      +.+-+
T Consensus       158 DmlTk  162 (245)
T KOG1207         158 DMLTK  162 (245)
T ss_pred             HHHHH
T ss_conf             99999


No 257
>KOG4169 consensus
Probab=98.13  E-value=3.6e-06  Score=53.99  Aligned_cols=132  Identities=20%  Similarity=0.238  Sum_probs=87.8

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             4999978897889999999-649859996136----------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      .+++||+.|=||.++.+.| .++..+.+.+.+                      ++|+++..++++.|++.     ..|+
T Consensus         7 na~vtggagGIGl~~sk~Ll~kgik~~~i~~~~En~~a~akL~ai~p~~~v~F~~~DVt~~~~~~~~f~ki~~~fg~iDI   86 (261)
T KOG4169           7 NALVTGGAGGIGLATSKALLEKGIKVLVIDDSEENPEAIAKLQAINPSVSVIFIKCDVTNRGDLEAAFDKILATFGTIDI   86 (261)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCHHEEEHHHHHCHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHCCEEE
T ss_conf             58996378636699999999767154061040147899998860399843999980120078899999999987094579


Q ss_pred             EEECCCCCCCCCCCCCCCEEEEECCCCCCC----CCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             997863445432233221024201222110----001122333----333445532111357554421111222211101
Q gi|254780921|r   54 IINPAAYTAVDKAEDEPEIAFSINAEGAGA----IAKAADSIG----IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYG  125 (290)
Q Consensus        54 Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~----l~~~~~~~~----~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg  125 (290)
                      +||-|++.+    ++|.+.+..+|..|..+    .+.+..+..    --+|.+||-  + |-.      -.+..|  .|+
T Consensus        87 lINgAGi~~----dkd~e~Ti~vNLtgvin~T~~alpyMdk~~gG~GGiIvNmsSv--~-GL~------P~p~~p--VY~  151 (261)
T KOG4169          87 LINGAGILD----DKDWERTINVNLTGVINGTQLALPYMDKKQGGKGGIIVNMSSV--A-GLD------PMPVFP--VYA  151 (261)
T ss_pred             EECCCCCCC----CHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCC--C-CCC------CCCCCH--HHH
T ss_conf             971664446----1207786502221200336663044554349998189970110--2-667------664202--323


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             24566665310122232235554
Q gi|254780921|r  126 KSKLAGEEKVASYTNNYVILRTA  148 (290)
Q Consensus       126 ~sK~~~E~~v~~~~~~~~IlR~~  148 (290)
                      .||.-.=-+-|..+.....-|.+
T Consensus       152 AsKaGVvgFTRSla~~ayy~~sG  174 (261)
T KOG4169         152 ASKAGVVGFTRSLADLAYYQRSG  174 (261)
T ss_pred             HCCCCEEEEEHHHHHHHHHHHCC
T ss_conf             20011564205422456676558


No 258
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated
Probab=98.10  E-value=7.8e-06  Score=52.06  Aligned_cols=162  Identities=17%  Similarity=0.227  Sum_probs=96.5

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             4999978897889999999-6498599961367------------------08789999999997559989997863445
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSFSPDVIINPAAYTA   62 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~   62 (290)
                      .|-|||++|-+|++|.+.| .+|..|+++++.+                  .+..++..+++.+++.  |+.|.-.|+..
T Consensus       182 TV~VTGASG~LG~aL~k~l~~~GAKVIalTs~~~~i~~~~~~~~~~~~~i~W~~G~E~~L~~~L~ki--DILILNHGIN~  259 (410)
T PRK07424        182 TVAVTGASGTLGQALLKELHQQGAKVIALTSNSDKIPLEINGEDLPVKTIHWQVGQEAALAELLEKV--DILVINHGINV  259 (410)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHC--CEEEECCCCCC
T ss_conf             7999547737789999999977998999935898655344665467127864328888988888646--89988488785


Q ss_pred             C-CCCCCCCCEEEEECCCCCCCCCCCCCCC-------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCHHHHHHHH
Q ss_conf             4-3223322102420122211000112233-------333344553211135755442111122221--11012456666
Q gi|254780921|r   63 V-DKAEDEPEIAFSINAEGAGAIAKAADSI-------GIPCIYISTDYVFDGLSRTPIDEFSPTNPL--NIYGKSKLAGE  132 (290)
Q Consensus        63 ~-~~~e~~~~~~~~~Nv~~~~~l~~~~~~~-------~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~--~~Yg~sK~~~E  132 (290)
                      - ++...+.+.++++|..+.-+|++.-...       ..|=|.+-|             -+.+..|-  -.|-.||.+--
T Consensus       260 ~g~~~~~~i~~S~EINalS~~rll~lF~~~~~~~~~~~~kEIWvNT-------------SEAEI~PA~sP~YEiSKrliG  326 (410)
T PRK07424        260 HGERTPEAINKSYEVNTFSAWRLMELFLTTVKTNQDKATKEVWVNT-------------SEAEVSPAFSPLYELSKRALG  326 (410)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEC-------------CHHHCCCCCCCHHHHHHHHHH
T ss_conf             6665978988767478777999999999996046445774389965-------------343205554828898999977


Q ss_pred             HHHCC-CCCCCCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             53101-2223223555420003686320002011246652153045545445223689999999984
Q gi|254780921|r  133 EKVAS-YTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       133 ~~v~~-~~~~~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      |++.- ....-.++|-- +.||...+           ..++.+        ...+.+|+.|..+++.
T Consensus       327 qLVSlrrl~~~~~IRKl-ILGPFkS~-----------LNPiGi--------MSa~~VAk~I~~~ak~  373 (410)
T PRK07424        327 DLVTLRRLDAPCVIRKL-ILGPFKSQ-----------LNPYGV--------MSADWVAKQIVKLAKR  373 (410)
T ss_pred             HHHHHHHCCCCCEEEEE-ECCCCCCC-----------CCCCCC--------CCHHHHHHHHHHHHHC
T ss_conf             65867633788268876-30554446-----------887620--------2889999999999855


No 259
>KOG3019 consensus
Probab=98.06  E-value=1.6e-06  Score=56.00  Aligned_cols=260  Identities=16%  Similarity=0.112  Sum_probs=144.6

Q ss_pred             EEEECCCCHHHHHHHH-----HH-----HCCCEEEEECHHHC--CCCCHHHHHHHHHHC----CCCEEEECCCCCCCCCC
Q ss_conf             9999788978899999-----99-----64985999613670--878999999999755----99899978634454322
Q gi|254780921|r    3 CLVIGNNGQIAQSLSS-----MC-----VQDVEIIRVGRPDI--DLLKPKDFASFFLSF----SPDVIINPAAYTAVDKA   66 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~-----~l-----~~~~~v~~~~r~~~--D~~~~~~~~~~l~~~----~pd~Vih~Aa~~~~~~~   66 (290)
                      -+.-+++|+|+.+|..     .+     ...|+|..++|...  .++=+    + ++..    .++..+|+++...    
T Consensus        15 a~~~~~~g~i~~nl~~~~~~~H~t~~~~a~~h~vtv~sR~pg~~ritw~----e-l~~~Gip~sc~a~vna~g~n~----   85 (315)
T KOG3019          15 AVSNWSNGIIRENLGSETSCCHDTNVHSADNHAVTVLSRSPGKARITWP----E-LDFPGIPISCVAGVNAVGNNA----   85 (315)
T ss_pred             CCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCC----H-HCCCCCCEEHHHHHHHHHHHC----
T ss_conf             7887666403201367630012488886554316999648997523450----2-207998502687775665532----


Q ss_pred             CCCCCE----EEEECC-----CCCCCCCCCCCCCC--C-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             332210----242012-----22110001122333--3-33445532111357554421111222211101245666653
Q gi|254780921|r   67 EDEPEI----AFSINA-----EGAGAIAKAADSIG--I-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEK  134 (290)
Q Consensus        67 e~~~~~----~~~~Nv-----~~~~~l~~~~~~~~--~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~  134 (290)
                       .+|..    .++-|+     ..|..|+++..+.-  . ..|.+|--++|--+...-|+|+++.--.+...+--++=|..
T Consensus        86 -l~P~rRWsp~fqkev~gSRi~~t~~la~aI~~aPq~~~~~Vlv~gva~y~pS~s~eY~e~~~~qgfd~~srL~l~WE~a  164 (315)
T KOG3019          86 -LLPIRRWSPEFQKEVKGSRIRVTSKLADAINNAPQEARPTVLVSGVAVYVPSESQEYSEKIVHQGFDILSRLCLEWEGA  164 (315)
T ss_pred             -CCCHHHCCHHHHHHHHCCEEEHHHHHHHHHHCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             -4923216977887753242008899999985498878775898766886145110033226567757999998988887


Q ss_pred             HCCCCC--CCCCCCCCCCEECCCCCCCCEEEC--CCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             101222--322355542000368632000201--1246652153045545445223689999999984420244334431
Q gi|254780921|r  135 VASYTN--NYVILRTAWVYSIFGSNFLLSMLR--LAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGI  210 (290)
Q Consensus       135 v~~~~~--~~~IlR~~~vyG~~~~~~v~~~l~--~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Gi  210 (290)
                      .+...+  +..++|.+.|.|.+|. .+..|+-  .+..+.++. .+.||+.=+|++|++..|..++++      ....|+
T Consensus       165 A~~~~~~~r~~~iR~GvVlG~gGG-a~~~M~lpF~~g~GGPlG-sG~Q~fpWIHv~DL~~li~~ale~------~~v~GV  236 (315)
T KOG3019         165 ALKANKDVRVALIRIGVVLGKGGG-ALAMMILPFQMGAGGPLG-SGQQWFPWIHVDDLVNLIYEALEN------PSVKGV  236 (315)
T ss_pred             HHCCCCCEEEEEEEEEEEEECCCC-CHHHHHHHHHHCCCCCCC-CCCEEEEEEEHHHHHHHHHHHHHC------CCCCCE
T ss_conf             634676404799997579833874-012322222303678678-877443356667789999999756------897742


Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCHHHHCCC-C-CCCCCCCCCH-----HHHHHHHCCCC--CCHHH
Q ss_conf             37623866678899999999999972798000576285880876-8-9975110086-----89999617899--99899
Q gi|254780921|r  211 FHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTK-A-HRPAYSCLDC-----SKLANTHNIRI--STWKE  281 (290)
Q Consensus       211 yn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~~~~~~~-a-~RP~~~~Ld~-----~K~~~~lg~~~--~~~~e  281 (290)
                      .|-+.. ..++..||++.+-....     ..-+.|++..-.... . +| .-.+|.-     .|+.+ +||+.  +...+
T Consensus       237 iNgvAP-~~~~n~Ef~q~lg~aL~-----Rp~~~pvP~fvvqA~fG~er-A~~vLeGqKV~Pqral~-~Gf~f~yp~vk~  308 (315)
T KOG3019         237 INGVAP-NPVRNGEFCQQLGSALS-----RPSWLPVPDFVVQALFGPER-ATVVLEGQKVLPQRALE-LGFEFKYPYVKD  308 (315)
T ss_pred             ECCCCC-CCCCHHHHHHHHHHHHC-----CCCCCCCCHHHHHHHHCCCC-EEEEEECCCCCCHHHHH-CCCEEECHHHHH
T ss_conf             346589-84405899999998857-----88535770999998747444-06996077014366764-376330647999


Q ss_pred             HHHHHHH
Q ss_conf             9999997
Q gi|254780921|r  282 GVRNILV  288 (290)
Q Consensus       282 ~i~~~i~  288 (290)
                      +|+++.+
T Consensus       309 Al~~i~~  315 (315)
T KOG3019         309 ALRAIMQ  315 (315)
T ss_pred             HHHHHHC
T ss_conf             9999749


No 260
>pfam03435 Saccharop_dh Saccharopine dehydrogenase. This family comprised of three structural domains that can not be separated in the linear sequence. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase.
Probab=98.01  E-value=1.5e-05  Score=50.40  Aligned_cols=55  Identities=25%  Similarity=0.373  Sum_probs=44.6

Q ss_pred             EEEECCCCHHHHHHHHHHHCCC---EEEEECHH-------------------HCCCCCHHHHHHHHHHCCCCEEEECCCC
Q ss_conf             9999788978899999996498---59996136-------------------7087899999999975599899978634
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMCVQDV---EIIRVGRP-------------------DIDLLKPKDFASFFLSFSPDVIINPAAY   60 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l~~~~---~v~~~~r~-------------------~~D~~~~~~~~~~l~~~~pd~Vih~Aa~   60 (290)
                      |||.|+ |++|+.+++.|.+..   +|+..+|+                   ++|..|.+++.+++++.  |+||||+..
T Consensus         1 IlvlGa-G~vG~~~~~~L~~~~~~~~i~vad~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~l~~~~~~~--diVv~~~p~   77 (384)
T pfam03435         1 VLIIGA-GGVGQGVAPLLARHGDVDEITVADRSLEKAQALAAPKLGLRFIAIAVDADNYEALAALLKEG--DLVINLAPP   77 (384)
T ss_pred             CEEECC-CHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHCC--CEEEECCCH
T ss_conf             989897-78799999999728998869999898899898775236985389995778999999987128--999999843


No 261
>KOG1014 consensus
Probab=97.95  E-value=1.8e-05  Score=50.00  Aligned_cols=123  Identities=16%  Similarity=0.209  Sum_probs=80.9

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH----------------------CCCCCHH----HHHHHHHHCCCCEEE
Q ss_conf             999978897889999999-6498599961367----------------------0878999----999999755998999
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD----------------------IDLLKPK----DFASFFLSFSPDVII   55 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~----------------------~D~~~~~----~~~~~l~~~~pd~Vi   55 (290)
                      ..|||+|.-||.+.++.| ++|.+|+-++|.+                      .|+++.+    .+++.+......++|
T Consensus        52 AVVTGaTDGIGKayA~eLAkrG~nvvLIsRt~~KL~~v~kEI~~~~~vev~~i~~Dft~~~~~ye~i~~~l~~~~VgILV  131 (312)
T KOG1014          52 AVVTGATDGIGKAYARELAKRGFNVVLISRTQEKLEAVAKEIEEKYKVEVRIIAIDFTKGDEVYEKLLEKLAGLDVGILV  131 (312)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             99977888522999999997598799996888999999999988758079999986489815689999886278648999


Q ss_pred             ECCCCCC--CCC----CCCCCCEEEEECCCCCCCCCCC----CCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             7863445--432----2332210242012221100011----223333-3344553211135755442111122221110
Q gi|254780921|r   56 NPAAYTA--VDK----AEDEPEIAFSINAEGAGAIAKA----ADSIGI-PCIYISTDYVFDGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        56 h~Aa~~~--~~~----~e~~~~~~~~~Nv~~~~~l~~~----~~~~~~-~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      |+++.+.  |..    .+........+|..++..+.+.    ..+.+. .++.+||..   |....|        -.+.|
T Consensus       132 NNvG~~~~~P~~f~~~~~~~~~~ii~vN~~~~~~~t~~ilp~M~~r~~G~IvnigS~a---g~~p~p--------~~s~y  200 (312)
T KOG1014         132 NNVGMSYDYPESFLKYPEGELQNIINVNILSVTLLTQLILPGMVERKKGIIVNIGSFA---GLIPTP--------LLSVY  200 (312)
T ss_pred             ECCCCCCCCCHHHHHCCHHHHHHEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCC---CCCCCH--------HHHHH
T ss_conf             6553167883778738556453146774326899998850555337886699822633---556671--------57887


Q ss_pred             HHHHHHHHHHHC
Q ss_conf             124566665310
Q gi|254780921|r  125 GKSKLAGEEKVA  136 (290)
Q Consensus       125 g~sK~~~E~~v~  136 (290)
                      +.||.-.+.+-.
T Consensus       201 sasK~~v~~~S~  212 (312)
T KOG1014         201 SASKAFVDFFSR  212 (312)
T ss_pred             HHHHHHHHHHHH
T ss_conf             787888888779


No 262
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional
Probab=97.76  E-value=5.9e-05  Score=47.10  Aligned_cols=178  Identities=15%  Similarity=0.139  Sum_probs=88.4

Q ss_pred             EEEECC--CCHHHHHHHHHH-HCCCEEEEECHH-----------------------------------HC----------
Q ss_conf             999978--897889999999-649859996136-----------------------------------70----------
Q gi|254780921|r    3 CLVIGN--NGQIAQSLSSMC-VQDVEIIRVGRP-----------------------------------DI----------   34 (290)
Q Consensus         3 iLVtG~--~G~iG~~l~~~l-~~~~~v~~~~r~-----------------------------------~~----------   34 (290)
                      .||||+  +.=||.++++.| .+|.+|+..++.                                   +.          
T Consensus        11 AlVTGaGgs~GIG~aiA~~lA~~GA~Vvi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~   90 (298)
T PRK06300         11 AFIAGIGDDQGYGWGIAKMLAEAGATIIVGTWVPIYKIFSQSWELGKFNESRKLSNGELLTIAKIYPMDASFDKPEDVPE   90 (298)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHCEEEEECCCCCCHHHHHH
T ss_conf             99908799862999999999982999999237530245556887655688887505630000346530034574323057


Q ss_pred             CCCCHH--------HHHHHH----HH-CCCCEEEECCCCCC------CCCCCCCCCEEEEECCCCCCCCCCCCC---CCC
Q ss_conf             878999--------999999----75-59989997863445------432233221024201222110001122---333
Q gi|254780921|r   35 DLLKPK--------DFASFF----LS-FSPDVIINPAAYTA------VDKAEDEPEIAFSINAEGAGAIAKAAD---SIG   92 (290)
Q Consensus        35 D~~~~~--------~~~~~l----~~-~~pd~Vih~Aa~~~------~~~~e~~~~~~~~~Nv~~~~~l~~~~~---~~~   92 (290)
                      |+++.+        .+.+++    ++ -+.|++||.||...      .+..+.+....+.+|..++..+++.+.   +.+
T Consensus        91 di~~~~~~~~l~~~~v~~~v~~~~~~fG~iDiLVnna~~~~~~~~~~~e~~~~~~~~~~~~n~~~~~~~~~~~~p~m~~~  170 (298)
T PRK06300         91 DIAENKRYKGISGYTISEVVEQVKKDFGHIDILVHSLANSPEISKPLLETSRKGYLAALSTSSYSFVSLLSHFGPIMNAG  170 (298)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             77656654100157999999999987799778998998887567784558999999999898499999999999997638


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCC----CCCCCCCCCCC-----EECCCC--CCCCE
Q ss_conf             33344553211135755442111122221110124566665310122----23223555420-----003686--32000
Q gi|254780921|r   93 IPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYT----NNYVILRTAWV-----YSIFGS--NFLLS  161 (290)
Q Consensus        93 ~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~----~~~~IlR~~~v-----yG~~~~--~~v~~  161 (290)
                      -..|.+||..   +....|       .....|+.+|.+.+.+.+..+    ++|-| |...|     ..+...  ++...
T Consensus       171 G~ii~i~s~~---~~~~~p-------~~~~~ysasKaal~~lTr~lA~E~g~~ygI-RVNaI~PG~i~T~~~~~~~~~e~  239 (298)
T PRK06300        171 GSTISLTYLA---SMRAVP-------GYGGGMSAAKAALESDTKTLAWEAGRRWGI-RVNTISAGPLASRAGKAIGFIER  239 (298)
T ss_pred             CCEEEEEEEE---CCCCCC-------CCCHHHHHHHHHHHHHHHHHHHHHCCCCCE-EEEEEECCCCCCCHHHCCCCCHH
T ss_conf             9447754300---134467-------740367999999986599999985701180-89998548644712321466299


Q ss_pred             EECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             2011246652153045545445223689999999984
Q gi|254780921|r  162 MLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHN  198 (290)
Q Consensus       162 ~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~  198 (290)
                      +.+......++       +...-.+|+|.++..|+.-
T Consensus       240 ~~~~~~~~~Pl-------~R~g~peeiA~~v~FLaSd  269 (298)
T PRK06300        240 MVDYYQDWAPL-------PEPMEAEQVGAVAAFLVSP  269 (298)
T ss_pred             HHHHHHHCCCC-------CCCCCHHHHHHHHHHHHCC
T ss_conf             99999857998-------9998999999999998084


No 263
>PRK08309 short chain dehydrogenase; Provisional
Probab=97.69  E-value=0.00016  Score=44.66  Aligned_cols=32  Identities=25%  Similarity=0.485  Sum_probs=29.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCCEEEEECHH
Q ss_conf             94999978897889999999649859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~~~v~~~~r~   32 (290)
                      |..||.|||||+......++.+|++|..+.|+
T Consensus         1 mhaLVIGGTGML~~vs~~L~~qg~~VsiiaR~   32 (182)
T PRK08309          1 MHALVIGGTGMLKRVSLWLCEEGFHVSIIARD   32 (182)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             91699724175599999997379999999448


No 264
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase; InterPro: IPR011286   This entry describes 2-deoxy-D-gluconate 3-dehydrogenase (also called 2-keto-3-deoxygluconate oxidoreductase), a member of the family of short-chain-alcohol dehydrogenases (IPR002198 from INTERPRO). This protein has been characterised in Erwinia chrysanthemi as an enzyme of pectin degradation .; GO: 0008678 2-deoxy-D-gluconate 3-dehydrogenase activity, 0051287 NAD binding.
Probab=97.46  E-value=0.00015  Score=44.79  Aligned_cols=130  Identities=22%  Similarity=0.238  Sum_probs=92.9

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEEC-HHH-------------------CCCCCHHHHHHHHHH-----CCCCEEE
Q ss_conf             4999978897889999999-6498599961-367-------------------087899999999975-----5998999
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVG-RPD-------------------IDLLKPKDFASFFLS-----FSPDVII   55 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~-r~~-------------------~D~~~~~~~~~~l~~-----~~pd~Vi   55 (290)
                      +.||||++-=||+-++--| .+|.+|++.. +.+                   +|+.+....+.++++     -+.|..|
T Consensus         7 ~alvTGa~tGlGQG~a~gLA~AGadi~g~~~~~~~~ET~~~v~~~Gr~f~~~~~Dl~~~~~~~~~~~~~~~~~g~~DiLV   86 (249)
T TIGR01832         7 VALVTGANTGLGQGIAVGLAEAGADIVGVGHISEPSETQQQVEALGRRFLSLTADLSDIEAIKALVDSAVEEFGKIDILV   86 (249)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHCCCEEHHHHHHHCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             68882598873689999998577417851431263888999998252100021212232137899999998618865676


Q ss_pred             ECCCCC----CCCCCCCCCCEEEEECCCCCCCCCCC----CCCCC--CCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCC
Q ss_conf             786344----54322332210242012221100011----22333--333445532111-35755442111122221110
Q gi|254780921|r   56 NPAAYT----AVDKAEDEPEIAFSINAEGAGAIAKA----ADSIG--IPCIYISTDYVF-DGLSRTPIDEFSPTNPLNIY  124 (290)
Q Consensus        56 h~Aa~~----~~~~~e~~~~~~~~~Nv~~~~~l~~~----~~~~~--~~~I~iSS~~Vy-~g~~~~p~~E~d~~~P~~~Y  124 (290)
                      |-|++-    .++.+|+|.+..+.+|...+-.|++.    +.+.|  .|+|-|-|=-=| +|-+-..|+ -++   ...-
T Consensus        87 NNAGIIrR~da~~f~e~dWd~V~nvNlk~vF~l~q~~a~~~l~~G~~GkiiNIAS~LSFQGGirVPsYT-ASK---~~v~  162 (249)
T TIGR01832        87 NNAGIIRREDAVEFSEKDWDDVMNVNLKSVFFLTQAAAKQFLKQGRGGKIINIASLLSFQGGIRVPSYT-ASK---HGVA  162 (249)
T ss_pred             ECCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEHHHHHHCCCCCCHHHH-HHH---HHHH
T ss_conf             074221045775156144579998668999999999999999648995057514234422675512466-667---7777


Q ss_pred             HHHHHHHHHHH
Q ss_conf             12456666531
Q gi|254780921|r  125 GKSKLAGEEKV  135 (290)
Q Consensus       125 g~sK~~~E~~v  135 (290)
                      |.||+.+-+..
T Consensus       163 GlTk~lAnEWa  173 (249)
T TIGR01832       163 GLTKLLANEWA  173 (249)
T ss_pred             HHHHHHHHHHH
T ss_conf             78999998998


No 265
>PRK08655 prephenate dehydrogenase; Provisional
Probab=97.41  E-value=0.00043  Score=42.27  Aligned_cols=59  Identities=20%  Similarity=0.268  Sum_probs=43.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHH-CCCEEEEECHHH---------CCCCCHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             949999788978899999996-498599961367---------0878999999999755998999786344
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRPD---------IDLLKPKDFASFFLSFSPDVIINPAAYT   61 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~~---------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~   61 (290)
                      |||.|.||+|-+|+.++++|. .||+|+..+|+.         ++........+++.+.  |+||-+.-+.
T Consensus         1 mkI~IIGG~G~MG~~Fa~~f~~sGyeV~I~gRd~~k~~~va~~LGv~~~~~~~e~~~~a--dvVIvsVPI~   69 (441)
T PRK08655          1 MKISIIGGTGGLGKWFARFLKDKGYEVIVWGRDPKKGKEVAKELGVEYASDNIDAAKDG--DIVIVSVPIN   69 (441)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHCCCCCCCHHHHHHCC--CEEEEECCHH
T ss_conf             97999947981779999999867988999815731356788873862224478897249--9999984889


No 266
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed
Probab=97.40  E-value=0.00055  Score=41.65  Aligned_cols=53  Identities=19%  Similarity=0.336  Sum_probs=39.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHH-CCCEEEEECHHH----------------CCCCCHHHHHHHHHHCCCCEEE
Q ss_conf             949999788978899999996-498599961367----------------0878999999999755998999
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRPD----------------IDLLKPKDFASFFLSFSPDVII   55 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~~----------------~D~~~~~~~~~~l~~~~pd~Vi   55 (290)
                      |||+|.|+ |-+|++|++.|. ++|+|+..++++                .|.++++.++++ .-.+.|.+|
T Consensus         1 M~IiI~Ga-G~vG~~La~~Ls~e~~dV~vID~d~~~~~~~~~~lDv~~i~Gd~~~~~~L~~A-gi~~ad~~I   70 (455)
T PRK09496          1 MKIIILGA-GQVGGTLAERLVGENNDVTVIDTDEERLRRLQDRLDVRTVVGNGSHPDVLREA-GAEDADMLI   70 (455)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHCCEEEEEECCCCHHHHHHC-CCCCCCEEE
T ss_conf             97999998-88999999999868997999989999999988625868999668999999965-998699999


No 267
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents glutamine-dependent CPSase (6.3.5.5 from EC) from prokaryotes and eukaryotes (CPSase II). ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=97.35  E-value=0.00053  Score=41.77  Aligned_cols=144  Identities=19%  Similarity=0.215  Sum_probs=90.5

Q ss_pred             EEEEECCCC----------HHHHHHHHHHH-CCCEEEEECHHHC---------C-----CCCHHHHHHHHHHCCCCEE-E
Q ss_conf             499997889----------78899999996-4985999613670---------8-----7899999999975599899-9
Q gi|254780921|r    2 KCLVIGNNG----------QIAQSLSSMCV-QDVEIIRVGRPDI---------D-----LLKPKDFASFFLSFSPDVI-I   55 (290)
Q Consensus         2 kiLVtG~~G----------~iG~~l~~~l~-~~~~v~~~~r~~~---------D-----~~~~~~~~~~l~~~~pd~V-i   55 (290)
                      ||||.|+.+          |-|+.=++.|+ +|++|+-+..|-+         |     =..+..+++++++.|||.| .
T Consensus         8 kvLviGSGPi~IGQAaEFDYSGsQAcKALkEEGy~viLVNsNpATimTD~~~AD~vY~ePlT~e~V~~IIEKERPDgiL~   87 (1089)
T TIGR01369         8 KVLVIGSGPIVIGQAAEFDYSGSQACKALKEEGYEVILVNSNPATIMTDPEMADKVYIEPLTPEAVEKIIEKERPDGILP   87 (1089)
T ss_pred             EEEEECCCCCCHHHHCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCHHHCCCCCCCCCCHHHHHHHHHHCCCCCHHC
T ss_conf             89996667311312023024789999998764957999758847233886686600252545888866653168660002


Q ss_pred             ECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCHHHHHHH
Q ss_conf             786344543223322102420122211000112233333344553211135755442----1111222211101245666
Q gi|254780921|r   56 NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPI----DEFSPTNPLNIYGKSKLAG  131 (290)
Q Consensus        56 h~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~~~~p~----~E~d~~~P~~~Yg~sK~~~  131 (290)
                      ++.|.|...       .+.+.+-.|+      ..++|++++=....++=.++-..-|    .|=..+-|.|.++.|=.+|
T Consensus        88 t~GGQTALN-------lav~L~~~GV------L~kYgV~vLGT~~eaI~kaEDRe~F~~~M~ei~~pvp~S~~~~~~eEA  154 (1089)
T TIGR01369        88 TLGGQTALN-------LAVELEESGV------LEKYGVEVLGTPVEAIKKAEDRELFREAMKEIGEPVPKSEIVHSVEEA  154 (1089)
T ss_pred             CCCCHHHHH-------HHHHHHHCCC------CHHHCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCHHHH
T ss_conf             576035777-------7886620685------145291785234243520202799999999738998811002788999


Q ss_pred             HHHHCCCCCCCCCCCCCCCEECCCCCCC
Q ss_conf             6531012223223555420003686320
Q gi|254780921|r  132 EEKVASYTNNYVILRTAWVYSIFGSNFL  159 (290)
Q Consensus       132 E~~v~~~~~~~~IlR~~~vyG~~~~~~v  159 (290)
                      ..+....+- =+|+|++.-.|..|.++.
T Consensus       155 ~~~a~~~Gy-PviVRpAftLGG~GgGiA  181 (1089)
T TIGR01369       155 LKAAKEIGY-PVIVRPAFTLGGTGGGIA  181 (1089)
T ss_pred             HHHHHHCCC-CEEECCCHHCCCCCCCEE
T ss_conf             999962689-689810032388998522


No 268
>PRK06732 phosphopantothenate--cysteine ligase; Validated
Probab=97.35  E-value=0.0009  Score=40.45  Aligned_cols=63  Identities=21%  Similarity=0.318  Sum_probs=46.2

