HHsearch alignment for GI: 254780921 and conserved domain: pfam03721

>pfam03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain. The UDP-glucose/GDP-mannose dehydrogenaseses are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate.
Probab=95.51  E-value=0.022  Score=32.61  Aligned_cols=31  Identities=19%  Similarity=0.258  Sum_probs=27.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHH-CCCEEEEECHH
Q ss_conf             949999788978899999996-49859996136
Q gi|254780921|r    1 MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRP   32 (290)
Q Consensus         1 MkiLVtG~~G~iG~~l~~~l~-~~~~v~~~~r~   32 (290)
T Consensus         1 MkI~ViGl-GyVGl~~a~~la~~G~~V~g~D~d   32 (185)
T pfam03721         1 MRIAVIGL-GYVGLPTAVCLAEIGHDVVGVDIN   32 (185)
T ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             97999897-874899999999489939999799