BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780921|ref|YP_003065334.1| dTDP-4-dehydrorhamnose
reductase [Candidatus Liberibacter asiaticus str. psy62]
         (290 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780921|ref|YP_003065334.1| dTDP-4-dehydrorhamnose reductase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040598|gb|ACT57394.1| dTDP-4-dehydrorhamnose reductase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 290

 Score =  600 bits (1548), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 290/290 (100%), Positives = 290/290 (100%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY
Sbjct: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP
Sbjct: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG
Sbjct: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY
Sbjct: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI
Sbjct: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290


>gi|315122653|ref|YP_004063142.1| dTDP-4-dehydrorhamnose reductase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496055|gb|ADR52654.1| dTDP-4-dehydrorhamnose reductase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 289

 Score =  441 bits (1134), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 221/288 (76%), Positives = 246/288 (85%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LVIGNNGQ+A SL ++  ++ E+IR+GRPDIDLLKPKDF   FLSF+PDVIINPAAY
Sbjct: 1   MKFLVIGNNGQVATSLFNLSGKNTEVIRLGRPDIDLLKPKDFVKIFLSFAPDVIINPAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAEDEP  AF+IN EGAGA+A AA+SIG+PCI+ISTDYVFDG S+TP+ E SPTNP
Sbjct: 61  TAVDKAEDEPHNAFAINTEGAGAVAAAAESIGVPCIHISTDYVFDGSSQTPLCETSPTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L IYGKSKLAGEEKV S T+NYVILRTAWVYS+FG+NF LSMLRL+KE REISVVCDQFG
Sbjct: 121 LGIYGKSKLAGEEKVMSCTDNYVILRTAWVYSLFGTNFFLSMLRLSKEYREISVVCDQFG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPTSA QIA A+IQIA NL+ NSD SLRGIFHMTA+GGPVSWADFAEYIF  S E GG  
Sbjct: 181 TPTSASQIAIAVIQIARNLVNNSDNSLRGIFHMTANGGPVSWADFAEYIFLVSTELGGNS 240

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
            KV RI T QYPTKA RPAYS LDCSKL   HN+RIS+WKEGVRNI +
Sbjct: 241 CKVRRISTNQYPTKARRPAYSFLDCSKLEKIHNVRISSWKEGVRNIFI 288


>gi|332715610|ref|YP_004443076.1| dTDP-4-dehydrorhamnose reductase [Agrobacterium sp. H13-3]
 gi|325062295|gb|ADY65985.1| dTDP-4-dehydrorhamnose reductase [Agrobacterium sp. H13-3]
          Length = 297

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 144/290 (49%), Positives = 191/290 (65%), Gaps = 1/290 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+  V G NGQ+  +L +     +EI+ +GRP++DL +P           PDV+++ AAY
Sbjct: 1   MRLAVTGKNGQVVSALQAQAGPGLEIVALGRPELDLARPDTVFKALRDAKPDVVVSAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EP+IAF++N +GA A+A+AA+ IG+P I+ISTDYVFDG   T   E  PT P
Sbjct: 61  TAVDKAETEPDIAFAVNRDGAKAVARAANDIGVPVIHISTDYVFDGTKTTAYVENDPTGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YG+SKL GE+ V+  T+NY +LRTAWVYS +GSNF+ +MLRL++ R EI+VV DQFG
Sbjct: 121 ASVYGRSKLEGEQAVSESTDNYAVLRTAWVYSEYGSNFVKTMLRLSESRDEINVVADQFG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PTSA  IA AI+ IA  L  +    LRG+FHM+   G  +WA FA+ IF  SAE GG  
Sbjct: 181 CPTSANDIAIAIVSIAKRLATDPSAHLRGVFHMSGT-GETNWAGFAKQIFAFSAENGGKS 239

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             V  I T QYPT A RPA S LDC KL   + IR+  W+   R ++  +
Sbjct: 240 IVVNDITTAQYPTPAQRPANSRLDCCKLEEVYGIRLPEWQTSTRAVMAAL 289


>gi|15890374|ref|NP_356046.1| dTDP-4-dehydrorhamnose reductase [Agrobacterium tumefaciens str.
           C58]
 gi|15158591|gb|AAK88831.1| dTDP-4-dehydrorhamnose reductase [Agrobacterium tumefaciens str.
           C58]
          Length = 297