Q ss_pred             CEEEEECC----------------CCHHHHHHHHHH-HCCCEEEEECHHH------------CCCCCHHHHHHHHHHC--
Q ss_conf             94999978----------------897889999999-6498599961367------------0878999999999755--
Q gi|254780921|r    1 MKCLVIGN----------------NGQIAQSLSSMC-VQDVEIIRVGRPD------------IDLLKPKDFASFFLSF--   49 (290)
Q Consensus         1 MkiLVtG~----------------~G~iG~~l~~~l-~~~~~v~~~~r~~------------~D~~~~~~~~~~l~~~--   49 (290)
                      ||||||+|                ||-.|.+|++.+ ..|++|+.+..+.            ..+...+++.+.+...  
T Consensus         1 ~kvLITaG~T~E~ID~VR~IsN~SSGk~G~aiA~~~~~~Ga~Vtli~g~~~~~p~~~~~~~~i~v~ta~em~~~~~~~~~   80 (228)
T PRK06732          1 MKILITSGGTTEPIDAVRGITNHSTGQLGKIIAETFLQAGHEVTLVTTKTAVKPEPHPNLSIIEIENVDDLLATLKPLVP   80 (228)
T ss_pred             CEEEEECCCCCCCCCCCCEECCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCEEEEEECCHHHHHHHHHHHCC
T ss_conf             98999578876676884476767814999999999997899899995677568898898589994589999999997478


Q ss_pred             CCCEEEECCCCCCC
Q ss_conf             99899978634454
Q gi|254780921|r   50 SPDVIINPAAYTAV   63 (290)
Q Consensus        50 ~pd~Vih~Aa~~~~   63 (290)
                      +.|++||+||.++.
T Consensus        81 ~~D~~I~aAAVsDy   94 (228)
T PRK06732         81 HHDVLIHSMAVSDY   94 (228)
T ss_pred             CCCEEEEEEEECCC
T ss_conf             99999993181015


No 269
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase; InterPro: IPR011848    In most bacteria, a single bifunctional protein catalyses phosphopantothenoylcysteine decarboxylase and phosphopantothenate--cysteine ligase activities, sequential steps in coenzyme A biosynthesis. These activities reside in separate proteins encoded by tandem genes in some bacterial lineages. This entry describes proteins from the genera Streptococcus and Enterococcus homologous to the C-terminal region of IPR005252 from INTERPRO, corresponding to phosphopantothenate--cysteine ligase activity ..
Probab=97.30  E-value=0.00046  Score=42.10  Aligned_cols=62  Identities=19%  Similarity=0.343  Sum_probs=44.8

Q ss_pred             CEEEEECC----------------CCHHHHHHHH-HHHCCCEEEEEC-----HH--HCCC-----CC----HHHHHHHHH
Q ss_conf             94999978----------------8978899999-996498599961-----36--7087-----89----999999997
Q gi|254780921|r    1 MKCLVIGN----------------NGQIAQSLSS-MCVQDVEIIRVG-----RP--DIDL-----LK----PKDFASFFL   47 (290)
Q Consensus         1 MkiLVtG~----------------~G~iG~~l~~-~l~~~~~v~~~~-----r~--~~D~-----~~----~~~~~~~l~   47 (290)
                      ||||||-|                ||-||..+++ +|.+||+|.-+.     |+  +.|+     .+    ...+++.+.
T Consensus         1 Mk~LvTsGGTsE~ID~VRSITNHStG~LGK~IaE~fL~~Gh~VtlvTTK~A~kP~~~~~Lsi~Eie~~~~L~~~L~~~v~   80 (253)
T TIGR02114         1 MKILVTSGGTSEPIDNVRSITNHSTGGLGKIIAEKFLAAGHEVTLVTTKRALKPEPQLNLSIKEIETVKDLLTTLKELVA   80 (253)
T ss_pred             CCEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCEEEECCHHHHHHHHHHHCC
T ss_conf             93688158863666663551233768721799999986587897875361218888888624864277899999887501


Q ss_pred             HCCCCEEEECCCCCC
Q ss_conf             559989997863445
Q gi|254780921|r   48 SFSPDVIINPAAYTA   62 (290)
Q Consensus        48 ~~~pd~Vih~Aa~~~   62 (290)
                      +.+.|++||.=|.|+
T Consensus        81 ~kq~d~liHsMAVSD   95 (253)
T TIGR02114        81 EKQHDILIHSMAVSD   95 (253)
T ss_pred             CCCCCEEEEEECCCC
T ss_conf             255438888511268


No 270
>pfam08643 DUF1776 Fungal family of unknown function (DUF1776). This is a fungal family of unknown function. One of the proteins in this family has been localized to the mitochondria.
Probab=97.22  E-value=0.00054  Score=41.72  Aligned_cols=137  Identities=9%  Similarity=-0.003  Sum_probs=80.1

Q ss_pred             EEEEC-CCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCC-----
Q ss_conf             99997-8897889999999-6498599961367------------------0878999999999755-----998-----
Q gi|254780921|r    3 CLVIG-NNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPD-----   52 (290)
Q Consensus         3 iLVtG-~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd-----   52 (290)
                      |||+| .+.-||+.++.-| .+|+.|+++.|++                  +|+++++++.+.++.+     +|.     
T Consensus         6 Vli~Gs~~~pi~R~iA~dL~rrGf~Vfa~~r~~~~~~~l~~~~~~~i~~L~lDvt~~~si~~a~~~~~~~l~~~~~~~~g   85 (296)
T pfam08643         6 VLVAGSPTEPLTRSIALDLERRGFIVFVTVTSAEEYKTVESEQREDIRPLWLDDTAPSSAEASLSEFLQLLETPHAPFPG   85 (296)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             99966999745899999999689789999577788999986244788527740788267999999999980676655578


Q ss_pred             ---------EEEECCCCCCC-C----CCCCCCCEEEEECCCCCCCCCCCCC------CCCCCCC-CCCCCCCCCCCCCCC
Q ss_conf             ---------99978634454-3----2233221024201222110001122------3333334-455321113575544
Q gi|254780921|r   53 ---------VIINPAAYTAV-D----KAEDEPEIAFSINAEGAGAIAKAAD------SIGIPCI-YISTDYVFDGLSRTP  111 (290)
Q Consensus        53 ---------~Vih~Aa~~~~-~----~~e~~~~~~~~~Nv~~~~~l~~~~~------~~~~~~I-~iSS~~Vy~g~~~~p  111 (290)
                               -||+..+...+ .    ....+.+..+++|+.++..+.++..      +.+.++| +.+|-.   |.-..|
T Consensus        86 ~~~~~l~L~gvi~~p~l~~p~Gpie~i~~~~~~~~~~~N~~g~i~~tq~~LPllr~~~~~~~iIv~~~Si~---g~~~~P  162 (296)
T pfam08643        86 AKPHVLRLRGVILVPSLSYPSGPIETIPPSSWASELNTRLLNPILTLQGLLPLLTSRSQKSKLIVFNPSIS---SSLNPP  162 (296)
T ss_pred             CCCCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCC---CCCCCC
T ss_conf             87552223247852676678785100899999999999949999999998888873468972899967631---145687


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHCCC-------CCCCCCCCCCCC
Q ss_conf             211112222111012456666531012-------223223555420
Q gi|254780921|r  112 IDEFSPTNPLNIYGKSKLAGEEKVASY-------TNNYVILRTAWV  150 (290)
Q Consensus       112 ~~E~d~~~P~~~Yg~sK~~~E~~v~~~-------~~~~~IlR~~~v  150 (290)
                      |.        ++|..+|.+-|-+...+       +-+.+.++++.+
T Consensus       163 ~~--------~~y~ask~ale~~s~~LR~El~~~gI~V~~i~pG~i  200 (296)
T pfam08643       163 YH--------APEALVSSALSTFFTILTRELRPHNIDVTQIKLGNL  200 (296)
T ss_pred             CC--------CHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             53--------599999999999999999874315965999944530


No 271
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism]
Probab=97.19  E-value=0.00095  Score=40.31  Aligned_cols=54  Identities=26%  Similarity=0.478  Sum_probs=47.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CCEEEEECHHH-------------CCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             499997889788999999964-98599961367-------------08789999999997559989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPD-------------IDLLKPKDFASFFLSFSPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~~-------------~D~~~~~~~~~~l~~~~pd~Vih   56 (290)
                      |||.+|+ |-+|.+++=.+.+ |.+|+++||..             .|..|.+.++.++++.+||+||-
T Consensus        14 kvmLLGS-GELGKEvaIe~QRLG~eVIAVDrY~~APAmqVAhrs~Vi~MlD~~al~avv~re~Pd~IVp   81 (394)
T COG0027          14 KVMLLGS-GELGKEVAIEAQRLGVEVIAVDRYANAPAMQVAHRSYVIDMLDGDALRAVVEREKPDYIVP   81 (394)
T ss_pred             EEEEECC-CCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHEEEEECCCHHHHHHHHHHHCCCEEEE
T ss_conf             8999638-8644699998886387799963768980664211113454569999999998658981331


No 272
>KOG1199 consensus
Probab=97.14  E-value=0.0011  Score=40.07  Aligned_cols=117  Identities=21%  Similarity=0.268  Sum_probs=78.9

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHH------------------CCCCCHHHHHHHHHHC-----CCCEEEECC
Q ss_conf             999978897889999999-6498599961367------------------0878999999999755-----998999786
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD------------------IDLLKPKDFASFFLSF-----SPDVIINPA   58 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~------------------~D~~~~~~~~~~l~~~-----~pd~Vih~A   58 (290)
                      -|||||.+-+|..-++.| ++|..+..++-++                  .|++.++.+...|...     +-|+.+|||
T Consensus        12 alvtggasglg~ataerlakqgasv~lldlp~skg~~vakelg~~~vf~padvtsekdv~aala~ak~kfgrld~~vnca   91 (260)
T KOG1199          12 ALVTGGASGLGKATAERLAKQGASVALLDLPQSKGADVAKELGGKVVFTPADVTSEKDVRAALAKAKAKFGRLDALVNCA   91 (260)
T ss_pred             EEEECCCCCCCHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             78616755202778999984686079872776544679998489369821666747889999998776605500265323


Q ss_pred             CCCC------CCCC----CCCCCEEEEECCCCCCCCCCCCCC---------CCCCCCCCCCCC--CCCCCCCCCCCCCCC
Q ss_conf             3445------4322----332210242012221100011223---------333334455321--113575544211112
Q gi|254780921|r   59 AYTA------VDKA----EDEPEIAFSINAEGAGAIAKAADS---------IGIPCIYISTDY--VFDGLSRTPIDEFSP  117 (290)
Q Consensus        59 a~~~------~~~~----e~~~~~~~~~Nv~~~~~l~~~~~~---------~~~~~I~iSS~~--Vy~g~~~~p~~E~d~  117 (290)
                      ++.-      +.+-    -.+.+....+|+.||-|+++....         .|-|=|-+.|++  -|||...        
T Consensus        92 gia~a~ktyn~~k~~~h~ledfqrvidvn~~gtfnvirl~aglmg~nepdq~gqrgviintasvaafdgq~g--------  163 (260)
T KOG1199          92 GIAYAFKTYNVQKKKHHDLEDFQRVIDVNVLGTFNVIRLGAGLMGENEPDQNGQRGVIINTASVAAFDGQTG--------  163 (260)
T ss_pred             CEEEEEEEEEECCCCCCCHHHHHHEEEEEEEEEEEEEEEHHHHHCCCCCCCCCCCEEEEEECEEEEECCCCC--------
T ss_conf             202544344313465452898655043200125544232024424788887884137982000012357432--------


Q ss_pred             CCCCCCCHHHHHH
Q ss_conf             2221110124566
Q gi|254780921|r  118 TNPLNIYGKSKLA  130 (290)
Q Consensus       118 ~~P~~~Yg~sK~~  130 (290)
                         ...|+.||-+
T Consensus       164 ---qaaysaskga  173 (260)
T KOG1199         164 ---QAAYSASKGA  173 (260)
T ss_pred             ---HHHHHCCCCC
T ss_conf             ---5554114673


No 273
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated
Probab=97.10  E-value=0.0016  Score=39.11  Aligned_cols=86  Identities=21%  Similarity=0.301  Sum_probs=50.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC--CCEEEEECHHHC----------------CCCC-HHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             9499997889788999999964--985999613670----------------8789-99999999755998999786344
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDI----------------DLLK-PKDFASFFLSFSPDVIINPAAYT   61 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~--~~~v~~~~r~~~----------------D~~~-~~~~~~~l~~~~pd~Vih~Aa~~   61 (290)
                      |||-|.|+||++|++|.++|.+  ..++..+.....                |+.= ....+.+.  .+.|+|+-|+...
T Consensus         2 ~kVaIvGAtG~vG~eli~lL~~hp~~ei~~las~~saGk~i~~~~p~l~~~~~~~~~~~~~~~~~--~~~Divf~alp~~   79 (345)
T PRK00436          2 IKVAIVGASGYTGGELLRLLLNHPEVEIVYLTSRSSAGKPLSDLHPHLRGLVDLVLEPLDPEEIA--AGADVVFLALPHG   79 (345)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCCCEEEEEECCCCCCCCHHHHCCCCCCCCCCEEEECCHHHHC--CCCCEEEECCCHH
T ss_conf             19999896618899999999809986799997578689737785811037778747649988942--6999999889838


Q ss_pred             CCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             543223322102420122211000112233333344553211135
Q gi|254780921|r   62 AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDG  106 (290)
Q Consensus        62 ~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g  106 (290)
                                        ....++..+.+.|+++|=.|++.-++.
T Consensus        80 ------------------~S~~~~~~~~~~g~~VID~SsdfR~~~  106 (345)
T PRK00436         80 ------------------VSMELAPQLLEAGVKVIDLSADFRLKD  106 (345)
T ss_pred             ------------------HHHHHHHHHHHCCCEEEECCHHHHCCC
T ss_conf             ------------------999999999866987998970120367


No 274
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF; InterPro: IPR012731    Members of the HesA/MoeB/ThiF family of proteins (IPR000594 from INTERPRO) include a number of members encoded in the midst of thiamine biosynthetic operons. This mix of known and putative ThiF proteins shows a deep split in phylogenetic trees. The Escherichia coli ThiF and MoeB proteins are seemingly more closely related than the E. coli ThiF and Campylobacter (for example) ThiF. This entry represents the more widely distributed clade of ThiF proteins as found in E. coli..
Probab=97.09  E-value=0.00064  Score=41.30  Aligned_cols=96  Identities=21%  Similarity=0.296  Sum_probs=50.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-C-CEEEEECHHHCCCC------------------CHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             499997889788999999964-9-85999613670878------------------999999999755998999786344
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-D-VEIIRVGRPDIDLL------------------KPKDFASFFLSFSPDVIINPAAYT   61 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~-~~v~~~~r~~~D~~------------------~~~~~~~~l~~~~pd~Vih~Aa~~   61 (290)
                      +|||.|+ |=||++.+.+|.. | +++...|....|+.                  +.+..++-+++.+||+.+..-.. 
T Consensus        23 ~VLiiGa-GgLGs~~~~~LA~AGVG~i~i~D~D~V~~SNLqRQ~Lf~e~Dv~~~~pK~e~aa~~l~~LN~~i~v~a~~~-  100 (210)
T TIGR02356        23 HVLIIGA-GGLGSPAALYLAAAGVGTITIVDDDHVDLSNLQRQILFAEEDVGTLRPKVEAAAERLRELNSDIRVTALKE-  100 (210)
T ss_pred             CEEEEEE-CHHHHHHHHHHHHCCCCEEEEEECCEECHHHCHHHHHHCHHHHHCCCHHHHHHHHHHHHHCCCCEEEEEEE-
T ss_conf             6599972-61456899999828883789985167701012055430324420131589999999985388968998542-


Q ss_pred             CCCCCC-------CCCCEEEEE--CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             543223-------322102420--12221100011223333334455
Q gi|254780921|r   62 AVDKAE-------DEPEIAFSI--NAEGAGAIAKAADSIGIPCIYIS   99 (290)
Q Consensus        62 ~~~~~e-------~~~~~~~~~--Nv~~~~~l~~~~~~~~~~~I~iS   99 (290)
                      .++..+       -||+....-  |...=.-+-++|.+.+.++||-|
T Consensus       101 ~vt~~~~~~~i~~~DPdlVlDc~DNf~tryliNdaC~~~~~PlI~aa  147 (210)
T TIGR02356       101 RVTAENLELLIENVDPDLVLDCTDNFATRYLINDACQALGIPLISAA  147 (210)
T ss_pred             CCCHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             02779999996238996896156687788999999998479869998


No 275
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated
Probab=97.06  E-value=0.0028  Score=37.64  Aligned_cols=53  Identities=25%  Similarity=0.513  Sum_probs=45.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CCEEEEECHHH-------------CCCCCHHHHHHHHHHCCCCEEE
Q ss_conf             499997889788999999964-98599961367-------------0878999999999755998999
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPD-------------IDLLKPKDFASFFLSFSPDVII   55 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~~-------------~D~~~~~~~~~~l~~~~pd~Vi   55 (290)
                      ||+|.|| |.||+-++...++ |++++.++...             .|+.|.+.+.++.+.+++|+|.
T Consensus        14 kIgIlGg-GQLg~Mla~aA~~LG~~vivld~~~d~PA~~vAd~~~~~~~~D~~al~~~a~~~~~DvvT   80 (395)
T PRK09288         14 RVMLLGS-GELGKEVAIEAQRLGVEVIAVDRYANAPAMQVAHRSHVIDMLDGDALRAVIEREKPDLIV   80 (395)
T ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEE
T ss_conf             8999898-899999999999879989998489959446728657977878999999999983899899


No 276
>pfam02571 CbiJ Precorrin-6x reductase CbiJ/CobK. This family consists of Precorrin-6x reductase EC:1.3.1.54. This enzyme catalyses the reaction: precorrin-6Y + NADP(+) <= precorrin-6X + NADPH. CbiJ and CobK both catalyse the reduction of macocycle in the colbalmin biosynthesis pathway.
Probab=97.05  E-value=0.0012  Score=39.76  Aligned_cols=83  Identities=19%  Similarity=0.368  Sum_probs=57.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-CCEEEEECH------HH--------CCCCCHHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             9499997889788999999964-985999613------67--------08789999999997559989997863445432
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGR------PD--------IDLLKPKDFASFFLSFSPDVIINPAAYTAVDK   65 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r------~~--------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~   65 (290)
                      |||||.|||+- |+.|++.|.+ +.-.+.++.      ..        .-+.+.+.+.+++++.+++.||.+.       
T Consensus         1 ~~IlilgGT~e-~r~la~~L~~~g~~~v~t~~~~~~~~~~~~~~~~~~G~l~~~~~m~~~i~~~~i~~vIDAT-------   72 (246)
T pfam02571         1 MRILILGGTTE-ARALAAALAAAGVVSVVTSLAGRTAAPRLPPLPVRVGGFGGADGLAAYLREEGIDAVIDAT-------   72 (246)
T ss_pred             CEEEEEEECHH-HHHHHHHHHHCCCEEEEECCCHHHCCCCCCCCCEEECCCCCHHHHHHHHHHCCCCEEEECC-------
T ss_conf             96999973689-9999999985698799984755443766788508979989999999999977997999899-------


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2332210242012221100011223333334455
Q gi|254780921|r   66 AEDEPEIAFSINAEGAGAIAKAADSIGIPCIYIS   99 (290)
Q Consensus        66 ~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iS   99 (290)
                         +|   |+.  ..+.+..++|...+++++-+-
T Consensus        73 ---HP---fA~--~is~na~~a~~~~~ipyiR~e   98 (246)
T pfam02571        73 ---HP---FAA--QISRNAAAACKELGVPLLRLE   98 (246)
T ss_pred             ---CC---CHH--HHHHHHHHHHHHHCCCEEEEC
T ss_conf             ---99---689--999999999998599689960


No 277
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional
Probab=97.04  E-value=0.0027  Score=37.73  Aligned_cols=55  Identities=15%  Similarity=0.132  Sum_probs=41.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC---CCEEEEECHHH-------C-------CCCCH---HHHHHHHHHCCCCEEEEC
Q ss_conf             9499997889788999999964---98599961367-------0-------87899---999999975599899978
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ---DVEIIRVGRPD-------I-------DLLKP---KDFASFFLSFSPDVIINP   57 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~---~~~v~~~~r~~-------~-------D~~~~---~~~~~~l~~~~pd~Vih~   57 (290)
                      |+|||||+.|  |.++++.|++   +..|+++|.+.       +       ..+++   +.+.+++++.++|+||-+
T Consensus         2 ~nILvt~~G~--~~~ii~~lk~~~~~~~Vi~~D~~~~a~~~~~aD~~y~~P~~~d~~y~~~ll~i~~~~~id~iiP~   76 (325)
T PRK12767          2 MNILVTSAGR--RVQLVKALKKSLLGGKVIGADISPLAPALYFADKFYVVPKVTDPNYIDALLDICKKENIDALIPL   76 (325)
T ss_pred             CEEEEECCCC--HHHHHHHHHHCCCCCEEEEECCCCCCCCHHHCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEC
T ss_conf             4899986786--89999999976998599996899899534454889987888987899999999998799999977


No 278
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional
Probab=97.03  E-value=0.0017  Score=38.96  Aligned_cols=79  Identities=19%  Similarity=0.208  Sum_probs=47.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHC--CCEEEEECHHHCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCEEEEECCC
Q ss_conf             499997889788999999964--985999613670878999999999755998999786344543223322102420122
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAE   79 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~--~~~v~~~~r~~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~~e~~~~~~~~~Nv~   79 (290)
                      ||.|.|++||.|.+|.++|..  ..+++.+...+  -.|...-++.+++.  |+||-|--    ...             
T Consensus         4 kV~I~GasGytG~EL~rlL~~Hp~vel~~i~~~~--~k~~~~~~~~~~~~--DvvFlalP----h~~-------------   62 (314)
T PRK11863          4 KVFIDGEAGTTGLQIRERLAGRSDIELLSIPEAK--RKDPAARRELLNAA--DIAILCLP----DDA-------------   62 (314)
T ss_pred             EEEEECCCCCHHHHHHHHHHCCCCEEEEEECCCC--CCCHHHHHHHHHCC--CEEEECCC----CHH-------------
T ss_conf             6999899885699999999759982999967112--55755678775069--99999999----778-------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             21100011223333334455321
Q gi|254780921|r   80 GAGAIAKAADSIGIPCIYISTDY  102 (290)
Q Consensus        80 ~~~~l~~~~~~~~~~~I~iSS~~  102 (290)
                       ...++....+.++|+|=.|+|.
T Consensus        63 -s~~~v~~~~~~g~kVIDLSaDf   84 (314)
T PRK11863         63 -AREAVALIDNPATRVIDASTAH   84 (314)
T ss_pred             -HHHHHHHHHHCCCEEEECCCCC
T ss_conf             -9999998862798899898544


No 279
>PRK05086 malate dehydrogenase; Provisional
Probab=96.92  E-value=0.00063  Score=41.31  Aligned_cols=95  Identities=20%  Similarity=0.170  Sum_probs=58.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC----CCEEEEECHHH------CCCCCH-----------HHHHHHHHHCCCCEEEECCC
Q ss_conf             9499997889788999999964----98599961367------087899-----------99999997559989997863
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ----DVEIIRVGRPD------IDLLKP-----------KDFASFFLSFSPDVIINPAA   59 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~----~~~v~~~~r~~------~D~~~~-----------~~~~~~l~~~~pd~Vih~Aa   59 (290)
                      |||-|+|++|.+|++++-.|..    ..++.-.|..+      +|+.+.           +...+.++..  |+||-+|+
T Consensus         1 mKV~IiGA~G~VG~s~A~~l~~~~~~~~el~L~Di~~~~~G~alDL~h~~~~~~~~~~~~~~~~~~l~~a--diVvitAG   78 (312)
T PRK05086          1 MKVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSGEDPTPALEGA--DVVLISAG   78 (312)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHCCCCCCCCCEEECCCHHHHHCCC--CEEEECCC
T ss_conf             9899998998699999999982898777499975888861056565478754665346169867871799--99998789


Q ss_pred             CCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC--CCCCCC
Q ss_conf             4454322332210242012221100011223333--334455
Q gi|254780921|r   60 YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI--PCIYIS   99 (290)
Q Consensus        60 ~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~--~~I~iS   99 (290)
                      .....  ......-++.|..-...+.+...+.+.  .++-+|
T Consensus        79 ~~rkp--G~tR~dLl~~Na~I~~~i~~~I~~~~p~aiiivvs  118 (312)
T PRK05086         79 VARKP--GMDRSDLFNVNAGIVKNLVEKVAKTCPKACIGIIT  118 (312)
T ss_pred             CCCCC--CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             89985--89889999987899999999887208971899954


No 280
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed predominantly of bacterial LDHs and a few fungal LDHs. Bacterial LDHs may be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=96.90  E-value=0.0043  Score=36.61  Aligned_cols=94  Identities=16%  Similarity=0.128  Sum_probs=58.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC---CCEEEEECHHH-------CCCCCHHHH----------HHHHHHCCCCEEEECCCC
Q ss_conf             9499997889788999999964---98599961367-------087899999----------999975599899978634
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ---DVEIIRVGRPD-------IDLLKPKDF----------ASFFLSFSPDVIINPAAY   60 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~---~~~v~~~~r~~-------~D~~~~~~~----------~~~l~~~~pd~Vih~Aa~   60 (290)
                      |||-|.|+ |.+|+.++-.|..   -.+++-+|+++       +|+.+...+          .+.+++  .|+||-+|+.
T Consensus         1 mKI~IIGa-G~VG~~~A~~l~~~~l~~el~L~Di~~~~a~g~a~DL~~a~~~~~~~~i~~~~~~~l~d--aDvVVitaG~   77 (308)
T cd05292           1 MKVAIVGA-GFVGSTTAYALLLRGLASEIVLVDINKAKAEGEAMDLAHGTPFVKPVRIYAGDYADCKG--ADVVVITAGA   77 (308)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCHHHHCC--CCEEEECCCC
T ss_conf             97999994-88899999999867998879999188984512568766241036881684099999779--9999989999


Q ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC--CCCCCC
Q ss_conf             454322332210242012221100011223333--334455
Q gi|254780921|r   61 TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI--PCIYIS   99 (290)
Q Consensus        61 ~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~--~~I~iS   99 (290)
                      ....  ..+...-+..|+.-.+.+++.+.+.+.  .++-+|
T Consensus        78 ~rk~--g~tR~dll~~Na~I~~~i~~~i~~~~p~~ivivvs  116 (308)
T cd05292          78 NQKP--GETRLDLLKRNVAIFKEIIPQILKYAPDAILLVVT  116 (308)
T ss_pred             CCCC--CCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             9998--99878999888999999999998419980899727


No 281
>cd00704 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. MDHs belong to the NAD-dependent, lactate dehydrogenase (LDH)-like, 2-hydroxycarboxylate dehydrogenase family, which also includes the GH4 family of glycoside hydrolases. They are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=96.86  E-value=0.00074  Score=40.94  Aligned_cols=95  Identities=19%  Similarity=0.199  Sum_probs=54.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCC----C----EEEEECHHH---------CCCCCH-----------HHHHHHHHHCCCC
Q ss_conf             94999978897889999999649----8----599961367---------087899-----------9999999755998
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQD----V----EIIRVGRPD---------IDLLKP-----------KDFASFFLSFSPD   52 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~----~----~v~~~~r~~---------~D~~~~-----------~~~~~~l~~~~pd   52 (290)
                      |||.|+|++|+||++++-+|..+    .    .+.-++..+         +|+.+.           +...+.++..  |
T Consensus         1 ~KV~IiGA~G~IG~~la~~l~~~~l~g~~~~i~l~L~Di~~~~~~~~G~~mdl~~~a~~~~~~v~~~~~~~~~~~~a--D   78 (323)
T cd00704           1 LHVLITGAAGQIGYNLLFLIASGELFGDDQPVILHLLDIPPAMKALEGVVMELQDCAFPLLKGVVITTDPEEAFKDV--D   78 (323)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCCEEECCCHHHHHCCC--C
T ss_conf             98999899978999999999728636998600899975888655531487866534665558748428858983799--8


Q ss_pred             EEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC---CCCCCCCC
Q ss_conf             999786344543223322102420122211000112233---33334455
Q gi|254780921|r   53 VIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSI---GIPCIYIS   99 (290)
Q Consensus        53 ~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~---~~~~I~iS   99 (290)
                      +||-+|+......  .....-...|+.-.+.+++...++   +++++-+|
T Consensus        79 vViitaG~prkpG--~tR~DLl~~N~~I~k~~~~~i~~~a~p~~~vivvs  126 (323)
T cd00704          79 VAILVGAFPRKPG--MERADLLRKNAKIFKEQGEALNKVAKPTVKVLVVG  126 (323)
T ss_pred             EEEECCCCCCCCC--CCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             8998278788999--82799998748999999999985179983899957


No 282
>pfam01113 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihydrodipicolinate reductase (DapB) reduces the alpha,beta-unsaturated cyclic imine, dihydro-dipicolinate. This reaction is the second committed step in the biosynthesis of L-lysine and its precursor meso-diaminopimelate, which are critical for both protein and cell wall biosynthesis. The N-terminal domain of DapB binds the dinucleotide NADPH.
Probab=96.86  E-value=0.0017  Score=38.85  Aligned_cols=80  Identities=26%  Similarity=0.381  Sum_probs=51.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC--CCEEEE-ECHHHC-----CCCC---------HHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             9499997889788999999964--985999-613670-----8789---------9999999975599899978634454
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ--DVEIIR-VGRPDI-----DLLK---------PKDFASFFLSFSPDVIINPAAYTAV   63 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~--~~~v~~-~~r~~~-----D~~~---------~~~~~~~l~~~~pd~Vih~Aa~~~~   63 (290)
                      |||.|.|++|-.|+.+++...+  +.++++ ++|+..     |+..         .....  ....++|+||.+-     
T Consensus         1 ikV~i~Ga~GrMG~~i~~~i~~~~~~~lv~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~--~~~~~~DVvIDFS-----   73 (122)
T pfam01113         1 IKVAVVGASGRMGRELIKAILEAPDFELVAAVDRPGSSLLGSDAGELAGPLGVPVTDDLE--EVLADADVLIDFT-----   73 (122)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCEECCCHH--HHCCCCCEEEEEC-----
T ss_conf             989998898878999999998589968999994389612254310014678711124477--7515788899906-----


Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             3223322102420122211000112233333344553
Q gi|254780921|r   64 DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYIST  100 (290)
Q Consensus        64 ~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS  100 (290)
                           .|        .++...+++|.+.++++|-=+|
T Consensus        74 -----~p--------~~~~~~~~~~~~~~~~~ViGTT   97 (122)
T pfam01113        74 -----TP--------EATLENLELALKHGKPLVIGTT   97 (122)
T ss_pred             -----CH--------HHHHHHHHHHHHCCCCEEEECC
T ss_conf             -----87--------8999999999967998899899


No 283
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase. Methylene Tetrahydromethanopterin Dehydrogenase (H4MPT DH) NADP binding domain. NADP-dependent H4MPT DH catalyzes the dehydrogenation of methylene- H4MPT and methylene-tetrahydrofolate (H4F) with NADP+ as cofactor. H4F and H4MPT are both cofactors that carry the one-carbon units between the formyl and methyl oxidation level. H4F and H4MPT are structurally analogous to each other with respect to the pterin moiety, but each has distinct side chain. H4MPT is present only in anaerobic methanogenic archaea and aerobic methylotrophic proteobacteria. H4MPT seems to have evolved independently from H4F and functions as a distinct carrier in C1 metabolism. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclo
Probab=96.85  E-value=0.0053  Score=36.12  Aligned_cols=31  Identities=23%  Similarity=0.507  Sum_probs=27.5

