HHsearch alignment for GI: 254780921 and conserved domain: pfam01073

>pfam01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family. The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones.
Probab=100.00  E-value=1.2e-43  Score=264.96  Aligned_cols=227  Identities=21%  Similarity=0.237  Sum_probs=178.3

Q ss_pred             EEECCCCHHHHHHHHHH-HCCC--EEEEECHH------------------HCCCCCHHHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             99978897889999999-6498--59996136------------------708789999999997559989997863445
Q gi|254780921|r    4 LVIGNNGQIAQSLSSMC-VQDV--EIIRVGRP------------------DIDLLKPKDFASFFLSFSPDVIINPAAYTA   62 (290)
Q Consensus         4 LVtG~~G~iG~~l~~~l-~~~~--~v~~~~r~------------------~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~   62 (290)
T Consensus         1 LVTGg~GFIGs~lv~~Ll~~g~~~~V~~~d~~~~~~~~~~~~~~~~~~~v~gDl~d~~~l~~~~~~~--D~V~H~Aa~~~   78 (280)
T pfam01073         1 LVTGGGGFLGRHIVRLLLREGELQEVRVFDLRFSPELLEDFSKLQVITYIEGDVTDKQDLRRALQGS--DVVIHTAAIID   78 (280)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCC--CEEEEECCCCC
T ss_conf             9058675999999999997799757999878898678887322588759991289999999998479--98997212235


Q ss_pred             CCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCC-CCCCC---CCCCC--CCCCCCCHHHHHHHHHHH
Q ss_conf             4322332210242012221100011223333-33445532111357-55442---11112--222111012456666531
Q gi|254780921|r   63 VDKAEDEPEIAFSINAEGAGAIAKAADSIGI-PCIYISTDYVFDGL-SRTPI---DEFSP--TNPLNIYGKSKLAGEEKV  135 (290)
Q Consensus        63 ~~~~e~~~~~~~~~Nv~~~~~l~~~~~~~~~-~~I~iSS~~Vy~g~-~~~p~---~E~d~--~~P~~~Yg~sK~~~E~~v  135 (290)
T Consensus        79 ~~-~~~~~~~~~~~Nv~gt~~ll~aa~~~gvkr~V~~SS~~v~g~~~~~~~~~~~~e~~p~~~~~~~~Y~~SK~~aE~~v  157 (280)
T pfam01073        79 VF-GKAYRDTIMKVNVKGTQNVLDACVKAGVRVLVYTSSMEVVGPNSYGQPIVNGDETTPYESTHQDPYPESKALAEKLV  157 (280)
T ss_pred             CC-CCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             55-66799999999999999999999964777079970047876777788756788888788888980288999999999


Q ss_pred             CCCCC---------CCCCCCCCCCEECCCCCCCCEEECCCCCCCCEEECCC--CCCCCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             01222---------3223555420003686320002011246652153045--545445223689999999984420244
Q gi|254780921|r  136 ASYTN---------NYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD--QFGTPTSALQIARAIIQIAHNLIENSD  204 (290)
Q Consensus       136 ~~~~~---------~~~IlR~~~vyG~~~~~~v~~~l~~~~~~~~i~~~~d--~~~~p~~v~D~a~~i~~~~~~~~~~~~  204 (290)
T Consensus       158 l~a~~~~~~~~~~~~~v~lRp~~vyGp~~~~~~~~~~~~~~~g~~~~~~g~g~~~~~~v~V~Dva~A~vlA~~~l~~~~~  237 (280)
T pfam01073       158 LKANGSTLKNGGRLYTCALRPAGIFGEGDPFLFPFLVRLLKNGLAKFRTGDKNVLSDRVYVGNVAWAHILAARALQDPKK  237 (280)
T ss_pred             HHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             98503344314553168854666538995159999999997599973679999888972787699999999986014566


Q ss_pred             -CCCC-CCEEEECCCCCCCHHHHHHHHHHHH
Q ss_conf             -3344-3137623866678899999999999
Q gi|254780921|r  205 -TSLR-GIFHMTADGGPVSWADFAEYIFWES  233 (290)
Q Consensus       205 -~~~~-Giyn~~~~~~~~s~~e~a~~I~~~~  233 (290)
T Consensus       238 ~~~~~Ge~y~i~~~~p~~s~~e~~~~~~~al  268 (280)
T pfam01073       238 ASSIAGQFYFISDDTPHNSYDDFNRTLLKAL  268 (280)
T ss_pred             CCCCCCCEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             7788974899779991677999999999980