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 143/290 (49%), Positives = 202/290 (69%), Gaps = 1/290 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+  V G NGQ+  +L ++   D+EI+ +GRP++DL++P++         PDV+++ AAY
Sbjct: 1   MRLAVTGRNGQVVSALQALAGADLEIVTLGRPELDLVRPENVLQALREAKPDVVVSAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EP+IAF++N +GA A+A+AA  +G+P I++STDYVFDG   T   E  PT P
Sbjct: 61  TAVDKAESEPDIAFAVNRDGAKAVAQAAKELGVPVIHLSTDYVFDGSKATAYVESDPTGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            +IYG+SKL GE  V+  T+NYV+LRTAWVYS +G+NF+ +ML+L++ R EI+VV DQFG
Sbjct: 121 TSIYGRSKLKGERAVSEATDNYVVLRTAWVYSEYGNNFVKTMLKLSESRDEINVVADQFG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PTSA  IA A++ IA  L+E+S  SLRGIFH++   G  +WA+FA+ IF  SAE GG  
Sbjct: 181 CPTSATDIAAAVVAIARKLVEDSSASLRGIFHLSGT-GETTWANFAKQIFAFSAENGGKS 239

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             V  I TKQYPT A RPA S L+C KL   + +++ +W+   R ++  +
Sbjct: 240 MIVNDITTKQYPTPAPRPANSRLNCRKLEEIYGLKLPSWQTSTREVVTAL 289


>gi|222148116|ref|YP_002549073.1| dTDP-4-dehydrorhamnose reductase [Agrobacterium vitis S4]
 gi|221735104|gb|ACM36067.1| dTDP-4-dehydrorhamnose reductase [Agrobacterium vitis S4]
          Length = 301

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 143/281 (50%), Positives = 187/281 (66%), Gaps = 3/281 (1%)

Query: 2   KCLVIGNNGQIAQSLSSMCV--QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           + LV G  GQ+ QSL       +D++++ +GRP +DL  P    +  L+  PD+II+ AA
Sbjct: 6   RYLVTGLAGQVVQSLLEKASDRKDIDLVALGRPQLDLADPATIEAAVLAAKPDLIISAAA 65

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVD+AE +   AF++N EG G +A+ A ++ IP I+ISTDYVFDG   +P +E  P  
Sbjct: 66  YTAVDQAETDEATAFTVNGEGPGELARVAKALDIPIIHISTDYVFDGSKASPYNEADPVA 125

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YG+SKL GE +VA+ T+N+ ILRTAWVYS FG NFLL+MLRLA+ R E+ VV DQ 
Sbjct: 126 PLGVYGRSKLEGERRVAAETDNHAILRTAWVYSPFGKNFLLTMLRLAETRDELGVVADQI 185

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PTSAL IA A++++A NL+ +    LRG FHMT   G  SWA+FA  IF  SAE+  P
Sbjct: 186 GNPTSALDIADAVLKVADNLLSSKAADLRGTFHMTG-TGEASWAEFAREIFRLSAEQNDP 244

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
            +KV  I    YPT A RPA S LDC+KLA  H I I  W+
Sbjct: 245 SAKVNPIPASAYPTPAKRPANSRLDCAKLARVHAIDIPDWR 285


>gi|192288555|ref|YP_001989160.1| dTDP-4-dehydrorhamnose reductase [Rhodopseudomonas palustris TIE-1]
 gi|192282304|gb|ACE98684.1| dTDP-4-dehydrorhamnose reductase [Rhodopseudomonas palustris TIE-1]
          Length = 297

 Score =  285 bits (730), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 142/286 (49%), Positives = 194/286 (67%), Gaps = 3/286 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+ +V G +GQ+AQ+L       + EII + RP+IDL +P +     ++  PD ++N AA
Sbjct: 1   MRIVVTGRHGQVAQALHERAAGTNAEIILLARPEIDLTRPSEIEGVLIALKPDAVVNAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVD+AE E ++A++INAEGAGA+A+ A  +G+P + +STDYVFDG +  P  E  PTN
Sbjct: 61  YTAVDQAESEHDLAYAINAEGAGAVARTAAKLGVPMVQLSTDYVFDGTAEQPYRETDPTN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL+ YG SKLAGE  VA    ++ +LRT+WVYS FG NF+ +ML LA++R E+ VVCDQ 
Sbjct: 121 PLSAYGASKLAGERAVAEAAPDHAVLRTSWVYSPFGKNFVRTMLALARQRDEVRVVCDQV 180

Query: 180 GTPTSALQIARAIIQIAHNLI-ENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
           G+PTSAL IA  ++ +  NL+ E + + +RGIFHMTADG   +WA FAE IF  S   GG
Sbjct: 181 GSPTSALDIADGVLGVVRNLLAEPTRSDMRGIFHMTADGT-ATWAAFAEAIFAASRAAGG 239