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHH
Q ss_conf             4999978897889999999-649859996136
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP   32 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~   32 (290)
                      +++|+|+||-||+..++.| .++.+|+-++|+
T Consensus        30 ~~~V~G~tG~vG~~~A~~lA~~Ga~v~lv~R~   61 (194)
T cd01078          30 TAVVLGGTGPVGQRAAVLLAREGARVVLVGRD   61 (194)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             89998588578999999999839979999587


No 284
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are localized to the glycosome and mitochondria. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=96.76  E-value=0.0015  Score=39.29  Aligned_cols=90  Identities=24%  Similarity=0.258  Sum_probs=55.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-C--CEEEEECHHH-----CCCCC------------HHHHHHHHHHCCCCEEEECCCC
Q ss_conf             9499997889788999999964-9--8599961367-----08789------------9999999975599899978634
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-D--VEIIRVGRPD-----IDLLK------------PKDFASFFLSFSPDVIINPAAY   60 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~--~~v~~~~r~~-----~D~~~------------~~~~~~~l~~~~pd~Vih~Aa~   60 (290)
                      |||-|.|++|.+|++++-.|.. +  .|++-+|.++     +|+..            .+.+++.+++.  |+||-+|+.
T Consensus         1 mKV~IIGA~G~VG~~~A~~l~~~~~~~elvLiDi~~~~g~a~DL~h~~~~~~v~~~~~~~~~~~~l~da--DiVVitAG~   78 (310)
T cd01337           1 VKVAVLGAAGGIGQPLSLLLKLNPLVSELALYDIVNTPGVAADLSHINTPAKVTGYLGPEELKKALKGA--DVVVIPAGV   78 (310)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHCCCCCCCEEEEECCCCHHHHHCCC--CEEEECCCC
T ss_conf             989999999818999999997299977699982774266755321656568512570887466774799--999987898


Q ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             4543223322102420122211000112233333
Q gi|254780921|r   61 TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIP   94 (290)
Q Consensus        61 ~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~   94 (290)
                      .+..  ......-.+.|..-...+++...+.+..
T Consensus        79 ~rkp--G~tR~dLl~~N~~I~k~i~~~i~~~~p~  110 (310)
T cd01337          79 PRKP--GMTRDDLFNINAGIVRDLATAVAKACPK  110 (310)
T ss_pred             CCCC--CCCHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             8997--9898999874078899999999820998


No 285
>COG3268 Uncharacterized conserved protein [Function unknown]
Probab=96.71  E-value=0.0016  Score=39.06  Aligned_cols=55  Identities=15%  Similarity=0.225  Sum_probs=40.8

Q ss_pred             EEEECCCCHHHHHHHHHHHC-CCEEEEECHH----------------HCCCCCHHHHHHHHHHCCCCEEEECCC
Q ss_conf             99997889788999999964-9859996136----------------708789999999997559989997863
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRP----------------DIDLLKPKDFASFFLSFSPDVIINPAA   59 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~----------------~~D~~~~~~~~~~l~~~~pd~Vih~Aa   59 (290)
                      ++|-|++||.|..+++.|.. +.+..--.|+                .+++-+++.+++...+.  .||+||++
T Consensus         9 ~iiYGAtGy~G~lvae~l~~~g~~~aLAgRs~~kl~~l~~~LG~~~~~~p~~~p~~~~~~~~~~--~VVlncvG   80 (382)
T COG3268           9 IIIYGATGYAGGLVAEYLAREGLTAALAGRSSAKLDALRASLGPEAAVFPLGVPAALEAMASRT--QVVLNCVG   80 (382)
T ss_pred             EEEECCCCCHHHHHHHHHHHCCCCHHHCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCC--EEEEECCC
T ss_conf             8997465521589999999748864321688899988998509664446778889999997426--68996146


No 286
>TIGR00036 dapB dihydrodipicolinate reductase; InterPro: IPR011770   Dihydrodipicolinate reductase is an enzyme found in bacteria and higher plants which is involved in the biosynthesis of diaminopimelic acid, a component of bacterial cell walls, and the essential amino acid L-lysine. It catalyses the the reduced pyridine nucleotide-dependent reduction of the alpha,beta-unsaturated cyclic imine, dihydrodipicolinate, to generate tetrahydrodipicolinate as shown below : 2,3-dihydrodipicolinate + NAD(P)H = 2,3,4,5-tetrahydrodipicolinate + NAD(P)(+) As this enzyme is not found in mammals it is a potential target for the development of novel antibacterial and herbicidal compounds.   The structures of the Escherichia coli (P04036 from SWISSPROT) and Mycobacterium tuberculosis (P72024 from SWISSPROT) enzymes have been determined , . The enzyme is a homotetramer where each monomer is composed of two domains, an N-terminal NAD(P)H-binding domain which forms a Rossman fold, and a C-terminal substrate-binding domain that forms an open, mixed alpha-beta sandwich.Tetramerisation occurs exclusively through interactions between C-terminal domain residues. Both enzymes show relatively little preference for either NADH or NADPH as cofactor. Conformational changes upon substrate binding bring the cofactor and substrate into close proximity and allow catalysis to occur. ; GO: 0008839 dihydrodipicolinate reductase activity, 0009089 lysine biosynthetic process via diaminopimelate, 0005737 cytoplasm.
Probab=96.70  E-value=0.0029  Score=37.60  Aligned_cols=58  Identities=17%  Similarity=0.357  Sum_probs=39.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHH---CCCEEEE-ECHHH------------------CCCCCHHHHHHHHH--HCCCCEEEE
Q ss_conf             949999788978899999996---4985999-61367------------------08789999999997--559989997
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV---QDVEIIR-VGRPD------------------IDLLKPKDFASFFL--SFSPDVIIN   56 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~---~~~~v~~-~~r~~------------------~D~~~~~~~~~~l~--~~~pd~Vih   56 (290)
                      |||-|+|+.|-+|+.+++...   ++.++++ ++|+.                  ..+++.......+.  +.+||++|.
T Consensus         2 ikvav~GA~GRMG~~~ik~~~~~ye~l~Lv~A~~~~~~~~~G~D~GEl~g~g~~gv~v~~~~~~~~~l~~~~~~~DVliD   81 (281)
T TIGR00036         2 IKVAVAGAAGRMGRELIKAVLQAYEGLKLVAAFERHGSSLQGTDIGELAGIGKVGVPVTDDLEAVLVLAFTETKPDVLID   81 (281)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             83588478873469999999974898167888861688856654202422554784100057889998740236864787


Q ss_pred             CC
Q ss_conf             86
Q gi|254780921|r   57 PA   58 (290)
Q Consensus        57 ~A   58 (290)
                      +-
T Consensus        82 FT   83 (281)
T TIGR00036        82 FT   83 (281)
T ss_pred             CC
T ss_conf             38


No 287
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are eukaryotic MDHs localized to the cytoplasm and cytosol. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=96.65  E-value=0.0011  Score=39.90  Aligned_cols=95  Identities=23%  Similarity=0.245  Sum_probs=56.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCC--------EEEEECHHH---------CCCCC-----------HHHHHHHHHHCCCC
Q ss_conf             949999788978899999996498--------599961367---------08789-----------99999999755998
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQDV--------EIIRVGRPD---------IDLLK-----------PKDFASFFLSFSPD   52 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~~--------~v~~~~r~~---------~D~~~-----------~~~~~~~l~~~~pd   52 (290)
                      |||.|||++|.||++|.-+|..|.        ++.-++..+         +|+.|           .+..++.|+..  |
T Consensus         3 ~kV~VtGAaG~Ig~~l~~~la~g~~~g~~~~i~L~L~Di~~~~~~l~Gv~mel~d~a~p~l~~i~~~~~~~~a~~~a--D   80 (325)
T cd01336           3 IRVLVTGAAGQIAYSLLPMIAKGDVFGPDQPVILHLLDIPPALKALEGVVMELQDCAFPLLKSVVATTDPEEAFKDV--D   80 (325)
T ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCCCCCEEEEEHHHCCCCCCCCEEECCCHHHHHCCC--C
T ss_conf             19999888718899999999758856899705999966778677655267457437864558735228878983688--7


Q ss_pred             EEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC---CCCCCCCC
Q ss_conf             999786344543223322102420122211000112233---33334455
Q gi|254780921|r   53 VIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSI---GIPCIYIS   99 (290)
Q Consensus        53 ~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~---~~~~I~iS   99 (290)
                      +||-+|+..+-..  .....-++.|..-.+.+.+...++   +++++-+|
T Consensus        81 vvii~ag~prkpG--mtR~DLl~~Na~I~k~~~~~I~~~a~p~~~viVv~  128 (325)
T cd01336          81 VAILVGAMPRKEG--MERKDLLKANVKIFKEQGEALDKYAKKNVKVLVVG  128 (325)
T ss_pred             EEEEECCCCCCCC--CCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             8999488779999--82799999899999999999998614581999927


No 288
>KOG2733 consensus
Probab=96.64  E-value=0.0031  Score=37.40  Aligned_cols=55  Identities=16%  Similarity=0.267  Sum_probs=40.6

Q ss_pred             EEEECCCCHHHHHHHHHHHC-----CCEEEEECHHH-------------------------CCCCCHHHHHHHHHHCCCC
Q ss_conf             99997889788999999964-----98599961367-------------------------0878999999999755998
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMCVQ-----DVEIIRVGRPD-------------------------IDLLKPKDFASFFLSFSPD   52 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l~~-----~~~v~~~~r~~-------------------------~D~~~~~~~~~~l~~~~pd   52 (290)
                      +.|.|++||-|..+++.+..     +...-.-.|++                         +|.+|++++.+..++.  .
T Consensus         8 vVIyGASGfTG~yivee~v~~~~~~~~slavAGRn~~KL~~vL~~~~~k~~~~ls~~~i~i~D~~n~~Sl~emak~~--~   85 (423)
T KOG2733           8 VVIYGASGFTGKYIVEEAVSSQVFEGLSLAVAGRNEKKLQEVLEKVGEKTGTDLSSSVILIADSANEASLDEMAKQA--R   85 (423)
T ss_pred             EEEECCCCCCCEEEHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHH--E
T ss_conf             99981566653024898864302467547873278889999999986324888665438994378878999998641--7


Q ss_pred             EEEECCC
Q ss_conf             9997863
Q gi|254780921|r   53 VIINPAA   59 (290)
Q Consensus        53 ~Vih~Aa   59 (290)
                      +|+||++
T Consensus        86 vivN~vG   92 (423)
T KOG2733          86 VIVNCVG   92 (423)
T ss_pred             EEEECCC
T ss_conf             8775155


No 289
>KOG1478 consensus
Probab=96.62  E-value=0.0057  Score=35.94  Aligned_cols=131  Identities=16%  Similarity=0.085  Sum_probs=73.5

Q ss_pred             CE--EEEECCCCHHHHHHHHHH-HCCCE-----EEEECHH-------------------------HCCCCCHHHHHHHHH
Q ss_conf             94--999978897889999999-64985-----9996136-------------------------708789999999997
Q gi|254780921|r    1 MK--CLVIGNNGQIAQSLSSMC-VQDVE-----IIRVGRP-------------------------DIDLLKPKDFASFFL   47 (290)
Q Consensus         1 Mk--iLVtG~~G~iG~~l~~~l-~~~~~-----v~~~~r~-------------------------~~D~~~~~~~~~~l~   47 (290)
                      ||  +||||+++-||-+++..| .+..+     ++-..|+                         ..|++|-.++.++..
T Consensus         2 ~RKvalITGanSglGl~i~~RLl~~~De~~~ltl~ltcR~~~kae~vc~~lk~f~p~~~i~~~yvlvD~sNm~Sv~~A~~   81 (341)
T KOG1478           2 MRKVALITGANSGLGLAICKRLLAEDDENVRLTLCLTCRNMSKAEAVCAALKAFHPKSTIEVTYVLVDVSNMQSVFRASK   81 (341)
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEEEEEEHHHHHHHHHHHH
T ss_conf             72389994488864399999997515776169999971772679999999997488761379999985065899999999


Q ss_pred             HC-----CCCEEEECCCC----------------CCCC---------------CCCCCCCEEEEECCCCCCCCCCC----
Q ss_conf             55-----99899978634----------------4543---------------22332210242012221100011----
Q gi|254780921|r   48 SF-----SPDVIINPAAY----------------TAVD---------------KAEDEPEIAFSINAEGAGAIAKA----   87 (290)
Q Consensus        48 ~~-----~pd~Vih~Aa~----------------~~~~---------------~~e~~~~~~~~~Nv~~~~~l~~~----   87 (290)
                      +.     +.|+|.--||+                +++-               .+..+....++.||.|.-.|...    
T Consensus        82 di~~rf~~ld~iylNAg~~~~~gi~w~~avf~~fsnpv~amt~pt~~~~t~G~is~D~lg~iFetnVFGhfyli~~l~pl  161 (341)
T KOG1478          82 DIKQRFQRLDYIYLNAGIMPNPGINWKAAVFGLFSNPVIAMTSPTEGLLTQGKISADGLGEIFETNVFGHFYLIRELEPL  161 (341)
T ss_pred             HHHHHHHHCCEEEECCCCCCCCCCCHHHHHHHHHHCHHHHHCCCHHHHHHCCEECCCCHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             99988653358997156578876359999999860236775281066552451335536667520444110248655367


Q ss_pred             -CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCHHHHHHHHHH
Q ss_conf             -2233333344553211135755442111122-2211101245666653
Q gi|254780921|r   88 -ADSIGIPCIYISTDYVFDGLSRTPIDEFSPT-NPLNIYGKSKLAGEEK  134 (290)
Q Consensus        88 -~~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~-~P~~~Yg~sK~~~E~~  134 (290)
                       |...+-.+|.+||-.   ..+..-.-||-.+ .-.-+|.-||.+.+-+
T Consensus       162 l~~~~~~~lvwtSS~~---a~kk~lsleD~q~~kg~~pY~sSKrl~DlL  207 (341)
T KOG1478         162 LCHSDNPQLVWTSSRM---ARKKNLSLEDFQHSKGKEPYSSSKRLTDLL  207 (341)
T ss_pred             HHCCCCCEEEEEEECC---CCCCCCCHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             6437997389972011---466568878876433789742117899999


No 290
>pfam00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain. L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate. The enzyme participates in the citric acid cycle. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. N-terminus (this family) is a Rossmann NAD-binding fold. C-terminus is an unusual alpha+beta fold.
Probab=96.59  E-value=0.00094  Score=40.35  Aligned_cols=33  Identities=24%  Similarity=0.327  Sum_probs=25.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-C--CEEEEECHHH
Q ss_conf             9499997889788999999964-9--8599961367
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-D--VEIIRVGRPD   33 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~--~~v~~~~r~~   33 (290)
                      |||-|.|+.|.+|++++-.|.. +  .|++-+|.++
T Consensus         1 mKV~IIGagg~VG~~~A~~l~~~~l~~elvL~D~~~   36 (142)
T pfam00056         1 VKVAVVGAGGGVGSSLAFALALQGLADELVLVDINK   36 (142)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCCC
T ss_conf             989998987789999999997479663478850577


No 291
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are bacterial MDHs, and plant MDHs localized to the choloroplasts. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=96.57  E-value=0.0012  Score=39.80  Aligned_cols=95  Identities=19%  Similarity=0.129  Sum_probs=51.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCC----C----EEEEECHHH---------CCCCCH-----------HHHHHHHHHCCCC
Q ss_conf             94999978897889999999649----8----599961367---------087899-----------9999999755998
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQD----V----EIIRVGRPD---------IDLLKP-----------KDFASFFLSFSPD   52 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~----~----~v~~~~r~~---------~D~~~~-----------~~~~~~l~~~~pd   52 (290)
                      |||.|+|++|+||++++-.|.++    .    ++.-++..+         +|+.+-           ....+.++..  |
T Consensus         3 ~KV~IiGAaG~IG~~la~~la~g~l~g~~~~v~l~L~Di~~~~~~l~G~amDl~~~a~~~~~~v~~~~~~~~a~~~a--D   80 (322)
T cd01338           3 VRVAVTGAAGQIGYSLLFRIASGEMFGPDQPVILQLLELPQALKALEGVAMELEDCAFPLLAEIVITDDPNVAFKDA--D   80 (322)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHCHHCCCCCEEEEEEECCCCCCCCCCEEEEEHHHCCCCCCCCEEEECCHHHHHCCC--C
T ss_conf             09999899968999999999711130799726999975757566676577445326765458779748878983788--7


Q ss_pred             EEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC---CCCCCCCC
Q ss_conf             999786344543223322102420122211000112233---33334455
Q gi|254780921|r   53 VIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSI---GIPCIYIS   99 (290)
Q Consensus        53 ~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~---~~~~I~iS   99 (290)
                      +||-+|+..+-..  .....-++.|..-...+.+...+.   +++++-+|
T Consensus        81 vVvitaG~prkPG--~tR~DLl~~Na~I~~~~~~~i~~~a~p~~~vivvs  128 (322)
T cd01338          81 WALLVGAKPRGPG--MERADLLKANGKIFTAQGKALNDVASRDVKVLVVG  128 (322)
T ss_pred             EEEEECCCCCCCC--CCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             8999368789989--81899999868999999999997579883899957


No 292
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed
Probab=96.57  E-value=0.0026  Score=37.87  Aligned_cols=84  Identities=14%  Similarity=0.102  Sum_probs=48.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHCC----CEEEEECHHH-----CCCCCHHH----H-HHHHHHCCCCEEEECCCCCCCCCCC
Q ss_conf             4999978897889999999649----8599961367-----08789999----9-9999755998999786344543223
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQD----VEIIRVGRPD-----IDLLKPKD----F-ASFFLSFSPDVIINPAAYTAVDKAE   67 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~~----~~v~~~~r~~-----~D~~~~~~----~-~~~l~~~~pd~Vih~Aa~~~~~~~e   67 (290)
                      ||-|.|+||++|++|.++|.+.    .++..++.++     ..+.+.+.    + ..-+.  +.|++|.|+..       
T Consensus         4 kVaIvGATG~vG~eli~lL~~~~~p~~~i~~~aS~~s~G~~~~~~~~~~~~~~~~~~~~~--~~Di~f~a~~~-------   74 (348)
T PRK06598          4 NVGVVGATGMVGSVLLQMLEERDFPVIEPVFFASSRSGGKAPSFGGKTLLVDALDIEDLK--GLDIALFSAGG-------   74 (348)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCEECCCEEEEEECCHHHHH--CCCEEEECCCC-------
T ss_conf             799989845999999999986799962499998756689875068955478627855760--79999986882-------


Q ss_pred             CCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             32210242012221100011223333334455321113
Q gi|254780921|r   68 DEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFD  105 (290)
Q Consensus        68 ~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~  105 (290)
                                 +-+..++..+.+.|+++|=.|++.-++
T Consensus        75 -----------~~s~~~~~~~~~~g~~VIDlSs~fR~~  101 (348)
T PRK06598         75 -----------DYSKEVAPKLRAAGGVVIDNASALRMD  101 (348)
T ss_pred             -----------HHHHHHHHHHHHCCCEEEECCHHHCCC
T ss_conf             -----------356888899975898999886431036


No 293
>KOG1198 consensus
Probab=96.56  E-value=0.013  Score=33.93  Aligned_cols=61  Identities=11%  Similarity=0.229  Sum_probs=43.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-C-CEEEEECHHH-------------CCCCCHHHHHHHHH--HCCCCEEEECCCCC
Q ss_conf             9499997889788999999964-9-8599961367-------------08789999999997--55998999786344
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-D-VEIIRVGRPD-------------IDLLKPKDFASFFL--SFSPDVIINPAAYT   61 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~-~~v~~~~r~~-------------~D~~~~~~~~~~l~--~~~pd~Vih~Aa~~   61 (290)
                      ++|||.||+|-+|+..+.+.+. + ..+++..+.+             .|..+++-++...+  ...+|+|+.|++-.
T Consensus       159 ~~vLv~ggsggVG~~aiQlAk~~~~~~v~t~~s~e~~~l~k~lGAd~vvdy~~~~~~e~~kk~~~~~~DvVlD~vg~~  236 (347)
T KOG1198         159 KSVLVLGGSGGVGTAAIQLAKHAGAIKVVTACSKEKLELVKKLGADEVVDYKDENVVELIKKYTGKGVDVVLDCVGGS  236 (347)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCC
T ss_conf             869999387489999999998749747999815541689997299651248857799998762278850999888897


No 294
>PRK05442 malate dehydrogenase; Provisional
Probab=96.52  E-value=0.0051  Score=36.21  Aligned_cols=95  Identities=22%  Similarity=0.180  Sum_probs=52.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCC--------CEEEEECHHH---------CCCCCH-----------HHHHHHHHHCCCC
Q ss_conf             94999978897889999999649--------8599961367---------087899-----------9999999755998
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQD--------VEIIRVGRPD---------IDLLKP-----------KDFASFFLSFSPD   52 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~--------~~v~~~~r~~---------~D~~~~-----------~~~~~~l~~~~pd   52 (290)
                      |||.|||++|+||+.|.-.+..|        .++.-++.++         +|+.|-           +..++.++..  |
T Consensus         5 ~kV~I~GAaG~ig~~l~~~la~g~l~g~~~~v~l~L~Di~~~~~~l~G~ameL~d~a~p~l~~v~~~~~~~~a~~~a--D   82 (325)
T PRK05442          5 VRVAVTGAAGQIGYSLLFRIASGDMLGKDQPVILQLLEIPQAQKALKGVVMELEDCAFPLLAGVVITDDPKVAFKDA--D   82 (325)
T ss_pred             EEEEEECCCCHHHHHHHHHHHCHHHCCCCCCEEEEEECCCCCCCCCCEEEEEHHCCCCCCCCCEEEECCHHHHHCCC--C
T ss_conf             29999888868889999998661320899846999965777666556677342116754448768508878983799--8


Q ss_pred             EEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCC---CCCCCCCC
Q ss_conf             999786344543223322102420122211000112233---33334455
Q gi|254780921|r   53 VIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSI---GIPCIYIS   99 (290)
Q Consensus        53 ~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~---~~~~I~iS   99 (290)
                      +||-+|+..+-..  .....-.+.|..-.+.+.++..++   +++++-+|
T Consensus        83 vviitag~prkPG--mtR~DLl~~Na~I~~~~~~~i~~~a~~~~~vlVv~  130 (325)
T PRK05442         83 VALLVGARPRGPG--MERKDLLKANGEIFTAQGKALNEVAARDVKVLVVG  130 (325)
T ss_pred             EEEECCCCCCCCC--CCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             8998078679999--74899997608899999999986579871899957


No 295
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity. The LDH-like MDH proteins have a lactate dehyhydrogenase-like (LDH-like) structure and malate dehydrogenase (MDH) enzymatic activity. This subgroup is composed of some archaeal LDH-like MDHs that prefer NADP(H) rather than NAD(H) as a cofactor. One member, MJ0490 from Methanococcus jannaschii, has been observed to form dimers and tetramers during crystalization, although it is believed to exist primarilly as a tetramer in solution. In addition to its MDH activity, MJ0490 also possesses fructose-1,6-bisphosphate-activated LDH activity. Members of this subgroup have a higher sequence similarity to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carbox
Probab=96.47  E-value=0.003  Score=37.49  Aligned_cols=95  Identities=19%  Similarity=0.202  Sum_probs=56.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCC---CEEEEECHHH---------CCCCCHHH------------HHHHHHHCCCCEEEE
Q ss_conf             94999978897889999999649---8599961367---------08789999------------999997559989997
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQD---VEIIRVGRPD---------IDLLKPKD------------FASFFLSFSPDVIIN   56 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~---~~v~~~~r~~---------~D~~~~~~------------~~~~l~~~~pd~Vih   56 (290)
                      |||-|+|++|.+|+.++-.|...   .+++-+|.++         +|+.+...            -.+.+++.  |+||-
T Consensus         1 mKV~IiGAaG~VG~~~a~~l~~~~~~~el~LiD~~~~~~~a~g~a~Dl~~~~~~~~~~~~i~~~~d~~~~~da--DivVi   78 (309)
T cd05294           1 MKVSIIGASGRVGSATALLLAKEDVVKEINLISRPKSLEKLKGLRLDIYDALAAAGIDAEIKISSDLSDVAGS--DIVII   78 (309)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCEEEHHHHCCCCCCCCCCEEEECCCHHHHCCC--CEEEE
T ss_conf             9899999997699999999983799875999605564342311235545034336887679827988996899--99998


Q ss_pred             CCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC--CCCCCC
Q ss_conf             8634454322332210242012221100011223333--334455
Q gi|254780921|r   57 PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI--PCIYIS   99 (290)
Q Consensus        57 ~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~--~~I~iS   99 (290)
                      +|+.....  ..+...-+..|+.-...+++.+.+.+.  .++-+|
T Consensus        79 tAG~~rk~--g~tR~dLl~~Na~I~~~i~~~i~~~~p~~ivivvt  121 (309)
T cd05294          79 TAGVPRKE--GMSRLDLAKKNAKIVKKYAKQIAEFAPDTKILVVT  121 (309)
T ss_pred             CCCCCCCC--CCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             78988995--99878999989999999998764269984999768


No 296
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional
Probab=96.45  E-value=0.014  Score=33.73  Aligned_cols=58  Identities=14%  Similarity=0.279  Sum_probs=40.1

Q ss_pred             CE-EEEECCCCHHHHHHHHHH---HCCCEEEEECHH-----------HC--------------------C---CCCHHHH
Q ss_conf             94-999978897889999999---649859996136-----------70--------------------8---7899999
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMC---VQDVEIIRVGRP-----------DI--------------------D---LLKPKDF   42 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l---~~~~~v~~~~r~-----------~~--------------------D---~~~~~~~   42 (290)
                      || |.|+|+||-||..-.+.+   .++++|++++-.           ++                    +   +...+++
T Consensus         1 mk~i~IlGsTGSIG~~tL~Vi~~~~~~f~v~~lsa~~n~~~L~~q~~~f~p~~v~i~~~~~~~~~~~~~~~~~~~g~~~l   80 (379)
T PRK05447          1 MKRITILGSTGSIGTQTLDVIRRHPDRFRVVALSAGSNVELLAEQIREFRPKYVVVADEAAAKELKAALAGKVLAGEEGL   80 (379)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHCCCEEEECCHHHHHHHHHHCCCCEEECHHHH
T ss_conf             97899985695888999999995868758999992897999999999949999999288999999875588288688999


Q ss_pred             HHHHHHCCCCEEEECC
Q ss_conf             9999755998999786
Q gi|254780921|r   43 ASFFLSFSPDVIINPA   58 (290)
Q Consensus        43 ~~~l~~~~pd~Vih~A   58 (290)
                      .++++..++|+||+..
T Consensus        81 ~~~~~~~~~D~vi~ai   96 (379)
T PRK05447         81 CELAALPEADVVVAAI   96 (379)
T ss_pred             HHHHHCCCCCEEEEEH
T ss_conf             9997367899999813


No 297
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional
Probab=96.44  E-value=0.0076  Score=35.25  Aligned_cols=51  Identities=12%  Similarity=0.300  Sum_probs=39.7

Q ss_pred             EEEEECCCCHHHHHHHHHH-HCCCEEEEECHHHCCCCCHHHHHHHHHHCCCCEEEECCC
Q ss_conf             4999978897889999999-649859996136708789999999997559989997863
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA   59 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~~D~~~~~~~~~~l~~~~pd~Vih~Aa   59 (290)
                      ||+|.||+|-+|+.+++.| ..||+|..+++.++     ...++++...  |+||-+.-
T Consensus       100 ~i~IIGG~G~mG~~F~~~f~~sGy~V~ild~~dw-----~~~~~~~~~a--dvViVsVP  151 (374)
T PRK11199        100 PVVIVGGKGQLGRLFAKMLTLSGYQVRILEKDDW-----DRADDILADA--GMVIVSVP  151 (374)
T ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCC-----CCHHHHHHCC--CEEEEEEC
T ss_conf             1799807982779999999967987996164445-----3489887179--98999814


No 298
>PRK13301 putative L-aspartate dehydrogenase; Provisional
Probab=96.43  E-value=0.0037  Score=37.03  Aligned_cols=61  Identities=20%  Similarity=0.335  Sum_probs=41.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC----CCEEEEECHHHCCCCC--------HHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             9499997889788999999964----9859996136708789--------9999999975599899978634454
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ----DVEIIRVGRPDIDLLK--------PKDFASFFLSFSPDVIINPAAYTAV   63 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~----~~~v~~~~r~~~D~~~--------~~~~~~~l~~~~pd~Vih~Aa~~~~   63 (290)
                      |||-|.|. |-||+.+++.|..    +.++.++.|...|...        .+.+++++.. +||+||-||+...+
T Consensus         3 ~rVgiiG~-GAIG~~Va~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~lla~-~pDlVvE~As~~Av   75 (267)
T PRK13301          3 HRIAFIGL-GAIASDVAAGLLADAAQPCQLAALTRNAADLPPALAGRVALLDGLPGLLAW-RPDLVVEAAGQQAI   75 (267)
T ss_pred             EEEEEECC-CHHHHHHHHHHHHCCCCCEEEEEEECCHHHHHHHHCCCCCCCCCHHHHHCC-CCCEEEECCCHHHH
T ss_conf             17999851-699999999986177765289998153355555532566545775777412-89999989798999


No 299
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent; InterPro: IPR011274   This entry represents the NAD-dependent cytosolic malate dehydrogenase from eukaryotes. The enzyme from pig has been studied by X-ray crystallography ; GO: 0030060 L-malate dehydrogenase activity, 0006108 malate metabolic process.
Probab=96.40  E-value=0.003  Score=37.54  Aligned_cols=46  Identities=28%  Similarity=0.374  Sum_probs=30.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEECHH-HCCCCCHHHHHHHHHH
Q ss_conf             4999978897889999999649859996136-7087899999999975
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRP-DIDLLKPKDFASFFLS   48 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~~~~v~~~~r~-~~D~~~~~~~~~~l~~   48 (290)
                      ||||||++|.||.+|....++ .+++|-+.+ .+.+.|-....+.|+.
T Consensus         1 rVlvtGAAGQiaY~L~~miA~-G~~lG~dQ~~~LhLLDIp~a~~~L~G   47 (325)
T TIGR01758         1 RVLVTGAAGQIAYALLPMIAR-GEMLGKDQPIILHLLDIPPAVKVLEG   47 (325)
T ss_pred             CEEEEECHHHHHHHHHHHHHC-CEEECCCCCEEECCCCHHHHHHHHHH
T ss_conf             958850437899988667746-74208986001002481688875101


