HHsearch alignment for GI: 254780921 and conserved domain: pfam04321

>pfam04321 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.
Probab=100.00  E-value=0  Score=457.03  Aligned_cols=282  Identities=46%  Similarity=0.770  Sum_probs=262.7

Q ss_pred             EEEECCCCHHHHHHHHHH-HCCCEEEEECHHHCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCEEEEECCCCC
Q ss_conf             999978897889999999-6498599961367087899999999975599899978634454322332210242012221
Q gi|254780921|r    3 CLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGA   81 (290)
Q Consensus         3 iLVtG~~G~iG~~l~~~l-~~~~~v~~~~r~~~D~~~~~~~~~~l~~~~pd~Vih~Aa~~~~~~~e~~~~~~~~~Nv~~~   81 (290)
T Consensus         1 ILVtG~~GfiGs~l~~~L~~~g~~v~~~~r~~~D~~d~~~l~~~~~~~~pd~VihlAa~~~~~~~~~~~~~~~~~Nv~~t   80 (284)
T pfam04321         1 ILVTGANGQLGRELTRLLAERGVEVVALDRPELDLTDPEAVAALVREARPDVVVNAAAYTAVDKAESEPELAYAVNALGP   80 (284)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCHHHHHCHHHHHHHHHHHH
T ss_conf             69964899899999999986899899954862578899999999986499799972413555677748888998759999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCE
Q ss_conf             10001122333333445532111357554421111222211101245666653101222322355542000368632000
Q gi|254780921|r   82 GAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLS  161 (290)
Q Consensus        82 ~~l~~~~~~~~~~~I~iSS~~Vy~g~~~~p~~E~d~~~P~~~Yg~sK~~~E~~v~~~~~~~~IlR~~~vyG~~~~~~v~~  161 (290)
T Consensus        81 ~~l~~~~~~~~~~~i~~Ss~~Vy~g~~~~p~~E~~~~~P~~~Yg~sK~~~E~~~~~~~~~~~IlR~~~vyG~~~~~~~~~  160 (284)
T pfam04321        81 GNLAEACAARGAPLIHISTDYVFDGAKGGPYREDDPTGPLNVYGRTKLAGEQAVLAANPRHLILRTAWVYGEYGNNFVKT  160 (284)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHHH
T ss_conf             99999987449857984175300068998854577778988016575899999997253460787734428888788999


Q ss_pred             EECCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCH
Q ss_conf             20112466521530455454452236899999999844202443344313762386667889999999999997279800
Q gi|254780921|r  162 MLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS  241 (290)
Q Consensus       162 ~l~~~~~~~~i~~~~d~~~~p~~v~D~a~~i~~~~~~~~~~~~~~~~Giyn~~~~~~~~s~~e~a~~I~~~~~~~~~~~~  241 (290)
T Consensus       161 ~~~~~~~~~~i~i~~d~~~~~~~v~D~a~~~~~~~e~~~~~--~~~~giyNi~~~-~~~s~~ela~~i~~~---~g~~~~  234 (284)
T pfam04321       161 MLRLAAERDELRVVDDQLGSPTSARDLADALLALIRKRLRG--PALAGTYHLAGS-GETSWYDFARAIFDE---AGADGG  234 (284)
T ss_pred             HHHHHHCCCCCEEECCCCCCCEEHHHHHHHHHHHHHHCCCC--CCCCCCEEECCC-CCEEHHHHHHHHHHH---HCCCCC
T ss_conf             99998628982685375689698999999999999820337--777761374189-844099999999999---688877


Q ss_pred             HEEECCHHHHCCCCCCCCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             0576285880876899751100868999961789999899999999719
Q gi|254780921|r  242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI  290 (290)
Q Consensus       242 ~i~~~~~~~~~~~a~RP~~~~Ld~~K~~~~lg~~~~~~~e~i~~~i~~l  290 (290)
T Consensus       235 ~i~~v~~~~~~~~~~rP~~~~lD~sK~~~~lg~~p~~~~egl~~~l~~~  283 (284)
T pfam04321       235 RVRPIPTAEYPTPARRPANSVLDTSKLEATFGIPLPDWREALAEVLDEL  283 (284)
T ss_pred             CEEEEEHHHCCCCCCCCCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             4266118888878999760015599999976879998999999999996