No 300
>TIGR01759 MalateDH-SF1 malate dehydrogenase; InterPro: IPR010945   Malate dehydrogenases catalyse the interconversion of malate and oxaloacetate using dinucleotide cofactors . The enzymes in this entry are found in archaea, bacteria and eukaryotes and fall into two distinct groups. The first group are cytoplamsic, NAD-dependent enzymes which participate in the citric acid cycle (1.1.1.37 from EC). The second group are found in plant chloroplasts, use NADP as cofactor, and participate in the C4 cycle (1.1.1.82 from EC).   Structural studies indicate that these enzymes are homodimers with very sinmilar overall topology, though the chloroplast enzymes also have N- and C-terminal extensions, and all contain the classical Rossman fold for NAD(P)H binding , , , . Substrate specificity is determined by a mobile loop at the active site which uses charge balancing to discriminate between the correct substrates (malate and oxaloacetate) and other potential oxo/hydroxyacid substrates the enzyme may encounter within the cell .; GO: 0016615 malate dehydrogenase activity, 0006108 malate metabolic process.
Probab=96.33  E-value=0.0021  Score=38.37  Aligned_cols=211  Identities=14%  Similarity=0.109  Sum_probs=99.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEECHH-HCCCCC----------------------------HHHHHHHHHHCCCC
Q ss_conf             4999978897889999999649859996136-708789----------------------------99999999755998
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRP-DIDLLK----------------------------PKDFASFFLSFSPD   52 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~~~~v~~~~r~-~~D~~~----------------------------~~~~~~~l~~~~pd   52 (290)
                      ||+||||+|+||.+|.-.++. .+++|.|++ ++.+.|                            -+..++.|++.  |
T Consensus         5 rV~VTGAAGQI~Y~Ll~~iA~-G~~fG~Dqpv~L~LLdIP~A~~~LeGV~MEL~DCAFPlL~~v~~T~~p~eAF~dv--D   81 (329)
T TIGR01759         5 RVAVTGAAGQIGYSLLFRIAS-GELFGKDQPVVLHLLDIPQAMKALEGVVMELEDCAFPLLAGVVATTDPEEAFKDV--D   81 (329)
T ss_pred             EEEEECCHHHHHHHHHHHHHC-CCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCCCCCCCEECCCHHHHHCCC--C
T ss_conf             799737446789999889855-6104889846888607723311334435535306452235112216868751898--7


Q ss_pred             EEEECCCCCCCCCCCCCCCEEEEECCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCC--CCCCCCC
Q ss_conf             9997863445432233221024201222110---0011223333334455321113575544---211112--2221110
Q gi|254780921|r   53 VIINPAAYTAVDKAEDEPEIAFSINAEGAGA---IAKAADSIGIPCIYISTDYVFDGLSRTP---IDEFSP--TNPLNIY  124 (290)
Q Consensus        53 ~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~---l~~~~~~~~~~~I~iSS~~Vy~g~~~~p---~~E~d~--~~P~~~Y  124 (290)
                      +=+-++|..+-+.=  +..--++.|..--..   .+....+..+|++=+      +++-+..   -.+..|  ..|.|+=
T Consensus        82 ~AlLvGa~PRK~GM--ER~DLL~~Ng~IF~~QG~aLn~~Ak~~vKVLVV------GNPaNTNaLIa~~~AP~~ip~~Nf~  153 (329)
T TIGR01759        82 VALLVGAFPRKPGM--ERRDLLSKNGKIFKEQGKALNKVAKKDVKVLVV------GNPANTNALIASKNAPKKIPPKNFS  153 (329)
T ss_pred             EEEEECCCCCCCCC--CHHHHHHHCCHHHHHHHHHHHHHCCCCCEEEEE------CCCCHHHHHHHHHCCCCCCCCCCCC
T ss_conf             57761366895884--479998722254687999999861898569985------2986279999997068656511110


Q ss_pred             HHHHHHHHHHHCCCCCCC--CCCCCCC--CEECCCCCCCCEEECCCC----CCCC-EEECCC-CCCCCCCHHHHHHHHHH
Q ss_conf             124566665310122232--2355542--000368632000201124----6652-153045-54544522368999999
Q gi|254780921|r  125 GKSKLAGEEKVASYTNNY--VILRTAW--VYSIFGSNFLLSMLRLAK----ERRE-ISVVCD-QFGTPTSALQIARAIIQ  194 (290)
Q Consensus       125 g~sK~~~E~~v~~~~~~~--~IlR~~~--vyG~~~~~~v~~~l~~~~----~~~~-i~~~~d-~~~~p~~v~D~a~~i~~  194 (290)
                      +.|.+.==+.+-..+.+.  -+-+..+  |=|-|..+.++.+-++--    .+++ .++..| .|..-..+.-+.+==.+
T Consensus       154 AmtRLDhNRA~~qlA~K~Gv~~~~V~nv~iWGNHS~tQvPD~~~A~v~~~~~~~pV~e~i~d~~Wl~g~F~~~Vq~RG~A  233 (329)
T TIGR01759       154 AMTRLDHNRAKSQLAAKLGVPVSDVKNVIIWGNHSNTQVPDVTHATVDKDGKGKPVKELIKDDDWLEGEFIPTVQQRGAA  233 (329)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCCCCCCCCCCCEEEEECCCCCEECCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             20022478999999987589601132379970278765644531168748993415233465321004320103225899


Q ss_pred             HHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCH
Q ss_conf             99844202443344313762386667889999999999997279800
Q gi|254780921|r  195 IAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS  241 (290)
Q Consensus       195 ~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~  241 (290)
                      +|+..         |     . +...|   =|+.++..+........
T Consensus       234 vI~~R---------G-----~-SSAAS---AA~AA~dh~rdW~~GTp  262 (329)
T TIGR01759       234 VIEAR---------G-----A-SSAAS---AANAAIDHVRDWVLGTP  262 (329)
T ss_pred             HHHHH---------C-----C-CHHHH---HHHHHHHHHHHHCCCCC
T ss_conf             99984---------5-----4-61367---99999999997168989


No 301
>PRK00048 dihydrodipicolinate reductase; Provisional
Probab=96.32  E-value=0.0051  Score=36.21  Aligned_cols=32  Identities=28%  Similarity=0.554  Sum_probs=25.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC--CCEEEE-ECHH
Q ss_conf             9499997889788999999964--985999-6136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ--DVEIIR-VGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~--~~~v~~-~~r~   32 (290)
                      |||.|.|++|-.|+.+++...+  +.++++ +++.
T Consensus         3 ikI~i~Ga~GrMG~~i~~~i~~~~~~~l~~~i~~~   37 (265)
T PRK00048          3 IKVGVAGASGRMGRELIEAVEAAEDLELVAALDRP   37 (265)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECC
T ss_conf             59999888887799999999868997999999468


No 302
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=96.28  E-value=0.018  Score=33.10  Aligned_cols=139  Identities=17%  Similarity=0.161  Sum_probs=76.5

Q ss_pred             EEEEECCCC----------HHHHHHHHHH-HCCCEEEEECHHHC------CC--------CCHHHHHHHHHHCCCCEEEE
Q ss_conf             499997889----------7889999999-64985999613670------87--------89999999997559989997
Q gi|254780921|r    2 KCLVIGNNG----------QIAQSLSSMC-VQDVEIIRVGRPDI------DL--------LKPKDFASFFLSFSPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G----------~iG~~l~~~l-~~~~~v~~~~r~~~------D~--------~~~~~~~~~l~~~~pd~Vih   56 (290)
                      ||||.|+..          |-|++-++.| .+|++|+-++.+-.      ++        ...+.+++++++.+||.|+-
T Consensus         9 kvLiiGsGpi~IGqa~EfDysg~qA~~aLkeeG~~vvlvN~NPaTi~TD~~~ad~vY~ePlt~e~v~~Ii~~E~Pd~il~   88 (1068)
T PRK12815          9 KILVIGSGPIIIGQAAEFDYSGTQACKALKEEGYQVVLVNPNPATIMTDPEPADTVYFEPLTLEFVKRIIRREKPDALLA   88 (1068)
T ss_pred             EEEEECCCCCHHCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHCCCCCCCEEEECCCCHHHHHHHHHHHCCCEEEE
T ss_conf             89998988153123446565699999999986998999889832620898744437885898999999999749998986


Q ss_pred             -CCCCCCCCCCCCCCCEEEEECCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCHHHHH
Q ss_conf             -8634454322332210242012221100011--2233333344553211135755442----11112222111012456
Q gi|254780921|r   57 -PAAYTAVDKAEDEPEIAFSINAEGAGAIAKA--ADSIGIPCIYISTDYVFDGLSRTPI----DEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        57 -~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~--~~~~~~~~I~iSS~~Vy~g~~~~p~----~E~d~~~P~~~Yg~sK~  129 (290)
                       +.+.+....+               ..|.+.  ..+.|++++=.|.+.+--++...-+    .|-..+-|.+....+--
T Consensus        89 ~~GGqtaLnla---------------~~L~~~GiL~k~~v~llGt~~~~I~~aedR~~f~~~m~~ig~~~~~s~~~~s~~  153 (1068)
T PRK12815         89 TLGGQTALNLA---------------VKLLEAGILEQYGVELLGTNVEAIQKGEDRERFRALMKELGEPVPESEIVDSEE  153 (1068)
T ss_pred             CCCCHHHHHHH---------------HHHHHCCCHHHCCCEEECCCHHHHHHHHCHHHHHHHHHHCCCCCCCCHHCCCHH
T ss_conf             77784799999---------------999975977865964967999999864599999999997699999705219999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCEECCCC
Q ss_conf             666531012223223555420003686
Q gi|254780921|r  130 AGEEKVASYTNNYVILRTAWVYSIFGS  156 (290)
Q Consensus       130 ~~E~~v~~~~~~~~IlR~~~vyG~~~~  156 (290)
                      ++..++.+.+ --+|+|++.++|..+.
T Consensus       154 ea~~~a~~ig-~PvivRps~~lGg~g~  179 (1068)
T PRK12815        154 EALRFAEKIG-FPIIVRPAYTLGGDGG  179 (1068)
T ss_pred             HHHHHHHHCC-CCEEEEECCCCCCCCC
T ss_conf             9999998669-9899983610668965


No 303
>PRK08507 prephenate dehydrogenase; Validated
Probab=96.28  E-value=0.023  Score=32.58  Aligned_cols=32  Identities=22%  Similarity=0.224  Sum_probs=27.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-C--CEEEEECHHH
Q ss_conf             9499997889788999999964-9--8599961367
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-D--VEIIRVGRPD   33 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~--~~v~~~~r~~   33 (290)
                      |||.|.|. |+||+.|++.|++ +  .+|++.++++
T Consensus         1 M~I~IiGl-GLiGgSla~alk~~~~~~~V~g~d~~~   35 (275)
T PRK08507          1 MKIGIIGL-GLMGGSLGLALKENKLISCVYGYDHNE   35 (275)
T ss_pred             CEEEEEEC-CHHHHHHHHHHHHCCCCCEEEEEECCH
T ss_conf             98999900-878999999999509986799995999


No 304
>PRK08057 cobalt-precorrin-6x reductase; Reviewed
Probab=96.24  E-value=0.012  Score=34.22  Aligned_cols=82  Identities=16%  Similarity=0.351  Sum_probs=55.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEEC---HH-H--------CCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCC
Q ss_conf             49999788978899999996498599961---36-7--------087899999999975599899978634454322332
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQDVEIIRVG---RP-D--------IDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDE   69 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~~~~v~~~~---r~-~--------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~~e~~   69 (290)
                      ||||.|||+- |+.|++.|....-++.+.   .. .        .-+.+.+++.+++++.+++.||.+.          +
T Consensus         3 ~IlilgGT~E-gr~la~~L~~~~~~~s~ag~~~~~~~~~~~i~~G~~~~~~~l~~~l~~~~i~~VIDAT----------H   71 (241)
T PRK08057          3 RILLLGGTSE-ARALARALAPDDTVTSLAGRTLKPADLPGPVRVGGFGGAEGLAAYLREEGIDLVVDAT----------H   71 (241)
T ss_pred             EEEEEECHHH-HHHHHHHHHCCCEEEEEEEECCCCCCCCCCEEECCCCCHHHHHHHHHHCCCCEEEECC----------C
T ss_conf             5999967089-9999999748998999853025565688767988889999999999967998999899----------9


Q ss_pred             CCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             210242012221100011223333334455
Q gi|254780921|r   70 PEIAFSINAEGAGAIAKAADSIGIPCIYIS   99 (290)
Q Consensus        70 ~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iS   99 (290)
                      |   |+.  ..+.+..++|+..|++++-+-
T Consensus        72 P---fA~--~is~~a~~a~~~~~ipylR~e   96 (241)
T PRK08057         72 P---YAA--QISANAAAACRALGIPYLRLE   96 (241)
T ss_pred             C---CHH--HHHHHHHHHHHHHCCEEEEEE
T ss_conf             7---089--999999999998697079996


No 305
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism]
Probab=96.18  E-value=0.0092  Score=34.78  Aligned_cols=115  Identities=17%  Similarity=0.169  Sum_probs=61.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC--CCEEEEECHHH-CC---------CC-----CHH--HHHHHHHHCCCCEEEECCCCC
Q ss_conf             9499997889788999999964--98599961367-08---------78-----999--999999755998999786344
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPD-ID---------LL-----KPK--DFASFFLSFSPDVIINPAAYT   61 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~--~~~v~~~~r~~-~D---------~~-----~~~--~~~~~l~~~~pd~Vih~Aa~~   61 (290)
                      |||.|.|++||-|.+|.++|..  ..++...+.++ .+         ++     ...  ..+++ .....|+||-|--  
T Consensus         3 ~kV~IvGasGYtG~EL~rlL~~Hp~ve~~~~ss~~~~g~~~~~~~p~l~g~~~l~~~~~~~~~~-~~~~~DvvFlalP--   79 (349)
T COG0002           3 IKVGIVGASGYTGLELLRLLAGHPDVELILISSRERAGKPVSDVHPNLRGLVDLPFQTIDPEKI-ELDECDVVFLALP--   79 (349)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEEEEECHHHCCCCHHHHCCCCCCCCCCCCCCCCHHHH-HCCCCCEEEEECC--
T ss_conf             1599977887748999999865997379996316645870687582423534554335774553-0156888999068--


Q ss_pred             CCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCC---CCCCCCHHHHHHHHHH
Q ss_conf             54322332210242012221100011223333334455321113575--5442111122---2211101245666653
Q gi|254780921|r   62 AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLS--RTPIDEFSPT---NPLNIYGKSKLAGEEK  134 (290)
Q Consensus        62 ~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~~--~~p~~E~d~~---~P~~~Yg~sK~~~E~~  134 (290)
                        +..              ...++......|+++|=.|+|+-+....  +.+|.+..+.   .....||..-+-.|++
T Consensus        80 --hg~--------------s~~~v~~l~~~g~~VIDLSadfR~~d~~~ye~~Yg~~h~~~~~l~~avYGLpEl~~e~i  141 (349)
T COG0002          80 --HGV--------------SAELVPELLEAGCKVIDLSADFRLKDPEVYEKWYGFTHAGPELLEDAVYGLPELHREKI  141 (349)
T ss_pred             --CHH--------------HHHHHHHHHHCCCEEEECCCCCCCCCHHHHHHHHCCCCCCCHHHHCCCCCCCCCCHHHH
T ss_conf             --636--------------88989999747994998873200577777788627777780133154334731298888


No 306
>PRK13302 putative L-aspartate dehydrogenase; Provisional
Probab=96.12  E-value=0.022  Score=32.68  Aligned_cols=59  Identities=15%  Similarity=0.298  Sum_probs=37.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC---CCEEEEEC-HHH---CC----CC---CHHHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             9499997889788999999964---98599961-367---08----78---9999999997559989997863445
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ---DVEIIRVG-RPD---ID----LL---KPKDFASFFLSFSPDVIINPAAYTA   62 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~---~~~v~~~~-r~~---~D----~~---~~~~~~~~l~~~~pd~Vih~Aa~~~   62 (290)
                      |||-|.|. |.||+.+++.|.+   +.++.++. |..   .+    +.   ....+++ +. .+||+||-||+...
T Consensus         7 mrVgliG~-GaIG~~va~~l~~g~~~~~l~~V~~r~~~~~~~~~~~~~~~~~~~~~~~-l~-~~~DlVVE~A~~~a   79 (271)
T PRK13302          7 LRVAIAGL-GAIGKAIAQALDRGLPGLTLSAVAVRDPQRHADFIWGLRRPPPVVPLDQ-LA-THADIVVEAAPASV   79 (271)
T ss_pred             CEEEEECC-CHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHCCCCCCCCCHHH-HH-HCCCEEEECCCHHH
T ss_conf             77999886-7899999999975899818999992887888999873589874078899-60-18999998989899


No 307
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]
Probab=96.11  E-value=0.028  Score=32.02  Aligned_cols=31  Identities=23%  Similarity=0.518  Sum_probs=27.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHH-CCCEEEEECHH
Q ss_conf             949999788978899999996-49859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~   32 (290)
                      |+++|.|+ |-+|+.+++.|. +|++|+..+++
T Consensus         1 m~iiIiG~-G~vG~~va~~L~~~g~~Vv~Id~d   32 (225)
T COG0569           1 MKIIIIGA-GRVGRSVARELSEEGHNVVLIDRD   32 (225)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             98999898-578899999998789908999768


No 308
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents glutamine-dependent CPSase (6.3.5.5 from EC) from prokaryotes and eukaryotes (CPSase II). ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=96.10  E-value=0.0073  Score=35.33  Aligned_cols=133  Identities=20%  Similarity=0.219  Sum_probs=81.4

Q ss_pred             EEEEECCCCH-HHH---------HHHHHH-HCCCEEEEECHH------HCCCCC--------HHHHHHHHHHCCCCEE-E
Q ss_conf             4999978897-889---------999999-649859996136------708789--------9999999975599899-9
Q gi|254780921|r    2 KCLVIGNNGQ-IAQ---------SLSSMC-VQDVEIIRVGRP------DIDLLK--------PKDFASFFLSFSPDVI-I   55 (290)
Q Consensus         2 kiLVtG~~G~-iG~---------~l~~~l-~~~~~v~~~~r~------~~D~~~--------~~~~~~~l~~~~pd~V-i   55 (290)
                      ||||+|+..+ ||+         |.+..| ..|++.+-+..|      +.|++|        .+.+-++++..||+.| |
T Consensus       575 ~~lvlGSGp~RIGqgvEFDYc~Vh~~~aLr~~Gye~ImiN~NPETVSTDyD~sDrLYFEplt~E~Vm~I~e~E~~~GVIV  654 (1089)
T TIGR01369       575 KVLVLGSGPNRIGQGVEFDYCCVHAVLALREAGYETIMINYNPETVSTDYDTSDRLYFEPLTFEDVMNIIELEKPEGVIV  654 (1089)
T ss_pred             EEEEECCCCEECCCCEEEHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHCCCCCCCCCCCEEHEEECCCCEEEE
T ss_conf             68998784514066312056789999999872995999977899743666651011587635031001100058667999


Q ss_pred             ECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCCHHHHH
Q ss_conf             7863445432233221024201222110001122333-3334455321113575544-----211112222111012456
Q gi|254780921|r   56 NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIG-IPCIYISTDYVFDGLSRTP-----IDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        56 h~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~-~~~I~iSS~~Vy~g~~~~p-----~~E~d~~~P~~~Yg~sK~  129 (290)
                      ++.|.+                   +.||++...+.| ++++=.|.+.+ |-..++.     ..+=.-+-|.+.-+.|+=
T Consensus       655 q~GGQt-------------------p~nlA~~L~~~GG~~iLGTS~~~I-D~AEDR~kFs~~l~~Lgi~QP~~~~a~s~e  714 (1089)
T TIGR01369       655 QFGGQT-------------------PLNLAKELEEAGGVPILGTSPESI-DRAEDREKFSELLDELGIPQPEWKIATSVE  714 (1089)
T ss_pred             ECCCHH-------------------HHHHHHHHHHCCCCEEECCCHHHH-HHHCCHHHHHHHHHHCCCCCCCCCEECCHH
T ss_conf             748732-------------------678999999708931736885787-513186799999971587989885272879


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCEECCC
Q ss_conf             66653101222322355542000368
Q gi|254780921|r  130 AGEEKVASYTNNYVILRTAWVYSIFG  155 (290)
Q Consensus       130 ~~E~~v~~~~~~~~IlR~~~vyG~~~  155 (290)
                      ++-+++.+-+-+ +++|||.|.|...
T Consensus       715 ea~~~A~~iGYP-vlvRPSYVLgG~a  739 (1089)
T TIGR01369       715 EAKEFASEIGYP-VLVRPSYVLGGRA  739 (1089)
T ss_pred             HHHHHHHHCCCC-EEECCCCCCCCCC
T ss_conf             999998546992-8981683003362


No 309
>PRK09620 hypothetical protein; Provisional
Probab=96.07  E-value=0.037  Score=31.39  Aligned_cols=63  Identities=17%  Similarity=0.196  Sum_probs=42.1

Q ss_pred             CEEEEECC----------------CCHHHHHHHHHH-HCCCEEEEECHH----------HCCC---CCH----HHHHHHH
Q ss_conf             94999978----------------897889999999-649859996136----------7087---899----9999999
Q gi|254780921|r    1 MKCLVIGN----------------NGQIAQSLSSMC-VQDVEIIRVGRP----------DIDL---LKP----KDFASFF   46 (290)
Q Consensus         1 MkiLVtG~----------------~G~iG~~l~~~l-~~~~~v~~~~r~----------~~D~---~~~----~~~~~~l   46 (290)
                      .|||||+|                ||-.|.+|++.+ ..|.+|+.+.-.          .+.+   ...    +.+...+
T Consensus         4 kkVLITaG~T~E~IDpVR~ItN~SSGkmG~aiA~~a~~~GA~Vtli~g~~~~~p~~~~~~~~~~~~~~~~~l~~~~~~~~   83 (229)
T PRK09620          4 KKVLITSGGCLEKWDQVRGHTNMAKGTIGRIIAEELISKGAHVIYLHGYFAEKPNDINNQLELHPFEGIIDLQDKMKSII   83 (229)
T ss_pred             CEEEEECCCCCCCCCCCCEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCEEEEEEEHHHHHHHHHHHH
T ss_conf             89999588875666884562776823999999999997799799994588778987788835898500999999999984


Q ss_pred             HHCCCCEEEECCCCCCC
Q ss_conf             75599899978634454
Q gi|254780921|r   47 LSFSPDVIINPAAYTAV   63 (290)
Q Consensus        47 ~~~~pd~Vih~Aa~~~~   63 (290)
                      ...++|++||+||.++.
T Consensus        84 ~~~~~D~~I~aAAVsDf  100 (229)
T PRK09620         84 THEKVDAVIMAAAGSDW  100 (229)
T ss_pred             CCCCCCEEEECCCHHCC
T ss_conf             56788999995450201


No 310
>PRK07417 arogenate dehydrogenase; Reviewed
Probab=96.05  E-value=0.025  Score=32.32  Aligned_cols=55  Identities=24%  Similarity=0.294  Sum_probs=36.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-CCEEEEECHHHC--------CCCCH--HHHHHHHHHCCCCEEEECCC
Q ss_conf             9499997889788999999964-985999613670--------87899--99999997559989997863
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDI--------DLLKP--KDFASFFLSFSPDVIINPAA   59 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~~~--------D~~~~--~~~~~~l~~~~pd~Vih~Aa   59 (290)
                      |||+|.|- |+||+.|+..|++ +++|++.++++-        .+-|.  ..+ +.++  +.|+||-|.-
T Consensus         2 mkI~IiGl-GLIGgSla~al~~~~~~V~g~d~~~~~~~~A~~~g~id~~~~~~-~~~~--~aDliila~P   67 (280)
T PRK07417          2 MNIGIVGL-GLIGGSLGLDLRSLGHTVYGVSRRESTCERAIERGLVDEASTDL-SLLK--DCDLVILALP   67 (280)
T ss_pred             CEEEEEEC-CHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCEECCCH-HHHC--CCCEEEECCC
T ss_conf             78999931-85799999999968997999979999999999869975202787-4605--7998998797


No 311
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed
Probab=95.99  E-value=0.031  Score=31.80  Aligned_cols=52  Identities=19%  Similarity=0.228  Sum_probs=42.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-CCEEEEECHHH-------------CCCCCHHHHHHHHHHCCCCEEE
Q ss_conf             9499997889788999999964-98599961367-------------0878999999999755998999
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPD-------------IDLLKPKDFASFFLSFSPDVII   55 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~~-------------~D~~~~~~~~~~l~~~~pd~Vi   55 (290)
                      |+|.|.|| |.+|+.++....+ |+++..++.++             .|+.|.+.+.++.+.+  |+|.
T Consensus         8 ~tIGIlGg-GQLgrMla~aA~~lG~~v~vldp~~~~PA~~va~~~~~~~~~D~~al~~fa~~~--DviT   73 (377)
T PRK06019          8 KTIGIIGG-GQLGRMLALAAAPLGYKVIVLDPDADCPAAQVADRVIVADYDDVAALRELAEQC--DVIT   73 (377)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHCCEEEECCCCCHHHHHHHHHCC--CEEE
T ss_conf             99999878-689999999999789989998489849847837848986889899999998459--9999


No 312
>PTZ00117 malate dehydrogenase; Provisional
Probab=95.97  E-value=0.1  Score=28.87  Aligned_cols=222  Identities=15%  Similarity=0.056  Sum_probs=99.8

Q ss_pred             CE-EEEECCCCHHHHHHHHHHHC--CCEEEEECHHH-------CCCCCHHHHH------------HHHHHCCCCEEEECC
Q ss_conf             94-99997889788999999964--98599961367-------0878999999------------999755998999786
Q gi|254780921|r    1 MK-CLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPD-------IDLLKPKDFA------------SFFLSFSPDVIINPA   58 (290)
Q Consensus         1 Mk-iLVtG~~G~iG~~l~~~l~~--~~~v~~~~r~~-------~D~~~~~~~~------------~~l~~~~pd~Vih~A   58 (290)
                      || |-|.| +|.+|+.++-.+..  -.+++-+|+++       +|+.+...+.            +-+++  .|+||-+|
T Consensus         1 M~KV~IIG-aG~VG~~~A~~l~~~~~~eivLiDi~~~~a~g~a~Dl~h~~~~~~~~~~i~~~~dy~~~~d--aDiVVitA   77 (313)
T PTZ00117          1 MKKISIIG-SGQIGAIVGLLLLQENLGDVYLYDVIEGVPQGKALDLKHFSTIIGVNANILGTNNYEDIKD--SDVIVITA   77 (313)
T ss_pred             CCEEEEEC-CCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEECCCHHHHCC--CCEEEECC
T ss_conf             97899989-7989999999997089987999958898308899887724203689857983799999689--99999898


Q ss_pred             CCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC--CCCCCC-----CCCCCCCCCCCCCCCCCCC---CCCCCHHHH
Q ss_conf             344543223322102420122211000112233333--344553-----2111357554421111222---211101245
Q gi|254780921|r   59 AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIP--CIYIST-----DYVFDGLSRTPIDEFSPTN---PLNIYGKSK  128 (290)
Q Consensus        59 a~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~--~I~iSS-----~~Vy~g~~~~p~~E~d~~~---P~~~Yg~sK  128 (290)
                      +.....  ......-+..|..-...+.+...+.+..  ++-+|-     .+++-.....|  -+--..   -++ =+|.+
T Consensus        78 G~~rk~--g~tR~dLl~~N~~I~~~i~~~i~~~~p~aiiivvtNPvDimt~v~~k~sg~p--~~rViG~gt~LD-saR~r  152 (313)
T PTZ00117         78 GVQRKE--GMTREDLIGVNGKIMKSVAESVKKHCPNAFVICVSNPLDIMVNVFKKKSGLP--HEKICGMAGILD-TSRFR  152 (313)
T ss_pred             CCCCCC--CCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHCCC--HHHEEECCCEEE-HHHHH
T ss_conf             998997--9988999987677788888776235898089978994899999999862898--677670044020-88999


Q ss_pred             H-HHHHHHCCCCCCCCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             6-666531012223223555420003686320002011246652153045545445223689999999984420244334
Q gi|254780921|r  129 L-AGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSL  207 (290)
Q Consensus       129 ~-~~E~~v~~~~~~~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~  207 (290)
                      . .+|.+ . ...+-  + -++|.|.||.+.+..+-...-.+.++.=+.++  ....-.++.+    +.++....    .
T Consensus       153 ~~la~~l-~-v~~~~--V-~~~ViGeHGds~vp~wS~~~v~G~pl~~~~~~--~~~~~~~~~e----i~~~~~~~----g  217 (313)
T PTZ00117        153 CLLARKL-K-VKPSD--V-SAVVLGGHGDLMVPLTRYVSIGGIPLSEFVKK--NKISHSEINE----IIKKTRFM----G  217 (313)
T ss_pred             HHHHHHH-C-CCCCC--E-EEEEEECCCCCEEEEEEECCCCCCCHHHHHHC--CCCCHHHHHH----HHHHHHHC----C
T ss_conf             9999996-8-99221--3-77786056894786452026589618998542--6878899999----99998516----6


Q ss_pred             CCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCH
Q ss_conf             43137623866678899999999999972798000576285
Q gi|254780921|r  208 RGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFT  248 (290)
Q Consensus       208 ~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~  248 (290)
                      +-|++...  +. |.|..|..+...+........++.|+..
T Consensus       218 ~~ii~~~K--g~-t~~gia~a~~~iv~aIl~d~~~vlpvs~  255 (313)
T PTZ00117        218 GEIIKLAK--TS-AAFAPAAAIVKMIKSYLKNEKSLLTCAV  255 (313)
T ss_pred             CEEEEECC--CC-CCCHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             23888227--74-2404899999999999769995899898


No 313
>pfam01470 Peptidase_C15 Pyroglutamyl peptidase.
Probab=95.89  E-value=0.013  Score=33.87  Aligned_cols=57  Identities=18%  Similarity=0.153  Sum_probs=36.8

Q ss_pred             CEEEEECCCCHHH------HHHHHHHH----CCCEEEEECHHHCCCC-CHHHHHHHHHHCCCCEEEECC
Q ss_conf             9499997889788------99999996----4985999613670878-999999999755998999786
Q gi|254780921|r    1 MKCLVIGNNGQIA------QSLSSMCV----QDVEIIRVGRPDIDLL-KPKDFASFFLSFSPDVIINPA   58 (290)
Q Consensus         1 MkiLVtG~~G~iG------~~l~~~l~----~~~~v~~~~r~~~D~~-~~~~~~~~l~~~~pd~Vih~A   58 (290)
                      |||||||=.-|=|      ..+++.|.    .++++...--+ .++. -.+.+.+.+++.+||+|||+.
T Consensus         1 mrVLvTGF~PF~~~~~NpS~~iv~~L~~~~~~~~~v~~~~LP-V~~~~~~~~l~~~l~~~~Pd~vihlG   68 (203)
T pfam01470         1 MKVLVTGFEPFGGDPINPAWEAAKQLDGRTIGGATIVGRILP-TSFKKAAEVLQQAIAEIKPDIVIALG   68 (203)
T ss_pred             CEEEEEEECCCCCCCCCHHHHHHHHCCCCCCCCCEEEEEEEC-CCHHHHHHHHHHHHHHHCCCEEEECC
T ss_conf             979998137889799787899998644567899679999916-50888999999999961998899824


No 314
>PRK13304 L-aspartate dehydrogenase; Reviewed
Probab=95.86  E-value=0.012  Score=34.20  Aligned_cols=59  Identities=17%  Similarity=0.187  Sum_probs=38.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCC---CEEEEEC-HHH---------CCCCCHHHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             94999978897889999999649---8599961-367---------08789999999997559989997863445
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQD---VEIIRVG-RPD---------IDLLKPKDFASFFLSFSPDVIINPAAYTA   62 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~---~~v~~~~-r~~---------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~   62 (290)
                      |||-|.|. |.||+.+++.+.++   .+++++. |+.         .+..-...++++++  +||+||-||+...
T Consensus         2 ~rVgiIG~-GaIG~~Va~~l~~g~~~~~L~~V~~r~~~~a~~~a~~~~~~~~~~ld~l~~--~~DlVVE~A~~~a   73 (265)
T PRK13304          2 LKIGIVGC-GAIANLITKAIDSGRINAELLAFYDRNLEKAENLAEKTGAPACLSIDELVK--DVDLVVECASQKA   73 (265)
T ss_pred             CEEEEECC-CHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHCCCCCCCCCHHHHHH--CCCEEEECCCHHH
T ss_conf             49999865-789999999986799864999997898789887764159971279899833--8999998989899


No 315
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative; InterPro: IPR011285   This entry represents a small, very well conserved family of proteins closely related to the FabG family, IPR011284 from INTERPRO, and possibly equal in function. In all completed genomes with a member of this family, a FabG in IPR011284 from INTERPRO is also found..
Probab=95.85  E-value=0.017  Score=33.31  Aligned_cols=125  Identities=13%  Similarity=0.099  Sum_probs=83.1

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHH----------------------HCCCCCHHHHHHHHHHC-----CCCEE
Q ss_conf             999978897889999999-649859996136----------------------70878999999999755-----99899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP----------------------DIDLLKPKDFASFFLSF-----SPDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~----------------------~~D~~~~~~~~~~l~~~-----~pd~V   54 (290)
                      +||||++--||++++..| ..|+++..-.+.                      ++|+.|+..+.++++..     -.--|
T Consensus         1 vlvtG~s~GiG~aia~~la~~G~~~~~h~~~~~~~a~~~~~~~~a~G~~~~~~~fdv~~r~~~r~~le~~~~~~GayyG~   80 (239)
T TIGR01831         1 VLVTGASRGIGRAIALKLAADGFEIAVHYHSDRADAEESVAAIRAQGGNARLLKFDVADRVAVREVLEADIAEHGAYYGV   80 (239)
T ss_pred             CEECCCCCHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             95225652267999998862763388875133014789999987458723665300353899999999889854864653


Q ss_pred             EECCCCCC----CCCCCCCCCEEEEECCCCCCCCCCCCC------CCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             97863445----432233221024201222110001122------33333344553-21113575544211112222111
Q gi|254780921|r   55 INPAAYTA----VDKAEDEPEIAFSINAEGAGAIAKAAD------SIGIPCIYIST-DYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        55 ih~Aa~~~----~~~~e~~~~~~~~~Nv~~~~~l~~~~~------~~~~~~I~iSS-~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      +.+|+++.    |..+|.+.+....+|..+..|+.+-|.      ..|-|+|-++| +.|.+...+..|+-.    --..
T Consensus        81 v~~aG~~rd~afPal~~~~Wd~v~~t~ld~fynv~~P~~mPm~~~r~GGri~t~~svsG~~GnrGqvnysa~----kaG~  156 (239)
T TIGR01831        81 VLNAGIARDAAFPALSEEDWDAVIHTNLDGFYNVIHPLVMPMIRARQGGRIITLASVSGVMGNRGQVNYSAA----KAGL  156 (239)
T ss_pred             EECCCCCHHCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCHHHH----HCCH
T ss_conf             000221100014433412334654504311455653456544530478707987311211357753001211----0221


Q ss_pred             CHHHHHHH
Q ss_conf             01245666
Q gi|254780921|r  124 YGKSKLAG  131 (290)
Q Consensus       124 Yg~sK~~~  131 (290)
                      -|.+|..+
T Consensus       157 iGatkal~  164 (239)
T TIGR01831       157 IGATKALA  164 (239)
T ss_pred             HHHHHHHH
T ss_conf             23457877


No 316
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed
Probab=95.78  E-value=0.004  Score=36.79  Aligned_cols=22  Identities=18%  Similarity=0.465  Sum_probs=20.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC
Q ss_conf             9499997889788999999964
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ   22 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~   22 (290)
                      |||-|.|+||++|+.+.++|.+
T Consensus         5 ~~VaIvGATG~VG~~li~lL~~   26 (336)
T PRK05671          5 LDIAVVGATGSVGEALVQVLEE   26 (336)
T ss_pred             CEEEEECCCCHHHHHHHHHHHH
T ss_conf             8799999864999999999863


No 317
>pfam01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain. This Pfam entry contains the following members: N-acetyl-glutamine semialdehyde dehydrogenase (AgrC) Aspartate-semialdehyde dehydrogenase
Probab=95.77  E-value=0.0089  Score=34.85  Aligned_cols=82  Identities=17%  Similarity=0.253  Sum_probs=46.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHC--CCEEEEE-CHHH---C-------------C--CCCHHHHHHHHHHCCCCEEEECCCC
Q ss_conf             499997889788999999964--9859996-1367---0-------------8--7899999999975599899978634
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ--DVEIIRV-GRPD---I-------------D--LLKPKDFASFFLSFSPDVIINPAAY   60 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~--~~~v~~~-~r~~---~-------------D--~~~~~~~~~~l~~~~pd~Vih~Aa~   60 (290)
                      ||-|.|+|||+|++|.++|.+  ..++..+ ++.+   .             |  +.+.+  .+.++  +.|+||-|...
T Consensus         1 kvaIiGatGyvG~eLirlL~~hp~~~i~~l~~s~~saG~~~~~~~~~~~~~~~~~~~~~~--~~~~~--~~Dvvf~alp~   76 (121)
T pfam01118         1 KVAIVGATGYVGQELLRLLAEHPPLELVALVASSRSAGKKVAFAGPWLTGGVDLLLEDVD--PEDLK--DVDIVFFALPA   76 (121)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCHHHHCCCCCCCCCCEEEECC--HHHHC--CCCEEEECCCH
T ss_conf             999989361999999999971887551378850565896014416542466664477589--77853--89899983876


Q ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             454322332210242012221100011223333334455321113
Q gi|254780921|r   61 TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFD  105 (290)
Q Consensus        61 ~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~  105 (290)
                      .                  ....+.....+.|+++|=.|++.-++
T Consensus        77 ~------------------~s~~~~~~~~~~g~~VIDlS~dfRl~  103 (121)
T pfam01118        77 G------------------VSKELAPKLLEAGAVVIDLSSAFRMD  103 (121)
T ss_pred             H------------------HHHHHHHHHHHCCCEEEECCHHHCCC
T ss_conf             8------------------99999999871598998785675178


No 318
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=95.74  E-value=0.046  Score=30.86  Aligned_cols=140  Identities=16%  Similarity=0.175  Sum_probs=71.6

Q ss_pred             EEEEECCCC----------HHHHHHHHHH-HCCCEEEEECHHH------CCC--------CCHHHHHHHHHHCCCCEEEE
Q ss_conf             499997889----------7889999999-6498599961367------087--------89999999997559989997
Q gi|254780921|r    2 KCLVIGNNG----------QIAQSLSSMC-VQDVEIIRVGRPD------IDL--------LKPKDFASFFLSFSPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G----------~iG~~l~~~l-~~~~~v~~~~r~~------~D~--------~~~~~~~~~l~~~~pd~Vih   56 (290)
                      ||||.|+..          |-|++-++.| .+|++++-++.+-      .|+        ...+.+++++++.+||.|+-
T Consensus         9 kvLviGsGp~~IGqa~EfDysg~qa~~al~e~g~~vilvN~NpaTv~Td~~~ad~vY~ePlt~e~v~~Ii~~E~Pd~il~   88 (1063)
T PRK05294          9 KILIIGSGPIVIGQACEFDYSGTQACKALREEGYRVVLVNSNPATIMTDPEMADATYIEPITPEFVEKIIEKERPDAILP   88 (1063)
T ss_pred             EEEEECCCCCHHCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHCCCCCCCCEEEECCCCHHHHHHHHHHHCCCEEEE
T ss_conf             89998988251037233265699999999986998999879854410787766437872798999999999759997886


Q ss_pred             -CCCCCCCCCCCCCCCEEEEECCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCHHHHH
Q ss_conf             -863445432233221024201222110001--1223333334455321113575544----211112222111012456
Q gi|254780921|r   57 -PAAYTAVDKAEDEPEIAFSINAEGAGAIAK--AADSIGIPCIYISTDYVFDGLSRTP----IDEFSPTNPLNIYGKSKL  129 (290)
Q Consensus        57 -~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~--~~~~~~~~~I~iSS~~Vy~g~~~~p----~~E~d~~~P~~~Yg~sK~  129 (290)
                       +.+.|....+               ..|.+  ...+.|++++=.|...+-..+...-    -.|-..+-|.+....+--
T Consensus        89 ~~GGQtaLnla---------------~~L~~~GiL~~~~v~lLGt~~~~I~~aedR~~F~~~l~~i~~p~~~s~~~~s~~  153 (1063)
T PRK05294         89 TMGGQTALNLA---------------LELAESGVLEKYGVELIGAKLEAIDKAEDRELFKEAMKKIGLPVPRSGIAHTME  153 (1063)
T ss_pred             CCCCHHHHHHH---------------HHHHHCCCHHHCCCEEECCCHHHHHHHHCHHHHHHHHHHCCCCCCCCHHCCCHH
T ss_conf             67780599999---------------999975967764972756999999977789999999997699999725309999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCEECCCCC
Q ss_conf             6665310122232235554200036863
Q gi|254780921|r  130 AGEEKVASYTNNYVILRTAWVYSIFGSN  157 (290)
Q Consensus       130 ~~E~~v~~~~~~~~IlR~~~vyG~~~~~  157 (290)
                      ++-.++.+.+ --+|+|++.+.|..+..
T Consensus       154 ea~~~a~~ig-yPvivRps~~LGG~g~~  180 (1063)
T PRK05294        154 EALEVAEEIG-YPVIIRPSFTLGGTGGG  180 (1063)
T ss_pred             HHHHHHHHCC-CCEEEEECCCCCCCCCE
T ss_conf             9999998659-98899844216787640


No 319
>smart00829 PKS_ER Enoylreductase. Enoylreductase in Polyketide synthases.
Probab=95.73  E-value=0.043  Score=31.03  Aligned_cols=32  Identities=13%  Similarity=0.215  Sum_probs=24.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHH-CCCEEEEECHH
Q ss_conf             949999788978899999996-49859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~   32 (290)
                      .+|||+||+|-+|...+.+++ .|.+|+++.++
T Consensus       106 ~~VlI~gg~G~vG~~aiqlak~~Ga~Vi~t~~s  138 (288)
T smart00829      106 ESVLIHAAAGGVGQAAIQLAQHLGAEVFATAGS  138 (288)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             999997898677799999999739830034088


No 320
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed of some bacterial LDHs from firmicutes, gammaproteobacteria, and actinobacteria. Vertebrate LDHs are non-allosteric, but some bacterial LDHs are activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenase, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=95.68  E-value=0.037  Score=31.36  Aligned_cols=95  Identities=18%  Similarity=0.206  Sum_probs=56.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-C--CEEEEECHHH-------CCCCCHHHH------------HHHHHHCCCCEEEECCC
Q ss_conf             499997889788999999964-9--8599961367-------087899999------------99997559989997863
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-D--VEIIRVGRPD-------IDLLKPKDF------------ASFFLSFSPDVIINPAA   59 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~--~~v~~~~r~~-------~D~~~~~~~------------~~~l~~~~pd~Vih~Aa   59 (290)
                      ||-|.|+ |++|+.++..|.. +  .+++-+|.++       +|+.+...+            .+-++.  -|+||-+|+
T Consensus         1 KI~IIGa-G~VG~~~A~~l~~~~~~~elvL~Di~~~~a~g~a~Dl~h~~~~~~~~~~~~~~~~y~~~~~--aDiVVitaG   77 (307)
T cd05290           1 KLVVIGA-GHVGSAVLNYALALGLFSEIVLIDVNEGVAEGEALDFHHATALTYSTNTKIRAGDYDDCAD--ADIIVITAG   77 (307)
T ss_pred             CEEEECC-CHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCCEEECCCCHHHHCC--CCEEEECCC
T ss_conf             9899996-9899999999985699887999928898237999987612035899865866799899469--999998677


Q ss_pred             CCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC--CCCCCC
Q ss_conf             4454322332210242012221100011223333--334455
Q gi|254780921|r   60 YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI--PCIYIS   99 (290)
Q Consensus        60 ~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~--~~I~iS   99 (290)
                      ......-..+...-++.|+.-.+.+.+...+.+.  .+|-+|
T Consensus        78 ~~~kpg~t~~R~dL~~~N~~I~~~i~~~i~~~~p~~i~ivvs  119 (307)
T cd05290          78 PSIDPGNTDDRLDLAQTNAKIIREIMGNITKVTKEAVIILIT  119 (307)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             765899983588888857899999999986139974999847


No 321
>KOG1204 consensus
Probab=95.65  E-value=0.0025  Score=37.91  Aligned_cols=126  Identities=18%  Similarity=0.136  Sum_probs=74.2

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEEC--H------------------HHCCCCCHHHHHHHHHHC-----CCCEEEE
Q ss_conf             999978897889999999-6498599961--3------------------670878999999999755-----9989997
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVG--R------------------PDIDLLKPKDFASFFLSF-----SPDVIIN   56 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~--r------------------~~~D~~~~~~~~~~l~~~-----~pd~Vih   56 (290)
                      ||+||++--||..++..+ .++.+.+.+.  |                  ...|++....+++.++..     +-+.|||
T Consensus         9 illTGaSrgiG~~~v~~i~aed~e~~r~g~~r~~a~~~~L~v~~gd~~v~~~g~~~e~~~l~al~e~~r~k~gkr~iiI~   88 (253)
T KOG1204           9 ILLTGASRGIGTGSVATILAEDDEALRYGVARLLAELEGLKVAYGDDFVHVVGDITEEQLLGALREAPRKKGGKRDIIIH   88 (253)
T ss_pred             EEEECCCCCCCHHHHHHHHHCCHHHHHHHHHCCCCCCCCEEEEECCCCCEECHHHHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             99925777755878999996242788886630356666658871687312202788889999998504534771567773


Q ss_pred             CCCCCCC------CCC-CCCCCEEEEECCCCCCCCCCCCC----CCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             8634454------322-33221024201222110001122----333--3334455321113575544211112222111
Q gi|254780921|r   57 PAAYTAV------DKA-EDEPEIAFSINAEGAGAIAKAAD----SIG--IPCIYISTDYVFDGLSRTPIDEFSPTNPLNI  123 (290)
Q Consensus        57 ~Aa~~~~------~~~-e~~~~~~~~~Nv~~~~~l~~~~~----~~~--~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~  123 (290)
                      -||-..+      |.. -.+.+..|++|..+...|..++.    +..  -.+|++||.+     .-.|+.      -...
T Consensus        89 NAG~lgdvsk~~~~~~D~~qw~ky~~~NlfS~VsL~~~~l~~lk~~p~~~~vVnvSS~a-----av~p~~------~wa~  157 (253)
T KOG1204          89 NAGSLGDVSKGAVDLGDSDQWKKYWDLNLFSMVSLVQWALPKLKKSPVNGNVVNVSSLA-----AVRPFS------SWAA  157 (253)
T ss_pred             CCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCHH-----HHCCCC------HHHH
T ss_conf             58875435541378555799999988653458766899988710788667079950445-----526440------8888


Q ss_pred             CHHHHHHHHHHHCCCC
Q ss_conf             0124566665310122
Q gi|254780921|r  124 YGKSKLAGEEKVASYT  139 (290)
Q Consensus       124 Yg~sK~~~E~~v~~~~  139 (290)
                      |+.+|.+-+.+.+..+
T Consensus       158 yc~~KaAr~m~f~~lA  173 (253)
T KOG1204         158 YCSSKAARNMYFMVLA  173 (253)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             6326999999999985


No 322
>PRK13194 pyrrolidone-carboxylate peptidase; Provisional
Probab=95.60  E-value=0.019  Score=32.98  Aligned_cols=57  Identities=19%  Similarity=0.195  Sum_probs=37.0

Q ss_pred             CEEEEECCCCHHH------HHHHHHHHC----CCEEEEECHHHCCCC-CHHHHHHHHHHCCCCEEEECC
Q ss_conf             9499997889788------999999964----985999613670878-999999999755998999786
Q gi|254780921|r    1 MKCLVIGNNGQIA------QSLSSMCVQ----DVEIIRVGRPDIDLL-KPKDFASFFLSFSPDVIINPA   58 (290)
Q Consensus         1 MkiLVtG~~G~iG------~~l~~~l~~----~~~v~~~~r~~~D~~-~~~~~~~~l~~~~pd~Vih~A   58 (290)
                      |||||||=.=|-|      ..+++.|..    +.++...--+ .++. -.+.+.+.++..+||+|||+.
T Consensus         1 mrVLvTGFePF~g~~~NPS~~~v~~L~~~~~~~~~v~~~~LP-V~~~~~~~~l~~~i~~~~Pd~vi~lG   68 (204)
T PRK13194          1 MKVLVTGFEPFGGDDKNPTMRIVKDLDGIKIGDAQVFGRVLP-VSFKRAREVLEKTLDEIKPDITINLG   68 (204)
T ss_pred             CEEEEEEECCCCCCCCCHHHHHHHHCCCCCCCCCEEEEEEEC-CCHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             989996007989799787899999633577789679999817-86899999999999851998999824


No 323
>pfam04127 DFP DNA / pantothenate metabolism flavoprotein. The DNA/pantothenate metabolism flavoprotein (EC:4.1.1.36) affects synthesis of DNA, and pantothenate metabolism.
Probab=95.58  E-value=0.061  Score=30.13  Aligned_cols=62  Identities=15%  Similarity=0.262  Sum_probs=41.3

Q ss_pred             EEEEECC----------------CCHHHHHHHHHH-HCCCEEEEECHHH------------CCCCCHHHHHHHHHHC---
Q ss_conf             4999978----------------897889999999-6498599961367------------0878999999999755---
Q gi|254780921|r    2 KCLVIGN----------------NGQIAQSLSSMC-VQDVEIIRVGRPD------------IDLLKPKDFASFFLSF---   49 (290)
Q Consensus         2 kiLVtG~----------------~G~iG~~l~~~l-~~~~~v~~~~r~~------------~D~~~~~~~~~~l~~~---   49 (290)
                      |||||+|                ||-.|.+|++.+ ..|++|..+..+.            ..+...+++.+.+...   
T Consensus         4 ~vlITaG~T~E~ID~VR~ItN~SSGkmG~alA~~~~~~Ga~V~li~g~~~~~~~~~~~~~~i~v~t~~em~~~~~~~~~~   83 (197)
T pfam04127         4 RVLVTSGGTREPIDPVRFISNFSSGKMGAAIAEEFLKRGADVTLIAGKGSLKPEPSGNLLIIPVETAEEMLNALKEIAPD   83 (197)
T ss_pred             EEEEECCCCCCCCCCCCEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCEEEEEECCHHHHHHHHHHHCCC
T ss_conf             99993688644438831536269559999999999978993899723565566898881899968999999999974756


Q ss_pred             CCCEEEECCCCCCC
Q ss_conf             99899978634454
Q gi|254780921|r   50 SPDVIINPAAYTAV   63 (290)
Q Consensus        50 ~pd~Vih~Aa~~~~   63 (290)
                      ..|++||+||.++.
T Consensus        84 ~~D~~I~aAAVsDf   97 (197)
T pfam04127        84 LHDVFILAAAVSDF   97 (197)
T ss_pred             CCCEEEEEEECCCC
T ss_conf             57799991000445


No 324
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein; InterPro: IPR014182   Members of this entry form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases. Some current members of this entry carry designations as putative alginate lyase, however none have been characterised as such..
Probab=95.56  E-value=0.045  Score=30.90  Aligned_cols=48  Identities=21%  Similarity=0.479  Sum_probs=37.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHC--CCEEEEECHHHCCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             499997889788999999964--9859996136708789999999997559989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~--~~~v~~~~r~~~D~~~~~~~~~~l~~~~pd~Vih   56 (290)
                      +|||+||+|=+||-++.++.+  +-+|+++..      .+++ .+|+.+-.-|+||+
T Consensus       153 ~lLIiGgAGGVGSI~iQLAR~LT~ltVIaTAS------RpEs-~~Wv~~LGAH~VID  202 (338)
T TIGR02817       153 ALLIIGGAGGVGSILIQLARQLTGLTVIATAS------RPES-QEWVLELGAHHVID  202 (338)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCEEEEECC------CHHH-HHHHHHCCCCEEEC
T ss_conf             47897388517899999999854964999728------5789-99999739918865


No 325
>pfam03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain. The UDP-glucose/GDP-mannose dehydrogenaseses are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate.
Probab=95.51  E-value=0.022  Score=32.61  Aligned_cols=31  Identities=19%  Similarity=0.258  Sum_probs=27.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHH-CCCEEEEECHH
Q ss_conf             949999788978899999996-49859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~   32 (290)
                      |||-|.|. ||+|..++-.|+ .|++|+++|.+
T Consensus         1 MkI~ViGl-GyVGl~~a~~la~~G~~V~g~D~d   32 (185)
T pfam03721         1 MRIAVIGL-GYVGLPTAVCLAEIGHDVVGVDIN   32 (185)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             97999897-874899999999489939999799


No 326
>PTZ00082 L-lactate dehydrogenase; Provisional
Probab=95.51  E-value=0.11  Score=28.61  Aligned_cols=225  Identities=14%  Similarity=0.081  Sum_probs=98.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHC--CCEEEEECHHH-------CCCCCHHHH------------HHHHHHCCCCEEEECCCC
Q ss_conf             499997889788999999964--98599961367-------087899999------------999975599899978634
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPD-------IDLLKPKDF------------ASFFLSFSPDVIINPAAY   60 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~--~~~v~~~~r~~-------~D~~~~~~~------------~~~l~~~~pd~Vih~Aa~   60 (290)
                      ||-|.|+ |.+|+.++-.+..  -.+++-+|..+       +|+.+...+            .+-+++  .|+||-+|+.
T Consensus         9 KV~IIGa-G~VG~~~A~~l~~~~l~eivLiDi~~~~a~g~a~Dl~h~~~~~~~~~~v~~~~dy~~~~~--aDiVVitAG~   85 (322)
T PTZ00082          9 KISLIGS-GNIGGVMAYLIQLKNLADVVLFDIVPNIPAGKALDIMHANVMAGSNCKVIGTNSYDDIAG--SDVVIVTAGL   85 (322)
T ss_pred             CEEEECC-CHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEECCCHHHHCC--CCEEEECCCC
T ss_conf             2999896-989999999996389977999978898008899987663644688857983799999779--9999989888


Q ss_pred             CCC-CCCC--CCCCEEEEECCCCCCCCCCCCCCCCC--CCCCCCC-----CCCCCCCCCCCCCCCCCCCCCCC--CHHHH
Q ss_conf             454-3223--32210242012221100011223333--3344553-----21113575544211112222111--01245
Q gi|254780921|r   61 TAV-DKAE--DEPEIAFSINAEGAGAIAKAADSIGI--PCIYIST-----DYVFDGLSRTPIDEFSPTNPLNI--YGKSK  128 (290)
Q Consensus        61 ~~~-~~~e--~~~~~~~~~Nv~~~~~l~~~~~~~~~--~~I~iSS-----~~Vy~g~~~~p~~E~d~~~P~~~--Yg~sK  128 (290)
                      ... ....  .+...-+..|+.-.+.++..+.+.+.  .++-+|-     .+++-.....|  .+--..--+.  =+|.+
T Consensus        86 ~~kpg~t~~~~~R~dLl~~Na~I~~~i~~~i~~~~p~aiiivvsNPvDv~t~~~~k~sg~p--~~rViG~Gt~LDsaR~r  163 (322)
T PTZ00082         86 AKAPGKSDDEWNRDDLLPLNAKIMIEVGENIKKYCPNAFVIVITNPLDVMVQLLLKVSGFP--KNKVVGMGGVLDSSRMK  163 (322)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHCCC--CCCEEEECCHHHHHHHH
T ss_conf             7789998765678899998899999999998740998359974892699999999976898--22489641238889999


Q ss_pred             -HHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             -6666531012223223555420003686320002011246652153045545445223689999999984420244334
Q gi|254780921|r  129 -LAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSL  207 (290)
Q Consensus       129 -~~~E~~v~~~~~~~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~  207 (290)
                       +.+|.+    .-+.--+ -++|.|.||.+.+.-|-+..-.+.++.=+-++  ....-.++.+    +.++...    ..
T Consensus       164 ~~ia~~l----~v~~~~V-~~~ViGeHGds~vp~wS~~~v~G~pl~~~~~~--~~~~~~~~~~----i~~~v~~----~g  228 (322)
T PTZ00082        164 YYIAQKL----GVNPRDV-HASVIGAHGDSMVPLTSYVTVGGIPLQEFIEQ--GLITQEEIDE----IFERTVN----SA  228 (322)
T ss_pred             HHHHHHH----CCCHHHE-EEEEEECCCCCEEEEEEEEEECCEEHHHHHCC--CCCCHHHHHH----HHHHHCC----CC
T ss_conf             9999984----9887772-76776146882687422227988986886314--8999899999----9986405----65


Q ss_pred             CCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHEEECCH
Q ss_conf             43137623866678899999999999972798000576285
Q gi|254780921|r  208 RGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFT  248 (290)
Q Consensus       208 ~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~~i~~~~~  248 (290)
                      +.|+++-+ .+. +.+..|..+...+.........+.|+..
T Consensus       229 ~~ii~~~g-kgs-t~~gia~a~~~i~~aIl~d~~~v~pvs~  267 (322)
T PTZ00082        229 LEIVNLYG-SGS-AYFAPAAAAIEMAEAYLKDKKKVLPCSC  267 (322)
T ss_pred             CEEEEECC-CCC-CCHHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             22313048-776-6302999999999999647895699999


No 327
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional
Probab=95.47  E-value=0.029  Score=31.98  Aligned_cols=99  Identities=14%  Similarity=0.170  Sum_probs=50.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CC-EEEEECHHHCCCC----------------CHHHHHHHHHHCCCCEEEECCCCC-C
Q ss_conf             499997889788999999964-98-5999613670878----------------999999999755998999786344-5
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DV-EIIRVGRPDIDLL----------------KPKDFASFFLSFSPDVIINPAAYT-A   62 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~-~v~~~~r~~~D~~----------------~~~~~~~~l~~~~pd~Vih~Aa~~-~   62 (290)
                      ||||.|+ |=+|++++.+|.. |. ++..+|....++.                +.+..++.+++..|++-|..-... .
T Consensus        34 ~VlivG~-GGlG~~~~~~La~aGvg~i~lvD~D~ve~sNLnRQ~l~~~~diG~~Kv~~a~~~l~~inp~i~i~~~~~~i~  112 (245)
T PRK05690         34 RVLVVGL-GGLGCAAAQYLAAAGVGTLTLVDFDTVSLSNLQRQVLHDDATIGQPKVESAKAALARINPHIAIETINARLD  112 (245)
T ss_pred             CEEEECC-CHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHCCCHHHCCCCHHHHHHHHHHHHCCCCCEEEEHHCCC
T ss_conf             7899877-777899999999859965999968867888678886459877898879999999997588752263331448


Q ss_pred             CCCCC---CCCCEEEE--ECCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             43223---32210242--01222110001122333333445532
Q gi|254780921|r   63 VDKAE---DEPEIAFS--INAEGAGAIAKAADSIGIPCIYISTD  101 (290)
Q Consensus        63 ~~~~e---~~~~~~~~--~Nv~~~~~l~~~~~~~~~~~I~iSS~  101 (290)
                      .+..+   ++.+....  -|...-..+-++|.+.++++|+-|-.
T Consensus       113 ~~n~~~li~~~DlViD~~Dn~~~R~~ln~~c~~~~~P~v~g~~~  156 (245)
T PRK05690        113 DDELAALIAAHDLVLDCTDNVATRNQLNAACFAAKKPLVSGAAI  156 (245)
T ss_pred             HHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             88998875078889987899999999999999719987987788


No 328
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional
Probab=95.46  E-value=0.041  Score=31.13  Aligned_cols=30  Identities=10%  Similarity=0.090  Sum_probs=18.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CCEEEEECH
Q ss_conf             499997889788999999964-985999613
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGR   31 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r   31 (290)
                      +|||+||+|-+|+..+.+.+. |.+|+++.+
T Consensus       143 ~vLi~gaaGgVG~~avQlAk~~Ga~Vi~t~~  173 (327)
T PRK10754        143 QFLFHAAAGGVGLIACQWAKALGAKLIGTVG  173 (327)
T ss_pred             EEEEECCCCCCCHHHHHHHHHCCCEEEEEEC
T ss_conf             9999817761126899999986999999989


No 329
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=95.43  E-value=0.062  Score=30.10  Aligned_cols=134  Identities=20%  Similarity=0.180  Sum_probs=68.4

Q ss_pred             EEEEECCCCH-HHH---------HHHHHH-HCCCEEEEECHH------HCCCC--------CHHHHHHHHHHCCCCEEE-
Q ss_conf             4999978897-889---------999999-649859996136------70878--------999999999755998999-
Q gi|254780921|r    2 KCLVIGNNGQ-IAQ---------SLSSMC-VQDVEIIRVGRP------DIDLL--------KPKDFASFFLSFSPDVII-   55 (290)
Q Consensus         2 kiLVtG~~G~-iG~---------~l~~~l-~~~~~v~~~~r~------~~D~~--------~~~~~~~~l~~~~pd~Vi-   55 (290)
                      ||||+|+..+ ||+         +-++.| ..|++.+-+..+      +.|+.        ..+.+.++++..+|+.|| 
T Consensus       555 kvlvlGsGp~rIGqgiEFDY~~v~a~~alk~~G~~~imIN~NPETVSTD~d~sDrLYFEplt~E~V~~I~~~E~p~gvi~  634 (1063)
T PRK05294        555 KVMILGGGPNRIGQGIEFDYCCVHAALALREAGYETIMVNCNPETVSTDYDTSDRLYFEPLTLEDVLEIIEKEKPKGVIV  634 (1063)
T ss_pred             CEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHCCCEEEE
T ss_conf             37996577732044423006799999999965981589537811111565667614543688999999999758987999


Q ss_pred             ECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCC---CCCCCCCCCCCCCCHHHHHHH
Q ss_conf             7863445432233221024201222110001122333333445532111357-554---421111222211101245666
Q gi|254780921|r   56 NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGL-SRT---PIDEFSPTNPLNIYGKSKLAG  131 (290)
Q Consensus        56 h~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~-~~~---p~~E~d~~~P~~~Yg~sK~~~  131 (290)
                      -+.|.+.                   .||+....+.|++++=.|...+=-.+ ++.   -..+-.-.-|.+....+--++
T Consensus       635 qfGGQt~-------------------~nla~~L~~~g~~ilGts~~~Id~aEDR~~F~~~l~~l~i~qp~~~~a~s~~ea  695 (1063)
T PRK05294        635 QFGGQTP-------------------LKLAKALEAAGVPILGTSPDAIDLAEDRERFQKLLEKLGIKQPPNGTATSVEEA  695 (1063)
T ss_pred             ECCCCCH-------------------HHHHHHHHHCCCCEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEECCHHHH
T ss_conf             7388367-------------------899999998799477788788787875888999998659999997076689999


Q ss_pred             HHHHCCCCCCCCCCCCCCCEECCC
Q ss_conf             653101222322355542000368
Q gi|254780921|r  132 EEKVASYTNNYVILRTAWVYSIFG  155 (290)
Q Consensus       132 E~~v~~~~~~~~IlR~~~vyG~~~  155 (290)
                      .+++.+.+ --+++|||.|.|..+
T Consensus       696 ~~~a~~iG-yPvlvRPSyVLGG~~  718 (1063)
T PRK05294        696 LEIAEEIG-YPVLVRPSYVLGGRA  718 (1063)
T ss_pred             HHHHHHCC-CCEEECCCCCCCCCC
T ss_conf             99998649-866843431025771


No 330
>PRK06849 hypothetical protein; Provisional
Probab=95.40  E-value=0.09  Score=29.19  Aligned_cols=59  Identities=15%  Similarity=0.188  Sum_probs=43.5

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHHHC----------------C-CCCH----HHHHHHHHHCCCCEEEECC
Q ss_conf             94999978897889999999-64985999613670----------------8-7899----9999999755998999786
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDI----------------D-LLKP----KDFASFFLSFSPDVIINPA   58 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~~----------------D-~~~~----~~~~~~l~~~~pd~Vih~A   58 (290)
                      |+||||||.-..+-++++.| .+||+|+..+....                . -.|+    +.+.+++++.++|++|-+.
T Consensus         5 ~tvLiTg~r~~~aL~laR~l~~~Gh~V~~aD~~~~~l~r~Sr~v~~~~~vP~P~~d~~~y~~~Ll~Iv~~e~idl~IP~~   84 (387)
T PRK06849          5 KTVLITGARAPAALQLARSFHNAGHTVILADSLKYPLSRFSRAVDGFYTIPSPKWDPNAYIQALLSIVKRHNIDLLIPTC   84 (387)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCHHHCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEECC
T ss_conf             77999588607899999999878997999848987754200001127986999789899999999999983899999777


Q ss_pred             C
Q ss_conf             3
Q gi|254780921|r   59 A   59 (290)
Q Consensus        59 a   59 (290)
                      -
T Consensus        85 e   85 (387)
T PRK06849         85 E   85 (387)
T ss_pred             C
T ss_conf             6


No 331
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase; InterPro: IPR000706   N -Acetylglutamate (NAG) fulfils distinct biological roles in lower and higher organisms. In prokaryotes, lower eukaryotes and plants it is the first intermediate in the biosynthesis of arginine, whereas in ureotelic (excreting nitrogen mostly in the form of urea) vertebrates, it is an essential allosteric cofactor for carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle. The pathway that leads from glutamate to arginine in lower organisms employs eight steps, starting with the acetylation of glutamate to form NAG. In these species, NAG can be produced by two enzymatic reactions: one catalysed by NAG synthase (NAGS) and the other by ornithine acetyltransferase (OAT). In ureotelic species, NAG is produced exclusively by NAGS. In lower organisms, NAGS is feedback-inhibited by L-arginine, whereas mammalian NAGS activity is significantly enhanced by this amino acid. The NAGS genes of bacteria, fungi and mammals are more diverse than other arginine-biosynthesis and urea-cycle genes. The evolutionary relationship between the distinctly different roles of NAG and its metabolism in lower and higher organisms remains to be determined .   The pathway from glutamate to arginine is:   NAGS; N-acetylglutamate synthase (2.3.1.1 from EC) (glutamate to N-acetylglutamate) NAGK; N-acetylglutamate kinase (2.7.2.8 from EC) (N-acetylglutamate to N-acetylglutamate-5P) NAGSA; N-acetyl-gamma-glutamyl-phosphate reductase (1.2.1.38 from EC) (N-acetylglutamate-5P to N-acetylglumate semialdehyde) Acetylornithine aminotransferase (2.6.1.11 from EC) (N-acetylglumate semialdehyde to N-acetylornithine) Acetylornithine deacetylase (3.5.1.16 from EC) (N-acetylornithine to ornithine) Arginase (3.5.3.1 from EC) (ornithine to arginine) N-acetyl-gamma-glutamyl-phosphate reductase (1.2.1.38 from EC) (AGPR) ,  is the enzyme that catalyzes the third step in the biosynthesis of arginine from glutamate, the NADP-dependent reduction of N-acetyl-5-glutamyl phosphate into N-acetylglutamate 5-semialdehyde. In bacteria it is a monofunctional protein of 35 to 38 kD (gene argC), while in fungi it is part of a bifunctional mitochondrial enzyme (gene ARG5,6, arg11 or arg-6) which contains a N-terminal acetylglutamate kinase (2.7.2.8 from EC) domain and a C-terminal AGPR domain. In the Escherichia coli enzyme, a cysteine has been shown to be implicated in the catalytic activity, and the region around this residue is well conserved.; GO: 0003942 N-acetyl-gamma-glutamyl-phosphate reductase activity, 0006526 arginine biosynthetic process.
Probab=95.35  E-value=0.02  Score=32.92  Aligned_cols=113  Identities=19%  Similarity=0.198  Sum_probs=69.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC--CCEEE--EECHH--HC--------------C-C--CC--HHHHHHHH-HHCCCCEE
Q ss_conf             9499997889788999999964--98599--96136--70--------------8-7--89--99999999-75599899
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ--DVEII--RVGRP--DI--------------D-L--LK--PKDFASFF-LSFSPDVI   54 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~--~~~v~--~~~r~--~~--------------D-~--~~--~~~~~~~l-~~~~pd~V   54 (290)
                      |||-|.|||||-|.+|.|+|..  ..++.  ..+|.  ..              | +  ..  ...++++. +++  |+|
T Consensus         1 ~~V~IvGAsGYtG~EL~RLL~~HP~~e~~~~~ss~~~~aG~~~~~~~P~L~g~~~~~~~~~~~~~~~~~~~L~~~--DvV   78 (361)
T TIGR01850         1 IKVGIVGASGYTGGELLRLLANHPEVEITYLVSSRESLAGKPLSEVHPHLRGLVDYLNLEPLDDAKLEEIELEDA--DVV   78 (361)
T ss_pred             CEEEEEECCCHHHHHHHHHHHCCCCEEEEEEEEEEEHHCCCCHHHHCCCHHHHHCCCCCCCCCHHHHHHHHHCCC--CEE
T ss_conf             968999334446899999984199537888887620113852577366111010023336667667888621376--789


Q ss_pred             EECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCC---CCCCCHHHHH
Q ss_conf             978634454322332210242012221100011223333334455321113575--54421111222---2111012456
Q gi|254780921|r   55 INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLS--RTPIDEFSPTN---PLNIYGKSKL  129 (290)
Q Consensus        55 ih~Aa~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy~g~~--~~p~~E~d~~~---P~~~Yg~sK~  129 (290)
                      |-+--.          .        -...++......|+++|=+|-|+=|+...  +.+|-. .+.-   ..-.||..=+
T Consensus        79 FlAlPh----------g--------vs~~~~p~~l~~g~~ViDLSADFRl~d~~~Ye~wYG~-h~~~~ll~~avYGLpEl  139 (361)
T TIGR01850        79 FLALPH----------G--------VSMELAPELLEAGVKVIDLSADFRLKDPEVYEKWYGF-HAAPELLQEAVYGLPEL  139 (361)
T ss_pred             EECCCH----------H--------HHHHHHHHHHHCCCEEEECCCCCCCCCHHHHHHHCCC-CCCHHHHHHCCCCCCCC
T ss_conf             986872----------5--------5699999998479869988834336997999996677-88966663115567670


Q ss_pred             H--HHHH
Q ss_conf             6--6653
Q gi|254780921|r  130 A--GEEK  134 (290)
Q Consensus       130 ~--~E~~  134 (290)
                      -  -|++
T Consensus       140 ~~~re~i  146 (361)
T TIGR01850       140 HGAREEI  146 (361)
T ss_pred             CHHHHHH
T ss_conf             1058898


No 332
>PRK13193 pyrrolidone-carboxylate peptidase; Provisional
Probab=95.34  E-value=0.024  Score=32.41  Aligned_cols=58  Identities=12%  Similarity=0.106  Sum_probs=38.2

Q ss_pred             CEEEEECCCCHHHH------HHHHHHH----CCCEEEEECHHHCCCC-CHHHHHHHHHHCCCCEEEECCC
Q ss_conf             94999978897889------9999996----4985999613670878-9999999997559989997863
Q gi|254780921|r    1 MKCLVIGNNGQIAQ------SLSSMCV----QDVEIIRVGRPDIDLL-KPKDFASFFLSFSPDVIINPAA   59 (290)
Q Consensus         1 MkiLVtG~~G~iG~------~l~~~l~----~~~~v~~~~r~~~D~~-~~~~~~~~l~~~~pd~Vih~Aa   59 (290)
                      |||||||=.-|-|.      .+++.|.    .++++...--+ .++. -.+.+.+.+++.+||+|||+.-
T Consensus         1 m~ILvTGFePF~g~~~NPS~~~v~~L~~~~~~~~~v~~~~LP-v~~~~~~~~l~~~i~~~~Pd~vi~lG~   69 (201)
T PRK13193          1 MTVLLFGFEPFLEYKENPSQLIVEALNGSTILKEEVKGVILP-VEYDKIEDMIVTKIREYKPILTLGIGL   69 (201)
T ss_pred             CEEEEEEECCCCCCCCCHHHHHHHHCCCCCCCCCEEEEEEEC-CCHHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             989997356899898786699998555566588458999968-708889999999998519968998056


No 333
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional
Probab=95.30  E-value=0.011  Score=34.30  Aligned_cols=22  Identities=18%  Similarity=0.416  Sum_probs=19.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC
Q ss_conf             9499997889788999999964
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ   22 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~   22 (290)
                      ++|-|.|+||++|+.|.++|..
T Consensus         6 ~nVaIvGATG~VG~~li~lL~~   27 (347)
T PRK06728          6 YHVAVVGATGAVGQKIIELLEK   27 (347)
T ss_pred             CEEEEECCCCHHHHHHHHHHHH
T ss_conf             7799998803999999999972


No 334
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism]
Probab=95.21  E-value=0.037  Score=31.39  Aligned_cols=83  Identities=25%  Similarity=0.412  Sum_probs=57.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-CCEEEEEC---HH-----------HCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             9499997889788999999964-98599961---36-----------708789999999997559989997863445432
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVG---RP-----------DIDLLKPKDFASFFLSFSPDVIINPAAYTAVDK   65 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~~~v~~~~---r~-----------~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~   65 (290)
                      |+|||.|||+- ++.|.+.|.. +..++..+   +-           -.-..+.+.+.+++++.+.|.||..        
T Consensus         3 ~~ilvlGGT~D-ar~la~~L~~~~~~~~~ss~t~~g~~l~~~~~~~~~~G~l~~e~l~~~l~e~~i~llIDA--------   73 (257)
T COG2099           3 MRILLLGGTSD-ARALAKKLAAAPVDIILSSLTGYGAKLAEQIGPVRVGGFLGAEGLAAFLREEGIDLLIDA--------   73 (257)
T ss_pred             CEEEEEECCHH-HHHHHHHHHCCCCCEEEEECCCCCCCCHHCCCCEEECCCCCHHHHHHHHHHCCCCEEEEC--------
T ss_conf             35999826389-999999862068617999703444241110588665276887899999997498889978--------


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2332210242012221100011223333334455
Q gi|254780921|r   66 AEDEPEIAFSINAEGAGAIAKAADSIGIPCIYIS   99 (290)
Q Consensus        66 ~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iS   99 (290)
                        .+|   |.  ...+.|.+++|+..|++++-+.
T Consensus        74 --THP---yA--a~iS~Na~~aake~gipy~r~e  100 (257)
T COG2099          74 --THP---YA--ARISQNAARAAKETGIPYLRLE  100 (257)
T ss_pred             --CCH---HH--HHHHHHHHHHHHHHCCCEEEEE
T ss_conf             --875---79--9998999999998599679987


No 335
>PRK08229 2-dehydropantoate 2-reductase; Provisional
Probab=95.12  E-value=0.038  Score=31.34  Aligned_cols=32  Identities=22%  Similarity=0.397  Sum_probs=27.9

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHHH
Q ss_conf             94999978897889999999-6498599961367
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPD   33 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~   33 (290)
                      |||+|.|+ |=+|+.+.-.| ..|++|..++|.+
T Consensus         3 mkI~IiGa-GAvG~~~a~~L~~aG~~V~lv~r~~   35 (341)
T PRK08229          3 ARICVLGA-GSIGCYLGGRLAAAGADVTLIGRAR   35 (341)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCEEEEECHH
T ss_conf             77999896-7999999999985899879995678


No 336
>PRK13303 L-aspartate dehydrogenase; Provisional
Probab=95.11  E-value=0.031  Score=31.79  Aligned_cols=59  Identities=22%  Similarity=0.305  Sum_probs=36.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCC--EE--EEECHHH---------CCCCCHHHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             949999788978899999996498--59--9961367---------08789999999997559989997863445
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQDV--EI--IRVGRPD---------IDLLKPKDFASFFLSFSPDVIINPAAYTA   62 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~~--~v--~~~~r~~---------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~   62 (290)
                      |||-|.|. |-||+.+++.+..+.  ++  +......         .++.-...++++ . .+||+||-||+...
T Consensus         2 mrVgiiG~-GaIG~~va~~l~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~L-~-~~~DlVVE~A~~~a   73 (265)
T PRK13303          2 MKVAMIGF-GAIAAAVYELLEHDPRLRVDWVIVPEHSVDAVRRALGRAVQVVSSVDAL-A-QRPDLVVECAGHAA   73 (265)
T ss_pred             CEEEEECC-CHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHCCCCCCCCCHHHH-H-HCCCEEEECCCHHH
T ss_conf             29999854-6899999999844997279999946852677875304588644798898-2-37999998988899


No 337
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated
Probab=95.10  E-value=0.038  Score=31.29  Aligned_cols=99  Identities=20%  Similarity=0.276  Sum_probs=57.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-CC-EEEEECHHH--------------CCCC----CHHHHHHHHHHCCCCEEEECCCC
Q ss_conf             9499997889788999999964-98-599961367--------------0878----99999999975599899978634
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-DV-EIIRVGRPD--------------IDLL----KPKDFASFFLSFSPDVIINPAAY   60 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~~-~v~~~~r~~--------------~D~~----~~~~~~~~l~~~~pd~Vih~Aa~   60 (290)
                      .||||.|+ |=||+.++.+|.+ |. ++..+|+..              -|+-    +....++.+++..|++-|.....
T Consensus        25 a~VlVvGa-GGLGs~~a~~La~aGVG~i~ivD~D~Ve~SNL~RQ~L~~e~Dig~~~pKa~aA~~~L~~iNp~v~I~~~~~  103 (339)
T PRK07688         25 KHVLIIGA-GALGTANAEMLVRAGVGKVTIVDRDYVEWSNLQRQQLYTESDVKNNLPKAVAAKKRLEEINSEVRVEAIVQ  103 (339)
T ss_pred             CCEEEECC-CHHHHHHHHHHHHCCCCEEEEEECCEECCCCCCCCCCCCHHHHCCCCHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             97899877-77779999999984898299980999246678865065621332263779999999983499860587600


Q ss_pred             C-CCCCCCCCCCEEEEECCCCCC------CCCCCCCCCCCCCCCCCCC
Q ss_conf             4-543223322102420122211------0001122333333445532
Q gi|254780921|r   61 T-AVDKAEDEPEIAFSINAEGAG------AIAKAADSIGIPCIYISTD  101 (290)
Q Consensus        61 ~-~~~~~e~~~~~~~~~Nv~~~~------~l~~~~~~~~~~~I~iSS~  101 (290)
                      . +.+..+ +....+.+=+.++-      .+-++|.+.++++||-|-.
T Consensus       104 ~l~~~n~~-~li~~~DlViD~tDNf~tR~liNd~c~~~~~PlV~ga~~  150 (339)
T PRK07688        104 DVTAEELE-ELVTNVDVIIDATDNFETRFIVNDAAQKYSIPWIYGACV  150 (339)
T ss_pred             CCCHHHHH-HHHHCCCEEEECCCCHHHHHHHHHHHHHHCCCEEEEEEE
T ss_conf             39989999-998518899987889999999999999959998999884


No 338
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated
Probab=95.09  E-value=0.1  Score=28.93  Aligned_cols=29  Identities=28%  Similarity=0.306  Sum_probs=19.4

Q ss_pred             EEEEECCCCHHHH----HHHHHH-HCCCEEEEEC
Q ss_conf             4999978897889----999999-6498599961
Q gi|254780921|r    2 KCLVIGNNGQIAQ----SLSSMC-VQDVEIIRVG   30 (290)
Q Consensus         2 kiLVtG~~G~iG~----~l~~~l-~~~~~v~~~~   30 (290)
                      |=+++|-||-|.-    .|++.| ++|++|..+-
T Consensus         5 K~IllgVtGsIAayK~~~L~r~L~k~G~~V~vvm   38 (392)
T PRK05579          5 KRIVLGVSGGIAAYKALELVRRLRKAGADVRVVM   38 (392)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             9899998337999999999999987899899998


No 339
>PRK06522 2-dehydropantoate 2-reductase; Reviewed
Probab=95.06  E-value=0.035  Score=31.54  Aligned_cols=31  Identities=23%  Similarity=0.362  Sum_probs=27.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHH-CCCEEEEECHH
Q ss_conf             949999788978899999996-49859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~   32 (290)
                      |||+|.|+ |-||+.+.-.|. .|++|..+.|.
T Consensus         1 MkI~IiGa-GaiG~~~a~~L~~ag~~V~li~r~   32 (307)
T PRK06522          1 MKIAILGA-GAIGGLFGARLAQAGHDVTLVARG   32 (307)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             98999991-499999999998489988999788


No 340
>pfam02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase. This is a family of 1-deoxy-D-xylulose 5-phosphate reductoisomerases. This enzyme catalyses the formation of 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose-5-phosphate in the presence of NADPH. This reaction is part of the terpenoid biosynthesis pathway.
Probab=95.06  E-value=0.088  Score=29.25  Aligned_cols=51  Identities=14%  Similarity=0.252  Sum_probs=41.2

Q ss_pred             EEEECCCCHHHHHHHHHH---HCCCEEEEECHHHCCCCCHHHHHHHHHHCCCCEEEEC
Q ss_conf             999978897889999999---6498599961367087899999999975599899978
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC---VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINP   57 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l---~~~~~v~~~~r~~~D~~~~~~~~~~l~~~~pd~Vih~   57 (290)
                      |.|+|+||-||..-.+.+   .+.+++++++-.    .|.+.+.+...+++|.+|+-.
T Consensus         1 I~IlGsTGSIG~~tL~Vi~~~~~~f~v~~Lsa~----~N~~~L~~q~~~f~p~~v~i~   54 (129)
T pfam02670         1 ITILGSTGSIGTQTLDVIRRNPDRFEVVALSAG----RNVELLAEQIKEFKPKYVAVA   54 (129)
T ss_pred             CEEECCCCHHHHHHHHHHHHCCCCEEEEEEEEC----CCHHHHHHHHHHCCCCEEEEC
T ss_conf             989767868899999999959567189999834----789999999997399799995


No 341
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed
Probab=95.04  E-value=0.042  Score=31.08  Aligned_cols=29  Identities=21%  Similarity=0.360  Sum_probs=24.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC--CCEEEEE
Q ss_conf             9499997889788999999964--9859996
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRV   29 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~--~~~v~~~   29 (290)
                      |||-|.|+|||.|.+|.++|..  ..++..+
T Consensus         4 ikvaIvGatGy~G~ELirlL~~HP~~ei~~l   34 (350)
T PRK08664          4 LKVGVLGATGLVGQRFVQLLANHPWFEVTAL   34 (350)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCCCEEEEE
T ss_conf             7799989842999999999970999668999


No 342
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional
Probab=94.96  E-value=0.037  Score=31.40  Aligned_cols=98  Identities=20%  Similarity=0.268  Sum_probs=56.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CC-EEEEECHHH--------------CCCC----CHHHHHHHHHHCCCCEEEECCCC-
Q ss_conf             499997889788999999964-98-599961367--------------0878----99999999975599899978634-
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DV-EIIRVGRPD--------------IDLL----KPKDFASFFLSFSPDVIINPAAY-   60 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~-~v~~~~r~~--------------~D~~----~~~~~~~~l~~~~pd~Vih~Aa~-   60 (290)
                      ||||.|+ |=||+.++..|.+ |. ++..+|+..              -|+.    +....++.+++..|++-|..-.. 
T Consensus        26 ~VlIVGa-GGLGs~~a~~La~aGVG~l~ivD~D~Ve~SNL~RQ~L~~~~Dig~~k~Ka~aA~~~L~~iNp~v~I~~~~~~  104 (337)
T PRK12475         26 HVLIIGA-GALGAANAEALVRAGIGKLTIADRDYVEWSNLQRQQLYTEEDAKQYKPKAIAAAEHLRKINSEVEIVPVVTD  104 (337)
T ss_pred             CEEEECC-CHHHHHHHHHHHHCCCCEEEEEECCEECCCCCCCCCCCCHHHCCCCCHHHHHHHHHHHHHCCCCCEEEEHHC
T ss_conf             6999977-777899999999828986999849983144674530022212155748899999999844999744751311


Q ss_pred             CCCCCCCCCCCEEEEECCCCCC------CCCCCCCCCCCCCCCCCCC
Q ss_conf             4543223322102420122211------0001122333333445532
Q gi|254780921|r   61 TAVDKAEDEPEIAFSINAEGAG------AIAKAADSIGIPCIYISTD  101 (290)
Q Consensus        61 ~~~~~~e~~~~~~~~~Nv~~~~------~l~~~~~~~~~~~I~iSS~  101 (290)
                      -+.+..+ +....+.+=+.++-      .+-++|.+.++++||-|..
T Consensus       105 l~~~n~~-~li~~~DlViD~tDNf~tR~liNd~c~~~~~PlV~ga~~  150 (337)
T PRK12475        105 VTVEEME-ELIKEVDLIIDATDNFDTRLLINDISQKYNIPWIYGGCV  150 (337)
T ss_pred             CCHHHHH-HHHHHCCEEEECCCCHHHHHHHHHHHHHHCCCEEEEEEE
T ss_conf             9979999-998618899988889999999999999969998998870


No 343
>PRK06223 malate dehydrogenase; Reviewed
Probab=94.87  E-value=0.021  Score=32.78  Aligned_cols=94  Identities=18%  Similarity=0.262  Sum_probs=55.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC---CCEEEEECHHH-------CCCCCHHHH------------HHHHHHCCCCEEEECC
Q ss_conf             9499997889788999999964---98599961367-------087899999------------9999755998999786
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ---DVEIIRVGRPD-------IDLLKPKDF------------ASFFLSFSPDVIINPA   58 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~---~~~v~~~~r~~-------~D~~~~~~~------------~~~l~~~~pd~Vih~A   58 (290)
                      |||-|+|+ |.+|++++-.|..   -.++.-+|+++       +|+.+...+            .+.++  ..|+||-+|
T Consensus         1 mKI~IiGa-G~VG~~~a~~l~~~~l~~el~L~Di~~~~a~g~a~Dl~~~~~~~~~~~~i~~~~d~~~~~--daDiVVita   77 (312)
T PRK06223          1 MKISIIGA-GNVGATLAHLLALKELGKDVVLFDIPEGIPQGKALDIAESSAVDGFDAKITGTNDYADIA--GSDVVIITA   77 (312)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCCEEEECCCHHHHC--CCCEEEEEC
T ss_conf             97999996-989999999998579987489976999733679888765143368884798378889957--999999906


Q ss_pred             CCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCC--CCCCCC
Q ss_conf             34454322332210242012221100011223333--334455
Q gi|254780921|r   59 AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI--PCIYIS   99 (290)
Q Consensus        59 a~~~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~--~~I~iS   99 (290)
                      +.....  ..+...-++.|+.-.+.+.+...+.+.  .++-+|
T Consensus        78 g~~rk~--g~tR~dll~~N~~I~k~i~~~i~~~~p~~iilvvs  118 (312)
T PRK06223         78 GVPRKP--GMSRDDLLGINAKIMKDVGEGIKKYAPDAIVIVIT  118 (312)
T ss_pred             CCCCCC--CCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             778999--98868999987899999999998409981899936


No 344
>PRK13197 pyrrolidone-carboxylate peptidase; Provisional
Probab=94.86  E-value=0.042  Score=31.05  Aligned_cols=57  Identities=19%  Similarity=0.128  Sum_probs=37.1

Q ss_pred             CEEEEECCCCHHH------HHHHHHHHC----CCEEEEECHHHCCCC-CHHHHHHHHHHCCCCEEEECC
Q ss_conf             9499997889788------999999964----985999613670878-999999999755998999786
Q gi|254780921|r    1 MKCLVIGNNGQIA------QSLSSMCVQ----DVEIIRVGRPDIDLL-KPKDFASFFLSFSPDVIINPA   58 (290)
Q Consensus         1 MkiLVtG~~G~iG------~~l~~~l~~----~~~v~~~~r~~~D~~-~~~~~~~~l~~~~pd~Vih~A   58 (290)
                      |||||||=.=|-|      ..+++.|..    ++++...--+ .++. -.+.+.+++++.+||+|||+.
T Consensus         2 ~rVLvTGF~PF~g~~~NPS~~~v~~L~~~~~~~~~i~~~~LP-V~~~~~~~~l~~~l~~~~Pd~Vl~lG   69 (215)
T PRK13197          2 MKILVTGFDPFGGESINPSWEAVKQLPGKTIGGAEIVKRQLP-TVFGKSLDVLKEAIEEVQPDAVIAIG   69 (215)
T ss_pred             CEEEEEECCCCCCCCCCHHHHHHHHCCCCCCCCEEEEEEEEC-CCHHHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             879997327899898786999998546577698289999939-76888899999999987998899924


No 345
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism]
Probab=94.84  E-value=0.031  Score=31.78  Aligned_cols=86  Identities=20%  Similarity=0.294  Sum_probs=46.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCC-E-----EEEECHHH----CCCCC-----HHHHHHHHHHCCCCEEEECCCCCCCCC
Q ss_conf             949999788978899999996498-5-----99961367----08789-----999999997559989997863445432
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQDV-E-----IIRVGRPD----IDLLK-----PKDFASFFLSFSPDVIINPAAYTAVDK   65 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~~-~-----v~~~~r~~----~D~~~-----~~~~~~~l~~~~pd~Vih~Aa~~~~~~   65 (290)
                      |||=|.|+||.+|+.+.+.|.+.+ .     +++..|+.    .++.+     ++.+.+.....+.|+|+-||+-.-   
T Consensus         2 ~~VavvGATG~VG~~~~~~L~e~~f~~~~~~~~AS~rSaG~~~~~f~~~~~~v~~~~~~~~~~~~~Divf~~ag~~~---   78 (334)
T COG0136           2 LNVAVLGATGAVGQVLLELLEERHFPFEELVLLASARSAGKKYIEFGGKSIGVPEDAADEFVFSDVDIVFFAAGGSV---   78 (334)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCHHH---
T ss_conf             18999942355899999998753998405788852311577160106750357621134100124999999176687---


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             233221024201222110001122333333445532111
Q gi|254780921|r   66 AEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVF  104 (290)
Q Consensus        66 ~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy  104 (290)
                                     +..+...+.+.|+.+|=-||++-+
T Consensus        79 ---------------s~~~~p~~~~~G~~VIdnsSa~Rm  102 (334)
T COG0136          79 ---------------SKEVEPKAAEAGCVVIDNSSAFRM  102 (334)
T ss_pred             ---------------HHHHHHHHHHCCCEEEECCCCCCC
T ss_conf             ---------------899999999769889968731115


No 346
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only]
Probab=94.81  E-value=0.09  Score=29.20  Aligned_cols=32  Identities=22%  Similarity=0.195  Sum_probs=26.0

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHH
Q ss_conf             94999978897889999999-649859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~   32 (290)
                      |++...||+|.+|+.|.+.| +.+|+|+.-+|+
T Consensus         1 m~~~~i~GtGniG~alA~~~a~ag~eV~igs~r   33 (211)
T COG2085           1 MMIIAIIGTGNIGSALALRLAKAGHEVIIGSSR   33 (211)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             917999625718789999999679739996478


No 347
>PRK00711 D-amino acid dehydrogenase small subunit; Validated
Probab=94.76  E-value=0.046  Score=30.82  Aligned_cols=31  Identities=19%  Similarity=0.355  Sum_probs=27.4

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHH
Q ss_conf             94999978897889999999-649859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~   32 (290)
                      |||+|.|| |.+|...+-.| ++|++|+.++|.
T Consensus         1 m~VvIIGa-Gi~G~stA~~La~~G~~V~vler~   32 (416)
T PRK00711          1 MRVVVLGS-GVVGVTSAWYLARAGHEVTVIDRQ   32 (416)
T ss_pred             CEEEEECC-HHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             97999994-499999999999689968999699


No 348
>TIGR01289 LPOR light-dependent protochlorophyllide reductase; InterPro: IPR005979    This family contains the light-dependent, NADPH-dependent form of protochlorophyllide reductase (1.3.1.33 from EC) which catalyses the reaction  chlorophyllide A + NADP+ = protochlorophyllide + NADPH.  The enzyme belongs to the short chain alcohol dehydrogenase family. ; GO: 0016630 protochlorophyllide reductase activity, 0015995 chlorophyll biosynthetic process, 0019685 photosynthesis dark reaction, 0009507 chloroplast.
Probab=94.69  E-value=0.063  Score=30.06  Aligned_cols=98  Identities=15%  Similarity=0.163  Sum_probs=67.7

Q ss_pred             EEEECCCCHHHHHHHHHHH-CC-CEEEEECHH---------------------HCCCCCHHHHHHHHHHCC-----CCEE
Q ss_conf             9999788978899999996-49-859996136---------------------708789999999997559-----9899
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMCV-QD-VEIIRVGRP---------------------DIDLLKPKDFASFFLSFS-----PDVI   54 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l~-~~-~~v~~~~r~---------------------~~D~~~~~~~~~~l~~~~-----pd~V   54 (290)
                      ++|||+++=+|-+=++.|. .| ++|+--.|+                     .+|+...++++++++++|     -|++
T Consensus         6 viITGASSG~GL~~AKAL~~~G~WHV~MACR~l~Ka~~aA~~~G~p~~sYti~~lDL~~LdSVR~FV~~Fr~~gr~LdaL   85 (321)
T TIGR01289         6 VIITGASSGLGLYAAKALAETGKWHVVMACRDLLKAEKAAKSLGMPKDSYTILHLDLGSLDSVRQFVEQFRESGRPLDAL   85 (321)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             78863731357899999986398089981446168899998438886661354301344678999999998607842013


Q ss_pred             EECCCCCC-----CCCCCCCCCEEEEECCCCCCCCC-------CCCCCCCCCCCCCCC
Q ss_conf             97863445-----43223322102420122211000-------112233333344553
Q gi|254780921|r   55 INPAAYTA-----VDKAEDEPEIAFSINAEGAGAIA-------KAADSIGIPCIYIST  100 (290)
Q Consensus        55 ih~Aa~~~-----~~~~e~~~~~~~~~Nv~~~~~l~-------~~~~~~~~~~I~iSS  100 (290)
                      |=-||..-     |-.+-.+.|+...+|-.|.--|+       +.|.....|+|-+.|
T Consensus        86 VCNAAVy~P~~~EP~~~adgfELSV~TNHlGHFLL~~LLL~DLk~~~~~~~RlII~G~  143 (321)
T TIGR01289        86 VCNAAVYLPLLKEPLYSADGFELSVATNHLGHFLLCNLLLDDLKKSPDKDKRLIILGS  143 (321)
T ss_pred             EEHHHHHCCCCCCCCCCCCCEEECHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEE
T ss_conf             4213452663347764877503201344556999999999998606777786799830


No 349
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=94.66  E-value=0.17  Score=27.64  Aligned_cols=60  Identities=20%  Similarity=0.173  Sum_probs=36.4

Q ss_pred             EEEEECCCCH-HHH---------HHHHHH-HCCCEEEEECHH------HCCCC--------CHHHHHHHHHHCCCCEEE-
Q ss_conf             4999978897-889---------999999-649859996136------70878--------999999999755998999-
Q gi|254780921|r    2 KCLVIGNNGQ-IAQ---------SLSSMC-VQDVEIIRVGRP------DIDLL--------KPKDFASFFLSFSPDVII-   55 (290)
Q Consensus         2 kiLVtG~~G~-iG~---------~l~~~l-~~~~~v~~~~r~------~~D~~--------~~~~~~~~l~~~~pd~Vi-   55 (290)
                      ||+|+|+..+ ||+         |-++.| ..|++.+-+..+      +.|..        ..+.+.++++..+|+.|| 
T Consensus       556 kvliLGsGP~RIGqgiEFDYc~vha~~aLr~~G~etImiN~NPETVSTDyD~sDrLYFEPlt~E~V~~I~~~E~p~gViv  635 (1068)
T PRK12815        556 KVLILGSGPIRIGQGIEFDYMCVHAAFALKKEGYETIMINNNPETVSTDYDTADRLYFEPITLEDILNVAEAENIKGVIV  635 (1068)
T ss_pred             EEEEECCCCCEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCEEECCCCHHHHHHHHHHHCCCEEEE
T ss_conf             49995678714224424002589999999968974899627843123674557735753687999999999858997999


Q ss_pred             ECCCCC
Q ss_conf             786344
Q gi|254780921|r   56 NPAAYT   61 (290)
Q Consensus        56 h~Aa~~   61 (290)
                      -+.|.|
T Consensus       636 qfGGQt  641 (1068)
T PRK12815        636 QFGGQT  641 (1068)
T ss_pred             ECCCCC
T ss_conf             648823


No 350
>PRK12921 2-dehydropantoate 2-reductase; Provisional
Probab=94.61  E-value=0.052  Score=30.54  Aligned_cols=31  Identities=23%  Similarity=0.474  Sum_probs=27.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHH-CCCEEEEECHH
Q ss_conf             949999788978899999996-49859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~   32 (290)
                      |||+|.|+ |=||+.+.-.|. .|++|..+.|.
T Consensus         1 MkI~I~Ga-GAiG~~~a~~L~~~g~~V~lv~r~   32 (306)
T PRK12921          1 MKIAVVGA-GAVGGTFGARLLEAGRDVTFLGRS   32 (306)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             98999992-499999999998369988999700


No 351
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family; InterPro: IPR014188   This entry represents a subfamily of the alcohol dehydrogenase, a superfamily in which some members are zinc-binding medium-chain alcohol dehydrogenases while others are quinone oxidoreductases with no bound zinc. This entry includes YhdH from Escherichia coli and YhfP from Bacillus subtilis both of which bind NADPH or NAD, but not zinc. Both proteins have been studied crystallographically for insight into function. .
Probab=94.60  E-value=0.046  Score=30.85  Aligned_cols=50  Identities=12%  Similarity=0.264  Sum_probs=34.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CCEEEEECHHHCCCCCHHHHH-HHHHHCCCCEEEECC
Q ss_conf             499997889788999999964-985999613670878999999-999755998999786
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFA-SFFLSFSPDVIINPA   58 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~~~D~~~~~~~~-~~l~~~~pd~Vih~A   58 (290)
                      .||||||||=+||-=+..|++ ||+|++.+=+      . .-+ ++|++---.-||+=+
T Consensus       151 pVlVTGAtGGVGS~Av~~L~~lGY~V~A~tGk------~-~~~~~yL~~LGA~evi~R~  202 (330)
T TIGR02823       151 PVLVTGATGGVGSLAVAILSKLGYEVVASTGK------A-EEEVEYLKELGASEVIDRE  202 (330)
T ss_pred             CEEEECCCCCHHHHHHHHHHHCCCEEEEEECC------H-HHHHHHHHHCCCCCCCCHH
T ss_conf             78870677877899999998379769997378------3-7788999865811057711


No 352
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: IPR005676   Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway. Additionally, several important metabolic intermediates are produced by these reactions, such as diaminopimelic acid, an essential component of bacterial cell wall biosynthesis, and dipicolinic acid, which is involved in sporulation in Gram-positive bacteria. Members of the animal kingdom do not posses this pathway and must therefore acquire these essential amino acids through their diet. Research into improving the metabolic flux through this pathway has the potential to increase the yield of the essential amino acids in important crops, thus improving their nutritional value. Additionally, since the enzymes are not present in animals, inhibitors of them are promising targets for the development of novel antibiotics and herbicides. For more information see .   Aspartate-semialdehyde dehydrogenase, the second enzyme in the aspartate pathway, converts aspartyl phosphate to aspartate-semialdehyde, the branch point intermediate between the lysine and threonine/methionine pathways. Based on sequence alignments, the aspartate-semialdehyde dehydrogenase family appears to have two distinct subgroups, one found in most bacteria (Gram-positve and Gram-negative), while the other is found primarily in organisms lacking peptidoglycan (archaea,fungi and some bacteria). Most studies have been performed on enzymes isolated from Gram-negative bacteria , , , . The N-terminal domain forms the active site and NADP-binding pocket, while C-terminal domain is primarily involved in hydrophobic intersubunit contacts. The catalytic mechanism involves the formation of a covalent thioester acyl-enzyme intermediate mediated through nucleophilic attack by an active site cysteine residue on the substrate aspartyl phosphate. Release of inorganic phosphate is followed by hydride transfer from NADPH to yield the product. The recently described archaeal structure suggests that the two subgroups of aspartate semi-aldehyde dehydrogenase share similar structures and have an identical catalytic mechanism, despite their relatively low sequence identity . Unlike the bacterial enzymes, the archaeal enzyme utilised both NAD and NADP as cofactor.   This entry represents the subgroup of aspartate dehydrogenases found primarily in organisms lacking peptidoglycan. In addition to its role in aspartate metabolism, the enzyme from Sulfolobus solfataricus has been shown recently to exhibit RNase activity, suggesting that these enzymes may perform additional cellular functions .; GO: 0004073 aspartate-semialdehyde dehydrogenase activity, 0009086 methionine biosynthetic process, 0009088 threonine biosynthetic process.
Probab=94.59  E-value=0.031  Score=31.78  Aligned_cols=24  Identities=17%  Similarity=0.392  Sum_probs=21.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCC
Q ss_conf             949999788978899999996498
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQDV   24 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~~   24 (290)
                      |||=|+|+||++|+-++++|..-.
T Consensus         1 ~~VavLGaTG~VGq~f~~lL~~HP   24 (358)
T TIGR00978         1 VRVAVLGATGLVGQKFVKLLEKHP   24 (358)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCC
T ss_conf             968997065546899999975269


No 353
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.
Probab=94.57  E-value=0.12  Score=28.59  Aligned_cols=31  Identities=29%  Similarity=0.325  Sum_probs=27.2

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHH
Q ss_conf             94999978897889999999-649859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~   32 (290)
                      |||-|.|. ||+|-.++-.| ..|++|+++|.+
T Consensus         1 MkI~ViGl-GyVGl~~a~~lA~~G~~V~g~D~d   32 (411)
T TIGR03026         1 MKIAVIGL-GYVGLPLAALLADLGHEVTGVDID   32 (411)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             97999897-877999999999489948999899


No 354
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]
Probab=94.56  E-value=0.1  Score=28.91  Aligned_cols=31  Identities=26%  Similarity=0.337  Sum_probs=27.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-CCEEEEECHH
Q ss_conf             9499997889788999999964-9859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~   32 (290)
                      |||-|.|. ||+|-...-.|++ ||+|+++|..
T Consensus         1 MkI~viGt-GYVGLv~g~~lA~~GHeVv~vDid   32 (414)
T COG1004           1 MKITVIGT-GYVGLVTGACLAELGHEVVCVDID   32 (414)
T ss_pred             CCEEEECC-CHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             91589888-556887899998709848999578


No 355
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1. APPBP1 is part of the heterodimeric activating enzyme (E1), specific for the Rub family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin(-like) by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by Rub family of ubiquitin-like proteins (Ublps) activates SCF ubiquitin ligases and is involved in cell cycle control, signaling and embryogenesis. ABPP1 contains part of the adenylation domain.
Probab=94.50  E-value=0.06  Score=30.17  Aligned_cols=104  Identities=13%  Similarity=0.190  Sum_probs=57.0

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCC-EEEEECHH--------------HCCCCC--HHHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             94999978897889999999-6498-59996136--------------708789--999999997559989997863445
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDV-EIIRVGRP--------------DIDLLK--PKDFASFFLSFSPDVIINPAAYTA   62 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~-~v~~~~r~--------------~~D~~~--~~~~~~~l~~~~pd~Vih~Aa~~~   62 (290)
                      +||||.|.+| +|.++++.| ..|. .+...|-.              +-|+-+  .+...+.+++-.|+|-++.-.-+.
T Consensus        21 s~VLiiG~~g-lG~EiaKNLvLaGV~svti~D~~~v~~~DLg~nFfl~~~diGk~Raea~~~~L~eLNp~V~v~~~~~~~   99 (425)
T cd01493          21 AHVCLLNATA-TGTEILKNLVLPGIGSFTIVDGSKVDEEDLGNNFFLDASSLGKSRAEATCELLQELNPDVNGSAVEESP   99 (425)
T ss_pred             CCEEEECCCH-HHHHHHHHHHHCCCCEEEEEECCCCCHHHCCCCCCCCHHHCCCHHHHHHHHHHHHHCCCCCEEEEECCH
T ss_conf             9399999971-199999872132897699995991878885766156677858839999999999847868547870687


Q ss_pred             CCCCCCCC------CEEEEECC--CCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             43223322------10242012--221100011223333334455321113
Q gi|254780921|r   63 VDKAEDEP------EIAFSINA--EGAGAIAKAADSIGIPCIYISTDYVFD  105 (290)
Q Consensus        63 ~~~~e~~~------~~~~~~Nv--~~~~~l~~~~~~~~~~~I~iSS~~Vy~  105 (290)
                      ....+.++      .....+|.  .-...+-++|+..++++|++.|..+|+
T Consensus       100 ~~~~~~~~~~~~~f~vVV~t~~~~~~~~~in~~cr~~~i~fI~~~~~Gl~G  150 (425)
T cd01493         100 EALLDNDPSFFSQFTVVIATNLPESTLLRLADVLWSANIPLLYVRSYGLYG  150 (425)
T ss_pred             HHHHHCCHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCEEEEEEECCEE
T ss_conf             886426876752833899828899999999999998699789998244669


No 356
>TIGR00715 precor6x_red precorrin-6x reductase; InterPro: IPR003723   Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase . In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase .    There are at least two distinct cobalamin biosynthetic pathways in bacteria :  Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway ; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis ; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii shermanii.     Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) . There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans.   This entry represents CobK and CbiJ precorrin-6x reductase (1.3.1.54 from EC). In the aerobic pathway, CobK catalyses the reduction of the macrocycle of precorrin-6X to produce precorrin-6Y; while in the anaerobic pathway CbiJ catalyses the reduction of the macrocycle of cobalt-precorrin-6X into cobalt-precorrin-6Y , .; GO: 0016994 precorrin-6A reductase activity, 0009236 cobalamin biosynthetic process.
Probab=94.48  E-value=0.045  Score=30.88  Aligned_cols=82  Identities=16%  Similarity=0.302  Sum_probs=58.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCCC--EEEEEC--HH--------HC-----CCCCHHH-HHHHHHHCCCCEEEECCCCCC
Q ss_conf             949999788978899999996498--599961--36--------70-----8789999-999997559989997863445
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQDV--EIIRVG--RP--------DI-----DLLKPKD-FASFFLSFSPDVIINPAAYTA   62 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~~--~v~~~~--r~--------~~-----D~~~~~~-~~~~l~~~~pd~Vih~Aa~~~   62 (290)
                      |+||+.||| -=++++.+.|....  +++.+.  +.        ++     --.+.+. ++++|++.+.|+||..     
T Consensus         1 ~~vll~GGT-~dsr~~~~~L~~~~~~~i~~t~tt~~~~~l~~~~~a~~v~~gaL~~~EGL~~~l~~~~i~~~vDA-----   74 (260)
T TIGR00715         1 MSVLLMGGT-KDSRAIAKKLRALGDVEILVTVTTEEGKKLLEISQASKVVTGALDKDEGLRELLKEESIDILVDA-----   74 (260)
T ss_pred             CEEEEEECC-HHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHCCCCEEEEC-----
T ss_conf             968997177-78999997403787589998741577630010037771587574888753788864496389857-----


Q ss_pred             CCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             432233221024201222110001122333333445
Q gi|254780921|r   63 VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYI   98 (290)
Q Consensus        63 ~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I~i   98 (290)
                           .+|   |++|  .|.+.++.|++.+.++|-+
T Consensus        75 -----tHP---FA~~--~t~~a~~vc~E~~~~Yvrf  100 (260)
T TIGR00715        75 -----THP---FAAQ--ITKNALEVCKELGIPYVRF  100 (260)
T ss_pred             -----CCH---HHHH--HHHHHHHHHHHCCCEEEEE
T ss_conf             -----973---5899--9999999997619817996


No 357
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only]
Probab=94.44  E-value=0.058  Score=30.28  Aligned_cols=58  Identities=17%  Similarity=0.304  Sum_probs=39.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCC---CEEE-EECHHH---------CCCCCHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             94999978897889999999649---8599-961367---------0878999999999755998999786344
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQD---VEII-RVGRPD---------IDLLKPKDFASFFLSFSPDVIINPAAYT   61 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~---~~v~-~~~r~~---------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~   61 (290)
                      |+|.+.|+ |.||..+.+++..+   .+.+ .++|..         ...+....+.+++  ..+|+||-||+.-
T Consensus         1 l~vgiVGc-GaIG~~l~e~v~~~~~~~e~v~v~D~~~ek~~~~~~~~~~~~~s~ide~~--~~~DlvVEaAS~~   71 (255)
T COG1712           1 LKVGIVGC-GAIGKFLLELVRDGRVDFELVAVYDRDEEKAKELEASVGRRCVSDIDELI--AEVDLVVEAASPE   71 (255)
T ss_pred             CEEEEEEC-CHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHCCCCCCCCHHHHH--HCCCEEEEECCHH
T ss_conf             95789823-37889999998668864369999448878888888603887635677773--0244254307889


No 358
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1. Aos1 is part of the heterodimeric activating enzyme (E1), specific for the SUMO family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. The E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by SUMO family of ubiquitin-like proteins (Ublps) is involved in cell division, nuclear transport, the stress response and signal transduction. Aos1 contains part of the adenylation domain.
Probab=94.41  E-value=0.085  Score=29.35  Aligned_cols=100  Identities=13%  Similarity=0.170  Sum_probs=52.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHH-CCC-EEEEECHHH--------------CCC--CCHHHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             949999788978899999996-498-599961367--------------087--89999999997559989997863445
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV-QDV-EIIRVGRPD--------------IDL--LKPKDFASFFLSFSPDVIINPAAYTA   62 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~-~~~-~v~~~~r~~--------------~D~--~~~~~~~~~l~~~~pd~Vih~Aa~~~   62 (290)
                      .||||.|. |=+|+++++.|. .|. ++..+|...              -|+  ...+...+.+++..|++-|+.-... 
T Consensus        22 s~VlvvG~-GGLG~~v~~~La~aGvg~i~ivD~d~v~~snL~RQ~l~~~~diG~~Ka~~a~~~l~~lNp~v~i~~~~~~-   99 (197)
T cd01492          22 ARILLIGL-KGLGAEIAKNLVLSGIGSLTILDDRTVTEEDLGAQFLIPAEDLGQNRAEASLERLRALNPRVKVSVDTDD-   99 (197)
T ss_pred             CCEEEECC-CHHHHHHHHHHHHHCCCEEEEEECCCCCHHHCCCCEECCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECC-
T ss_conf             95999887-8899999999998379869999899187777397860323347888599999999973899728987045-


Q ss_pred             CCCCCCC--CCEEEE------ECCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             4322332--210242------01222110001122333333445532111
Q gi|254780921|r   63 VDKAEDE--PEIAFS------INAEGAGAIAKAADSIGIPCIYISTDYVF  104 (290)
Q Consensus        63 ~~~~e~~--~~~~~~------~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy  104 (290)
                        ..+.+  .-..+.      -|...-..+-++|.+.++++|+-++...|
T Consensus       100 --~~~~~~~~i~~~D~Vvd~~dn~~~r~~iN~~c~~~~iplI~g~~~g~~  147 (197)
T cd01492         100 --ISEKPEEFFSQFDVVVATELSRAELVKINELCRKLGVKFYATGVHGLF  147 (197)
T ss_pred             --CCHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCE
T ss_conf             --857689998289999999999999999999999819978999813755


No 359
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated
Probab=94.38  E-value=0.064  Score=30.04  Aligned_cols=94  Identities=17%  Similarity=0.258  Sum_probs=49.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CC-EEEEECHHHC--------------CCC--CHHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             499997889788999999964-98-5999613670--------------878--99999999975599899978634454
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DV-EIIRVGRPDI--------------DLL--KPKDFASFFLSFSPDVIINPAAYTAV   63 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~-~v~~~~r~~~--------------D~~--~~~~~~~~l~~~~pd~Vih~Aa~~~~   63 (290)
                      ||||.|+ |=+|+.++.+|.. |. ++...|....              |+-  +.+...+.+.+..|++-|..-... +
T Consensus       140 ~VlivG~-GGLGs~~a~yLA~aGVG~i~lvD~D~Ve~SNL~RQil~~~~diG~~Ka~~a~~~L~~~Np~i~i~~~~~~-l  217 (379)
T PRK08762        140 RVLLIGA-GGLGSPAAFYLAAAGVGHLRIADHDVVDRSNLQRQILHTEDSVGQPKVDSAAQRIAALNPRVQVEAVQTR-V  217 (379)
T ss_pred             CEEEECC-CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHCCCCCHHHCCCHHHHHHHHHHHHHCCCCCEEEEHHC-C
T ss_conf             7899888-7557999999998379758976288613345011257464335555899999999986899733850210-8


Q ss_pred             CCCCCCC---CEEEEECCCCCC------CCCCCCCCCCCCCCCCC
Q ss_conf             3223322---102420122211------00011223333334455
Q gi|254780921|r   64 DKAEDEP---EIAFSINAEGAG------AIAKAADSIGIPCIYIS   99 (290)
Q Consensus        64 ~~~e~~~---~~~~~~Nv~~~~------~l~~~~~~~~~~~I~iS   99 (290)
                      +  +.+.   ...+.+=+.++.      .+-++|.+.++++|+-|
T Consensus       218 ~--~~n~~~li~~~DlViDctDN~~tR~liN~~c~~~~~PlV~ga  260 (379)
T PRK08762        218 T--SSNVEALLQDVDVVVDGADNFPARYLLNDACVKLGKPLVYGA  260 (379)
T ss_pred             C--HHHHHHHHHHCCEEEECCCCHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             9--899999986288999868877889999999999799979998


No 360
>PRK12446 N-acetylglucosaminyl transferase; Reviewed
Probab=94.32  E-value=0.12  Score=28.58  Aligned_cols=64  Identities=19%  Similarity=0.259  Sum_probs=38.9

Q ss_pred             CE--EEEECCCC---HHHHHHHHHH-HCCCEEEEECHH---H------CC----------CC---CHHH-----------
Q ss_conf             94--99997889---7889999999-649859996136---7------08----------78---9999-----------
Q gi|254780921|r    1 MK--CLVIGNNG---QIAQSLSSMC-VQDVEIIRVGRP---D------ID----------LL---KPKD-----------   41 (290)
Q Consensus         1 Mk--iLVtG~~G---~iG~~l~~~l-~~~~~v~~~~r~---~------~D----------~~---~~~~-----------   41 (290)
                      ||  ++..||||   |=+-++++.| .++++|..+...   +      .+          +.   ....           
T Consensus         1 MkkIii~~GGTGGHi~Palala~~L~~~~~~v~~ig~~~g~e~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~l~~~~   80 (352)
T PRK12446          1 MKKIVFTGGGSAGHVTPNLAIIPKLIEDNWDISYIGSHQGIEKTIIEKENIPYYSISSGKLRRYFDLKNIKDPFLVMKGV   80 (352)
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             98799995875888999999999998489959999889605430445049968995447727855299999999999999


Q ss_pred             --HHHHHHHCCCCEEEECCCCCCCC
Q ss_conf             --99999755998999786344543
Q gi|254780921|r   42 --FASFFLSFSPDVIINPAAYTAVD   64 (290)
Q Consensus        42 --~~~~l~~~~pd~Vih~Aa~~~~~   64 (290)
                        ...++.+.+||+||-+.+|.++.
T Consensus        81 ~~s~~il~~~kPd~Vig~GGY~S~P  105 (352)
T PRK12446         81 MDAYVRIRKLKPDVIFSKGGFVSVP  105 (352)
T ss_pred             HHHHHHHHHCCCCEEEECCCHHHHH
T ss_conf             9999999963999999749877799


No 361
>pfam00899 ThiF ThiF family. This family contains a repeated domain in ubiquitin activating enzyme E1 and members of the bacterial ThiF/MoeB/HesA family.
Probab=94.31  E-value=0.11  Score=28.82  Aligned_cols=97  Identities=20%  Similarity=0.274  Sum_probs=49.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CC-EEEEECHHHC--------------CC--CCHHHHHHHHHHCCCCEEEECC--CCC
Q ss_conf             499997889788999999964-98-5999613670--------------87--8999999999755998999786--344
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DV-EIIRVGRPDI--------------DL--LKPKDFASFFLSFSPDVIINPA--AYT   61 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~-~v~~~~r~~~--------------D~--~~~~~~~~~l~~~~pd~Vih~A--a~~   61 (290)
                      ||||.|+ |=+|+++++.|.. |. ++...|....              |+  .+.+.+.+.+.+..|++-|..-  -++
T Consensus         3 kVlivG~-GglG~~~~~~La~~Gvg~i~lvD~D~ve~sNL~Rq~l~~~~diG~~Ka~~~~~~l~~~np~~~i~~~~~~i~   81 (134)
T pfam00899         3 RVLVVGA-GGLGSPAAEYLARAGVGKLTLVDFDTVELSNLNRQILFTESDIGKPKAEVAKERLRAINPDVEVEAYPERLT   81 (134)
T ss_pred             EEEEECC-CHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCEEECCHHHCCCEEHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             8999898-889999999999938974999989567632227224233646688107999999997789958999925679


Q ss_pred             CCCCCC---CCCCEEE--EECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             543223---3221024--20122211000112233333344553
Q gi|254780921|r   62 AVDKAE---DEPEIAF--SINAEGAGAIAKAADSIGIPCIYIST  100 (290)
Q Consensus        62 ~~~~~e---~~~~~~~--~~Nv~~~~~l~~~~~~~~~~~I~iSS  100 (290)
                      . +..+   ++.+...  .-|...-..+-++|.+.++++|+.++
T Consensus        82 ~-~~~~~~~~~~DvVi~~~Dn~~~r~~ln~~c~~~~ip~i~~~~  124 (134)
T pfam00899        82 P-ENLEELLKGADLVVDALDNFAARYLLNDACVKRGIPLISAGA  124 (134)
T ss_pred             H-HHHHHCCCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             7-787642644889999989999999999999985998999554


No 362
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain. This domain is inserted into the catalytic domain, the large dehydrogenase and D-lactate dehydrogenase families in SCOP. N-terminal portion of which is represented by family pfam00389.
Probab=94.30  E-value=0.13  Score=28.28  Aligned_cols=58  Identities=16%  Similarity=0.154  Sum_probs=42.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-CCEEEEECHHHCC-----CCCHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             9499997889788999999964-9859996136708-----78999999999755998999786344
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDID-----LLKPKDFASFFLSFSPDVIINPAAYT   61 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~~~D-----~~~~~~~~~~l~~~~pd~Vih~Aa~~   61 (290)
                      ++|.|.|- |-||+.+++.++. |.+|++.++..-+     ......+++++++.  |+|+.+...+
T Consensus        37 k~vgIiG~-G~IG~~va~~l~~fg~~V~~~d~~~~~~~~~~~~~~~~l~~ll~~s--Dii~~~~plt  100 (176)
T pfam02826        37 KTVGIIGL-GRIGRAVARRLKAFGMKVIAYDRYPKAEAEALGARYVSLDELLAES--DVVSLHLPLT  100 (176)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHHCCCEEEECCCCCCHHHHCCEEECCHHHHHHHC--CEEEECCCCC
T ss_conf             99999896-9999999999998398125437987610231571666899998629--9887547674


No 363
>PRK08306 dipicolinate synthase subunit A; Reviewed
Probab=94.27  E-value=0.17  Score=27.66  Aligned_cols=59  Identities=25%  Similarity=0.265  Sum_probs=37.2

Q ss_pred             CEEEEECCCCHHHHHHHHHH-HCCCEEEEECHHHCC-----CCCHHHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             94999978897889999999-649859996136708-----789999999997559989997863445
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDID-----LLKPKDFASFFLSFSPDVIINPAAYTA   62 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~~D-----~~~~~~~~~~l~~~~pd~Vih~Aa~~~   62 (290)
                      |+|.|.||. .=--++++.| ..|++|..+.-++.+     ....+..++.++..  |+||-..-.++
T Consensus         3 ~~iaviGGD-~Rq~~l~~~L~~~g~~V~~~gf~~~~~~~~~~~~~~~~~~~~~~~--d~iIlPvpg~~   67 (296)
T PRK08306          3 MHIAVIGGD-ARQLELIRKLVELGAKVSLVGFDQLDHGFTGVAKCSSLEEALSDV--DVIILPVPGTN   67 (296)
T ss_pred             CEEEEECCC-HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCEEEECCHHHHHHCC--CEEEECCCCCC
T ss_conf             489997875-899999999997799799983576555667617734678887239--99997883225


No 364
>PTZ00325 malate dehydrogenase; Provisional
Probab=94.19  E-value=0.032  Score=31.71  Aligned_cols=94  Identities=20%  Similarity=0.123  Sum_probs=55.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CC--EEEEECHHH-----CCCCCH-----------HHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             499997889788999999964-98--599961367-----087899-----------99999997559989997863445
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DV--EIIRVGRPD-----IDLLKP-----------KDFASFFLSFSPDVIINPAAYTA   62 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~--~v~~~~r~~-----~D~~~~-----------~~~~~~l~~~~pd~Vih~Aa~~~   62 (290)
                      ||-|+|++|.+|+.++-.|.. +.  +++-+|.++     +|+.+.           ....+.++.  .|+||-+|+...
T Consensus         3 KV~IIGA~G~VG~s~A~~l~~~~~~~elvL~Di~~a~g~a~Dl~~~~~~~~~~~~~~~~~~e~~~~--aDIVVitaG~~r   80 (313)
T PTZ00325          3 KVAVLGAAGGIGQPLSLLLKRNPYVSTLSLYDIVGAPGVAADLSHIPSPAKVTGYAKGELHKAVDG--ADVVLIVAGVPR   80 (313)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHCCCCCCCCCEECCCCHHHHHCC--CCEEEECCCCCC
T ss_conf             899989998699999999983899777999808972668988867555356654527988898489--989998889889


Q ss_pred             CCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC--CCCCC
Q ss_conf             43223322102420122211000112233333--34455
Q gi|254780921|r   63 VDKAEDEPEIAFSINAEGAGAIAKAADSIGIP--CIYIS   99 (290)
Q Consensus        63 ~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~--~I~iS   99 (290)
                      ...  .....-++.|+.-...+++...+.+.+  +|-+|
T Consensus        81 kpg--~tR~dLl~~N~~I~~~i~~~i~~~~~~aiiivvt  117 (313)
T PTZ00325         81 KPG--MTRDDLFNTNAGIVRDLVLACASSAPKAIFGIIT  117 (313)
T ss_pred             CCC--CCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECC
T ss_conf             978--9689999970699999999999769980999736


No 365
>PRK07411 hypothetical protein; Validated
Probab=94.17  E-value=0.095  Score=29.08  Aligned_cols=96  Identities=17%  Similarity=0.188  Sum_probs=55.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CC-EEEEECHHH--------------CCC--CCHHHHHHHHHHCCCCEEEECCC--CC
Q ss_conf             499997889788999999964-98-599961367--------------087--89999999997559989997863--44
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DV-EIIRVGRPD--------------IDL--LKPKDFASFFLSFSPDVIINPAA--YT   61 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~-~v~~~~r~~--------------~D~--~~~~~~~~~l~~~~pd~Vih~Aa--~~   61 (290)
                      ||||.|+ |=+|+.+..+|.. |. ++..+|...              .|+  .+.+..++.+.+..|++-|....  ++
T Consensus        40 ~VlvvG~-GGLG~p~~~yLaaaGvG~i~ivD~D~ve~sNL~RQ~l~~~~~vG~~K~~~a~~~l~~lnp~~~i~~~~~~l~  118 (390)
T PRK07411         40 SVLCIGT-GGLGSPLLLYLAAAGIGRIGIVDFDIVDSSNLQRQVIHGTSWVGKPKIESAKNRILEINPYCQVDLYETRLS  118 (390)
T ss_pred             CEEEECC-CHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCHHCCCCCHHHHHHHHHHHHCCCCCCEEHHHHCC
T ss_conf             7899888-723799999999838975999748994623478543666200797189999999998689864210343255


Q ss_pred             CCCCCCCCCCEEEEECCCCCCC------CCCCCCCCCCCCCCCCC
Q ss_conf             5432233221024201222110------00112233333344553
Q gi|254780921|r   62 AVDKAEDEPEIAFSINAEGAGA------IAKAADSIGIPCIYIST  100 (290)
Q Consensus        62 ~~~~~e~~~~~~~~~Nv~~~~~------l~~~~~~~~~~~I~iSS  100 (290)
                      . +-+ .+....+.+=+.+|-|      +-++|...++++|+-|-
T Consensus       119 ~-~na-~~li~~~DvvvD~tDNf~tRylindac~~~~~PlV~ga~  161 (390)
T PRK07411        119 S-ENA-LDILAPYDVVVDGTDNFPTRYLVNDACVLLNKPNVYGSI  161 (390)
T ss_pred             H-HHH-HHHHCCCCEEEECCCCHHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             5-248-874228868996788889999989999996998799764


No 366
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]
Probab=94.04  E-value=0.34  Score=25.97  Aligned_cols=48  Identities=17%  Similarity=0.341  Sum_probs=28.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CCEEEEECHHHCCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             499997889788999999964-9859996136708789999999997559989997
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN   56 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~~~D~~~~~~~~~~l~~~~pd~Vih   56 (290)
                      +|||+||+|-+|+..+.+++. |..++.+...      .+..+ ++++.-.|.+|+
T Consensus       145 ~VLv~gaaGgVG~~aiQlAk~~G~~~v~~~~s------~~k~~-~~~~lGAd~vi~  193 (326)
T COG0604         145 TVLVHGAAGGVGSAAIQLAKALGATVVAVVSS------SEKLE-LLKELGADHVIN  193 (326)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECC------HHHHH-HHHHCCCCEEEE
T ss_conf             79997785469999999999849958999817------57889-998739988970


No 367
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated
Probab=93.94  E-value=0.12  Score=28.51  Aligned_cols=97  Identities=19%  Similarity=0.248  Sum_probs=53.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CC-EEEEECHHHC--------------CC--CCHHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             499997889788999999964-98-5999613670--------------87--899999999975599899978634454
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DV-EIIRVGRPDI--------------DL--LKPKDFASFFLSFSPDVIINPAAYTAV   63 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~-~v~~~~r~~~--------------D~--~~~~~~~~~l~~~~pd~Vih~Aa~~~~   63 (290)
                      ||||.|+ |=+|+.+..+|.+ |. ++..+|....              |+  .+.+..++.+....|++-|..-... +
T Consensus        44 ~VlvvG~-GGLG~~~~~yLaaaGvG~i~ivD~D~v~~sNL~RQil~~~~dvG~~K~~~a~~~l~~~Np~v~v~~~~~~-l  121 (392)
T PRK07878         44 RVLVIGA-GGLGSPTLLYLAAAGVGTIGIVEFDVVDESNLQRQIIHGQSDVGRSKAQSARDSIVEINPLVNVRLHEFR-L  121 (392)
T ss_pred             CEEEECC-CHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCHHHCCCCHHHHHHHHHHHHCCCCCCEEHHHC-C
T ss_conf             7899878-7578999999998289759998789967455772005684335870799999999987898531211313-7


Q ss_pred             CCCC-CCCCEEEEECCCCCCC------CCCCCCCCCCCCCCCCC
Q ss_conf             3223-3221024201222110------00112233333344553
Q gi|254780921|r   64 DKAE-DEPEIAFSINAEGAGA------IAKAADSIGIPCIYIST  100 (290)
Q Consensus        64 ~~~e-~~~~~~~~~Nv~~~~~------l~~~~~~~~~~~I~iSS  100 (290)
                      +... .+....+.+=+.+|.|      +-++|...++++|+-|-
T Consensus       122 ~~~n~~~li~~~DvViD~tDN~~tR~lindac~~~~~PlV~ga~  165 (392)
T PRK07878        122 EPSNAVDLFAQYDLILDGTDNFATRYLVNDAAVLAGKPYVWGSI  165 (392)
T ss_pred             CHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             88898764317768986689989999999999996998799760


No 368
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like. E1, a highly conserved small protein present universally in eukaryotic cells, is part of cascade to attach ubiquitin (Ub) covalently to substrate proteins. This cascade consists of activating (E1), conjugating (E2), and/or ligating (E3) enzymes and then targets them for degradation by the 26S proteasome. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and ubiquitin's C-terminus. The E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. A set of novel molecules with a structural similarity to Ub, called Ub-like proteins (Ubls), have similar conjugation cascades. In contrast to ubiquitin-E1, which is a single-chain protein with a weakly conserved two-fold repeat, many of the Ubls-E1are a heterodimer where each subunit corresponds to one half of a single-chain E1. This CD represents the family homol
Probab=93.91  E-value=0.12  Score=28.58  Aligned_cols=102  Identities=18%  Similarity=0.216  Sum_probs=53.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CC-EEEEECHH----------------HCCCC--CHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             499997889788999999964-98-59996136----------------70878--999999999755998999786344
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DV-EIIRVGRP----------------DIDLL--KPKDFASFFLSFSPDVIINPAAYT   61 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~-~v~~~~r~----------------~~D~~--~~~~~~~~l~~~~pd~Vih~Aa~~   61 (290)
                      ||||.|+ |=+|+++++.|.. |. ++..+|..                +.|+-  +.+...+.+++..|++-|+.....
T Consensus        21 ~VlVvG~-GGLG~~v~~~La~aGVg~i~ivD~D~Ve~sNL~RQ~l~~~~~~diG~~Ka~~a~~~l~~lNp~v~i~~~~~~   99 (198)
T cd01485          21 KVLIIGA-GALGAEIAKNLVLAGIDSITIVDHRLVSTEDLGSNFFLDAEVSNSGMNRAAASYEFLQELNPNVKLSIVEED   99 (198)
T ss_pred             CEEEECC-CHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             8999877-889999999999749986999959963533577575026541116872999999999977999779998224


Q ss_pred             ---CCCCCC---CCCCEEE--EECCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             ---543223---3221024--201222110001122333333445532111
Q gi|254780921|r   62 ---AVDKAE---DEPEIAF--SINAEGAGAIAKAADSIGIPCIYISTDYVF  104 (290)
Q Consensus        62 ---~~~~~e---~~~~~~~--~~Nv~~~~~l~~~~~~~~~~~I~iSS~~Vy  104 (290)
                         ..+..+   ++.+...  .-|...-..+-++|.+.++++|+-+....+
T Consensus       100 ~~~~~~n~~~~~~~~DlVvd~~dn~~~r~~in~~c~~~~iPlI~ga~~G~~  150 (198)
T cd01485         100 SLSNDSNIEEYLQKFTLVIATEENYERTAKVNDVCRKHHIPFISCATYGLI  150 (198)
T ss_pred             CCCCHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHCCCEEEEECCCCE
T ss_conf             457786899998489999999999999999999999929988999745668


No 369
>PRK00885 phosphoribosylamine--glycine ligase; Provisional
Probab=93.88  E-value=0.4  Score=25.52  Aligned_cols=55  Identities=24%  Similarity=0.273  Sum_probs=40.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHCC---CEEEEECHH----------HCCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             94999978897889999999649---859996136----------708789999999997559989997
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQD---VEIIRVGRP----------DIDLLKPKDFASFFLSFSPDVIIN   56 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~~---~~v~~~~r~----------~~D~~~~~~~~~~l~~~~pd~Vih   56 (290)
                      |||||.|+ |==-.+|+..|.+.   .++++..-+          ..+.+|.+.+.++..+.++|.||-
T Consensus         1 MkVLviGs-GgREHAia~kl~~s~~v~~v~~~PGN~G~~~~~~~~~i~~~d~~~l~~~a~~~~idlvii   68 (424)
T PRK00885          1 MKVLVIGS-GGREHALAWKLAQSPLVEKVYVAPGNAGTALEAENVAIDVTDIEALVAFAKEEGIDLTVV   68 (424)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEECCCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             97999888-889999999997397989899928975887417365128579999999999849999998


No 370
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated
Probab=93.87  E-value=0.11  Score=28.82  Aligned_cols=96  Identities=21%  Similarity=0.284  Sum_probs=54.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CC-EEEEECHHHC--------------CC--CCHHHHHHHHHHCCCCEEEECCCCCCC
Q ss_conf             499997889788999999964-98-5999613670--------------87--899999999975599899978634454
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DV-EIIRVGRPDI--------------DL--LKPKDFASFFLSFSPDVIINPAAYTAV   63 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~-~v~~~~r~~~--------------D~--~~~~~~~~~l~~~~pd~Vih~Aa~~~~   63 (290)
                      ||||.|+ |=||+.+..+|.. |. ++...|....              |+  .+.+...+.+.+..|++-|..--.. .
T Consensus        30 ~VlvvG~-GGLG~~~~~yLa~aGvG~i~i~D~D~ve~sNL~RQ~l~~~~~iG~~K~~~a~~~l~~~np~i~i~~~~~~-l  107 (355)
T PRK05597         30 KVSVIGA-GGLGSPALLYLAGAGVGHITIIDDDVVDLSNLHRQVIHTTAGVGTPKAESAREAMLALNPDVKVTVSVRR-L  107 (355)
T ss_pred             CEEEECC-CHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEHHH-C
T ss_conf             6899877-7668999999998499759997299926121337756541217979799999999987899742753321-5


Q ss_pred             CCCC-CCCCEEEEECCCCCCC------CCCCCCCCCCCCCCCC
Q ss_conf             3223-3221024201222110------0011223333334455
Q gi|254780921|r   64 DKAE-DEPEIAFSINAEGAGA------IAKAADSIGIPCIYIS   99 (290)
Q Consensus        64 ~~~e-~~~~~~~~~Nv~~~~~------l~~~~~~~~~~~I~iS   99 (290)
                      +... .+....+.+=+.+|-|      +-++|...+.++|+-|
T Consensus       108 ~~~na~~li~~~DvVvD~tDn~~tR~lind~c~~~~~PlV~ga  150 (355)
T PRK05597        108 DWSNALSELADADVILDGSDNFDTRHVASWAAARLGIPHVWAS  150 (355)
T ss_pred             CHHHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             7778997752887898767888899999999998699879965


No 371
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of  a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1).
Probab=93.82  E-value=0.17  Score=27.62  Aligned_cols=31  Identities=19%  Similarity=0.323  Sum_probs=22.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-CC-EEEEECHH
Q ss_conf             9499997889788999999964-98-59996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-DV-EIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~~-~v~~~~r~   32 (290)
                      .||||.|+ |=+|++++..|.. |. ++..+|..
T Consensus        22 s~VlivG~-GGlGs~~~~~La~~Gvg~i~lvD~D   54 (228)
T cd00757          22 ARVLVVGA-GGLGSPAAEYLAAAGVGKLGLVDDD   54 (228)
T ss_pred             CCEEEECC-CHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             97899887-7889999999998399758999787


No 372
>KOG1494 consensus
Probab=93.77  E-value=0.047  Score=30.80  Aligned_cols=121  Identities=23%  Similarity=0.270  Sum_probs=73.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEEC-------------HHH-------CCCCCHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             49999788978899999996498599961-------------367-------0878999999999755998999786344
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQDVEIIRVG-------------RPD-------IDLLKPKDFASFFLSFSPDVIINPAAYT   61 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~~~~v~~~~-------------r~~-------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~   61 (290)
                      ||-|+|++|=||+.|.-+|+....|.-+.             -..       ..++-.+++++.++..  |+||-.|+..
T Consensus        30 KVAvlGAaGGIGQPLSLLlK~np~Vs~LaLYDi~~~~GVaaDlSHI~T~s~V~g~~g~~~L~~al~~a--dvVvIPAGVP  107 (345)
T KOG1494          30 KVAVLGAAGGIGQPLSLLLKLNPLVSELALYDIANTPGVAADLSHINTNSSVVGFTGADGLENALKGA--DVVVIPAGVP  107 (345)
T ss_pred             EEEEEECCCCCCCCHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCEECCCCHHHHHHHHCCC--CEEEECCCCC
T ss_conf             49997348766756899974285523013332036986202200167887131267836789875389--7899638998


Q ss_pred             CCCCCCCCCCEEEEECCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCC-C----CCCCCCCCCCHHHHHH
Q ss_conf             5432233221024201222110001122333--333445532111357554421-1----1122221110124566
Q gi|254780921|r   62 AVDKAEDEPEIAFSINAEGAGAIAKAADSIG--IPCIYISTDYVFDGLSRTPID-E----FSPTNPLNIYGKSKLA  130 (290)
Q Consensus        62 ~~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~--~~~I~iSS~~Vy~g~~~~p~~-E----~d~~~P~~~Yg~sK~~  130 (290)
                      +...  -..+--|++|..-...|+.++.++.  +.+..||- -|-   +..|+. |    .-..+|...+|.|.+.
T Consensus       108 RKPG--MTRDDLFn~NAgIv~~l~~aia~~cP~A~i~vIsN-PVN---stVPIaaevlKk~G~ydpkklfGVTtLD  177 (345)
T KOG1494         108 RKPG--MTRDDLFNINAGIVKTLAAAIAKCCPNALILVISN-PVN---STVPIAAEVLKKAGVYDPKKLFGVTTLD  177 (345)
T ss_pred             CCCC--CCHHHHHHCCHHHHHHHHHHHHHHCCCCEEEEECC-CCC---CCCHHHHHHHHHCCCCCCCCEECEEHHH
T ss_conf             9999--85777664144799999999986596121676607-633---4205899999973878865230300212


No 373
>PRK08040 putative semialdehyde dehydrogenase; Provisional
Probab=93.68  E-value=0.1  Score=28.84  Aligned_cols=29  Identities=17%  Similarity=0.340  Sum_probs=22.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHCC----CEEEEEC
Q ss_conf             4999978897889999999649----8599961
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQD----VEIIRVG   30 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~~----~~v~~~~   30 (290)
                      +|-|.|+||.+|+.+.++|.+.    .++..+.
T Consensus         6 ~VaivGATG~VGq~~l~lL~e~~fp~~~l~~la   38 (337)
T PRK08040          6 NIALLGATGAVGEALLETLAERQFPVGEIYALA   38 (337)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             799988850889999999971799813599998


No 374
>PRK05708 2-dehydropantoate 2-reductase; Provisional
Probab=93.61  E-value=0.1  Score=28.84  Aligned_cols=31  Identities=13%  Similarity=0.235  Sum_probs=27.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHH-CCCEEEEECHH
Q ss_conf             949999788978899999996-49859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~   32 (290)
                      |||.|.|+ |-||+.+.-.|. .|++|..+.|.
T Consensus         3 MkI~IiGa-GAiG~~~a~~L~~ag~dV~lv~r~   34 (305)
T PRK05708          3 MTWHILGA-GSLGSLWACRLARAGLPVRLILRD   34 (305)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             88999882-399999999998489973999947


No 375
>PRK05600 thiamine biosynthesis protein ThiF; Validated
Probab=93.57  E-value=0.12  Score=28.50  Aligned_cols=96  Identities=22%  Similarity=0.303  Sum_probs=54.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CC-EEEEECHHHC--------------CCC--CHHHHHHHHHHCCCCEEEECCCCC-C
Q ss_conf             499997889788999999964-98-5999613670--------------878--999999999755998999786344-5
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DV-EIIRVGRPDI--------------DLL--KPKDFASFFLSFSPDVIINPAAYT-A   62 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~-~v~~~~r~~~--------------D~~--~~~~~~~~l~~~~pd~Vih~Aa~~-~   62 (290)
                      ||||.|+ |=+|+.+..+|.+ |. ++..+|....              |+-  +.+..++.+.+..|++-|..-... +
T Consensus        43 ~VlvvG~-GGLG~p~~~yLaaaGvG~i~ivD~D~Ve~sNL~RQil~~~~diG~~K~~~A~~~l~~lNp~i~i~~~~~~l~  121 (370)
T PRK05600         43 RVLVIGA-GGLGCPAMQSLASAGVGTITLIDDDTVDVSNIHRQILFGASDVGRPKVEVAAERLKEIQPDIRVNALRERLT  121 (370)
T ss_pred             CEEEECC-CHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHCCCHHHCCCCHHHHHHHHHHHHCCCCCEEEHHHHCC
T ss_conf             7899888-757899999999828974898738982602105554269766697579999999998789971573566469


Q ss_pred             CCCCCCCCCEEEEECCCCCCC------CCCCCCCCCCCCCCCC
Q ss_conf             432233221024201222110------0011223333334455
Q gi|254780921|r   63 VDKAEDEPEIAFSINAEGAGA------IAKAADSIGIPCIYIS   99 (290)
Q Consensus        63 ~~~~e~~~~~~~~~Nv~~~~~------l~~~~~~~~~~~I~iS   99 (290)
                      .+-. .+....+.+=+.+|-|      +-++|...+.++||-|
T Consensus       122 ~~n~-~~li~~~DvVvD~tDNf~tRylindaC~~~~~PlV~ga  163 (370)
T PRK05600        122 AENA-VELLNGVDLVLDGSDSFATKFLVADAAEITGTPLVWGT  163 (370)
T ss_pred             HHHH-HHHHHCCCEEEECCCCHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             9999-98763687899778887999999999998499769845


No 376
>PRK07574 formate dehydrogenase; Provisional
Probab=93.56  E-value=0.23  Score=26.91  Aligned_cols=76  Identities=18%  Similarity=0.271  Sum_probs=35.1

Q ss_pred             HHHH-HCCCEEEEECHHHCCCCCHHHHHHHHHHCCCCEEEE----CCCCCCCCCCCCCCCEEE-EECCCCCCCC-CCCCC
Q ss_conf             9999-649859996136708789999999997559989997----863445432233221024-2012221100-01122
Q gi|254780921|r   17 SSMC-VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN----PAAYTAVDKAEDEPEIAF-SINAEGAGAI-AKAAD   89 (290)
Q Consensus        17 ~~~l-~~~~~v~~~~r~~~D~~~~~~~~~~l~~~~pd~Vih----~Aa~~~~~~~e~~~~~~~-~~Nv~~~~~l-~~~~~   89 (290)
                      -++| .+||+.+.++-++..  + ..+++-+.+.  |+||-    .|-.| -+.-|+-|.+=. ..--.|+-|+ +++|.
T Consensus        61 r~~le~~gh~~v~t~dk~g~--~-~~~~~~l~da--~ivis~pf~p~ylT-~E~IekApnLKli~tAGVG~DnIDL~AA~  134 (385)
T PRK07574         61 RTFLEERGHELVVTSDKDGP--D-SVFERELPDA--DVVISQPFWPAYLT-AERIAKAPNLKLAITAGIGSDHVDLQAAS  134 (385)
T ss_pred             HHHHHHCCCEEEEECCCCCC--C-CHHHHHCCCC--EEEECCCCCCCCCC-HHHHHCCCCCEEEEEEEECCCHHHHHHHH
T ss_conf             88898559169996588898--5-0677515776--39974588732114-99994388673999942047245499899


Q ss_pred             CCCCCCCCC
Q ss_conf             333333445
Q gi|254780921|r   90 SIGIPCIYI   98 (290)
Q Consensus        90 ~~~~~~I~i   98 (290)
                      ++|+.+...
T Consensus       135 erGI~V~nv  143 (385)
T PRK07574        135 EHNITVAEV  143 (385)
T ss_pred             HCCCEEEEC
T ss_conf             789999959


No 377
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms]
Probab=93.45  E-value=0.32  Score=26.09  Aligned_cols=80  Identities=20%  Similarity=0.332  Sum_probs=54.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC--CCEEEEECHHHCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCEEEEECC
Q ss_conf             9499997889788999999964--98599961367087899999999975599899978634454322332210242012
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINA   78 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~--~~~v~~~~r~~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~~e~~~~~~~~~Nv   78 (290)
                      |||||..-++++=..+.+.|..  ..+++++.+      |.....+.+.+.+||+|.--...               -+.
T Consensus         2 irVlvVddsal~R~~i~~~l~~~~~i~vv~~a~------ng~~a~~~~~~~~PDVi~ld~em---------------p~m   60 (350)
T COG2201           2 IRVLVVDDSALMRKVISDILNSDPDIEVVGTAR------NGREAIDKVKKLKPDVITLDVEM---------------PVM   60 (350)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEEECC------CHHHHHHHHHHCCCCEEEEECCC---------------CCC
T ss_conf             479998581999999999983089737997337------87999999972299789972566---------------445


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22110001122333333445532
Q gi|254780921|r   79 EGAGAIAKAADSIGIPCIYISTD  101 (290)
Q Consensus        79 ~~~~~l~~~~~~~~~~~I~iSS~  101 (290)
                      .|...|-+..+....++|.+||.
T Consensus        61 dgl~~l~~im~~~p~pVimvssl   83 (350)
T COG2201          61 DGLEALRKIMRLRPLPVIMVSSL   83 (350)
T ss_pred             CHHHHHHHHHCCCCCCEEEEECC
T ss_conf             47999999844799868999514


No 378
>pfam01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus. NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate. This family represents the N-terminal NAD-binding domain.
Probab=93.41  E-value=0.18  Score=27.49  Aligned_cols=31  Identities=26%  Similarity=0.364  Sum_probs=26.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-CCEEEEECHH
Q ss_conf             9499997889788999999964-9859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~~~v~~~~r~   32 (290)
                      |||.|.|+ |--|++|+..|.+ +++|....|+
T Consensus         1 kKI~IiGa-G~wGtAla~~la~n~~~V~l~~r~   32 (159)
T pfam01210         1 KKIAVLGA-GSWGTALAKVLARNGHEVRLWGRD   32 (159)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEEEC
T ss_conf             98999996-999999999999879989999904


No 379
>COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism]
Probab=93.38  E-value=0.32  Score=26.06  Aligned_cols=30  Identities=17%  Similarity=0.370  Sum_probs=22.8

Q ss_pred             CEEEEECCCCHHHHHHHHHH---HCCCEEEEEC
Q ss_conf             94999978897889999999---6498599961
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMC---VQDVEIIRVG   30 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l---~~~~~v~~~~   30 (290)
                      +|+.|+|+||-||..--+..   ...++++++.
T Consensus         2 k~i~iLGSTGSIG~qtLdVi~~~p~~f~vval~   34 (385)
T COG0743           2 KKLTILGSTGSIGTQTLDVIRRNPDKFEVVALA   34 (385)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             459997168734288999999689857999973


No 380
>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This family contains both shikimate and quinate dehydrogenases. Shikimate 5-dehydrogenase catalyses the conversion of shikimate to 5-dehydroshikimate. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids. Quinate 5-dehydrogenase catalyses the conversion of quinate to 5-dehydroquinate. This reaction is part of the quinate pathway where quinic acid is exploited as a source of carbon in prokaryotes and microbial eukaryotes. Both the shikimate and quinate pathways share two common pathway metabolites 3-dehydroquinate and dehydroshikimate.
Probab=93.28  E-value=0.27  Score=26.51  Aligned_cols=56  Identities=20%  Similarity=0.364  Sum_probs=35.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC-CC-EEEEECHHH---------C-----CCCCHHHHHHHHHHCCCCEEEECCC
Q ss_conf             9499997889788999999964-98-599961367---------0-----8789999999997559989997863
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ-DV-EIIRVGRPD---------I-----DLLKPKDFASFFLSFSPDVIINPAA   59 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~-~~-~v~~~~r~~---------~-----D~~~~~~~~~~l~~~~pd~Vih~Aa   59 (290)
                      .|+||.|+ |-+|+.+++.|.+ +. +++.+.|..         +     ...+.+.+.+.+.+.  |+||.|.+
T Consensus        13 ~~vlVIGa-G~~~~~~~~~L~~~g~~~i~v~nRt~~ka~~la~~~~~~~~~~~~~~~l~~~l~~~--DivI~aT~   84 (134)
T pfam01488        13 KKVLLIGA-GEMARLAAKHLLSKGAKKITIANRTLEKAKELAEEFGGEEVEALPLDELEELLAEA--DIVISATS   84 (134)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCEEEEECHHHHHHHHHC--CEEEEECC
T ss_conf             98999996-09999999999975998899954757899999998499725898513544136319--99999259


No 381
>COG0623 FabI Enoyl-[acyl-carrier-protein]
Probab=93.27  E-value=0.29  Score=26.31  Aligned_cols=63  Identities=16%  Similarity=0.296  Sum_probs=46.4

Q ss_pred             EEEEECCCC--HHHHHHHHHHH-CCCEEEEECHH--------------------HCCCCCHHHHHHHHHHC-----CCCE
Q ss_conf             499997889--78899999996-49859996136--------------------70878999999999755-----9989
Q gi|254780921|r    2 KCLVIGNNG--QIAQSLSSMCV-QDVEIIRVGRP--------------------DIDLLKPKDFASFFLSF-----SPDV   53 (290)
Q Consensus         2 kiLVtG~~G--~iG~~l~~~l~-~~~~v~~~~r~--------------------~~D~~~~~~~~~~l~~~-----~pd~   53 (290)
                      |+||+|-..  -|+-.+++.|. +|-+...+...                    ++|.++.+.++++|.+.     +.|.
T Consensus         8 ~~lI~Gvan~rSIAwGIAk~l~~~GAeL~fTy~~e~l~krv~~la~~~~s~~v~~cDV~~d~~i~~~f~~i~~~~g~lD~   87 (259)
T COG0623           8 RILIMGVANNRSIAWGIAKALAEQGAELAFTYQGERLEKRVEELAEELGSDLVLPCDVTNDESIDALFATIKKKWGKLDG   87 (259)
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCE
T ss_conf             58999732662179999999997598799984358889999998764167769966778768999999999876076647


Q ss_pred             EEECCCCCCCC
Q ss_conf             99786344543
Q gi|254780921|r   54 IINPAAYTAVD   64 (290)
Q Consensus        54 Vih~Aa~~~~~   64 (290)
                      +||+.|+++-+
T Consensus        88 lVHsIaFa~k~   98 (259)
T COG0623          88 LVHSIAFAPKE   98 (259)
T ss_pred             EEEEECCCCHH
T ss_conf             99873148867


No 382
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism]
Probab=93.26  E-value=0.18  Score=27.46  Aligned_cols=78  Identities=22%  Similarity=0.362  Sum_probs=44.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHC--CCEEEE-ECHHHCCC--CCHHHH------------HHHHHHCCCCEEEECCCCCCC
Q ss_conf             9499997889788999999964--985999-61367087--899999------------999975599899978634454
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCVQ--DVEIIR-VGRPDIDL--LKPKDF------------ASFFLSFSPDVIINPAAYTAV   63 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~~--~~~v~~-~~r~~~D~--~~~~~~------------~~~l~~~~pd~Vih~Aa~~~~   63 (290)
                      |||.|.|++|-.|+.+++...+  +.++.+ ++|+....  .|...+            ...+...++|++|.+-     
T Consensus         3 iki~V~Ga~GRMG~~ii~~v~~~~~~~L~aa~~~~~~~~~g~d~ge~~g~~~~gv~v~~~~~~~~~~~DV~IDFT-----   77 (266)
T COG0289           3 IKVAVAGASGRMGRTLIRAVLEAPDLELVAAFDRPGSLSLGSDAGELAGLGLLGVPVTDDLLLVKADADVLIDFT-----   77 (266)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCHHHHCCCCCCCCEEECCHHHCCCCCCEEEECC-----
T ss_conf             369997578727899999985289946999981378422343112321446557332063433046898899899-----


Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             322332210242012221100011223333334
Q gi|254780921|r   64 DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCI   96 (290)
Q Consensus        64 ~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~~~I   96 (290)
                           .|        +++..+++.|.++++++|
T Consensus        78 -----~P--------~~~~~~l~~~~~~~~~lV   97 (266)
T COG0289          78 -----TP--------EATLENLEFALEHGKPLV   97 (266)
T ss_pred             -----CC--------HHHHHHHHHHHHCCCCEE
T ss_conf             -----82--------546999999997699869


No 383
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins. This family includes classical ubiquitin-activating enzymes E1, ubiquitin-like (ubl) activating enzymes and other mechanistic homologes, like MoeB, Thif1 and others. The common reaction mechanism catalyzed by MoeB, ThiF and the E1 enzymes begins with a nucleophilic attack of the C-terminal carboxylate of MoaD, ThiS and ubiquitin, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS.
Probab=93.24  E-value=0.18  Score=27.47  Aligned_cols=99  Identities=19%  Similarity=0.244  Sum_probs=50.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHC-CC-EEEEECHHH----------------CCCCCHHHHHHHHHHCCCCEEEECCCCCC-
Q ss_conf             499997889788999999964-98-599961367----------------08789999999997559989997863445-
Q gi|254780921|r    2 KCLVIGNNGQIAQSLSSMCVQ-DV-EIIRVGRPD----------------IDLLKPKDFASFFLSFSPDVIINPAAYTA-   62 (290)
Q Consensus         2 kiLVtG~~G~iG~~l~~~l~~-~~-~v~~~~r~~----------------~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~-   62 (290)
                      ||||.|+ |=+|+++++.|.. |. ++..+|...                .-..+.+...+.+.+..|++-|+.-...- 
T Consensus         1 kVlivG~-GglG~~va~~L~~~Gv~~i~ivD~D~v~~~Nl~Rq~~~~~~dvG~~Ka~~a~~~l~~~np~v~i~~~~~~~~   79 (143)
T cd01483           1 RVLLVGL-GGLGSEIALNLARSGVGKITLIDFDTVELSNLNRQFLARQADIGKPKAEVAARRLNELNPGVNVTAVPEGIS   79 (143)
T ss_pred             CEEEECC-CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             9999997-989999999999937971999978987500146422589889492248999999985689838999945689


Q ss_pred             CCCCC---CCCCEEE--EECCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             43223---3221024--201222110001122333333445532
Q gi|254780921|r   63 VDKAE---DEPEIAF--SINAEGAGAIAKAADSIGIPCIYISTD  101 (290)
Q Consensus        63 ~~~~e---~~~~~~~--