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           P +KV  I T +YPT A RP  S LD S LA  H IR+  W++ ++
Sbjct: 240 PSAKVIPIPTTEYPTPAKRPTNSRLDSSALATAHGIRLPHWRQSLQ 285


>gi|222148464|ref|YP_002549421.1| dTDP-4-dehydrorhamnose reductase [Agrobacterium vitis S4]
 gi|221735452|gb|ACM36415.1| dTDP-4-dehydrorhamnose reductase [Agrobacterium vitis S4]
          Length = 301

 Score =  284 bits (727), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 142/281 (50%), Positives = 186/281 (66%), Gaps = 3/281 (1%)

Query: 2   KCLVIGNNGQIAQSLSSMCV--QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           + LV G  GQ+ QSL       +D++++ +GRP +DL       +   +  PD+II+ AA
Sbjct: 6   RYLVTGLAGQVVQSLLEKASDRKDIDLVALGRPQLDLADAATIEAAVRAAKPDLIISAAA 65

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVD+AE +   AF++N EG G +A+ A ++ IP I+ISTDYVFDG   +P +E  P  
Sbjct: 66  YTAVDQAETDEAAAFAVNGEGPGELARVAKALDIPIIHISTDYVFDGSKASPYNEADPVA 125

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YG+SKL GE +VA+ T+N+ ILRTAWVYS FG NFLL+MLRLA+ R E+ VV DQ 
Sbjct: 126 PLGVYGRSKLEGERRVAAETDNHAILRTAWVYSPFGKNFLLTMLRLAETRDELGVVADQI 185

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PTSAL IA A++++A NL+ +    LRG FHMT   G  SWA+FA  IF  SAE+ GP
Sbjct: 186 GNPTSALDIADAVLKVADNLLSSKAADLRGTFHMTGT-GEASWAEFATEIFRLSAEQNGP 244

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
            +KV  I    YPT A RPA S LDC+KLA  H I I  W+
Sbjct: 245 SAKVNPIPASAYPTPAKRPANSRLDCAKLARVHAIDIPDWR 285


>gi|319784645|ref|YP_004144121.1| dTDP-4-dehydrorhamnose reductase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170533|gb|ADV14071.1| dTDP-4-dehydrorhamnose reductase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 295

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 137/281 (48%), Positives = 188/281 (66%), Gaps = 3/281 (1%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ +V G +GQ+A SL  ++     VE+I +GRP +DL +P        +  PD++++ A
Sbjct: 1   MRLVVTGRDGQVAASLLEAAQAAAGVEVIAIGRPQLDLARPDTVIEAIAAVKPDIVVSAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD+AEDEP++AF++NA GAG +A+AA  +G+P I++STDYVFDG +     E   T
Sbjct: 61  AYTAVDQAEDEPDLAFAVNAVGAGKVAQAAALLGVPVIHLSTDYVFDGTAHGAYVETDAT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG SKLAGE+ VAS    ++ILRTAWVYS FG NF+ +MLRLA +R EISVV DQ
Sbjct: 121 APRSVYGASKLAGEQAVASANPRHLILRTAWVYSPFGKNFVKTMLRLAADRDEISVVADQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
           +G PTSAL IA  I  +A +L  +   +  G++H+  D G  +WA+FA+ +F  S ERG 
Sbjct: 181 WGNPTSALDIADGIFHMARHLKADLKFAEWGVYHVAGD-GDTNWAEFAQRVFVTSLERGR 239

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTW 279
           PY+ V  I T  YPTKA RPA S L+C K+A T   R  +W
Sbjct: 240 PYAAVRGISTSDYPTKAKRPANSRLNCGKMAATFGWRCRSW 280


>gi|326385993|ref|ZP_08207617.1| putative dTDP-4-dehydrorhamnose reductase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326209218|gb|EGD60011.1| putative dTDP-4-dehydrorhamnose reductase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 297

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 146/285 (51%), Positives = 191/285 (67%), Gaps = 10/285 (3%)

Query: 1   MKCLVIGNNGQIAQSL-----SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVII 55
           M+  V G +GQ+ Q+L     SS C     I  +GRP+IDL +P+  A  F  F+PDVI+
Sbjct: 1   MRIAVTGTHGQVVQALGERSASSGCT----IAAIGRPEIDLARPETLAGVFDRFAPDVIV 56

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           + AAYTAV+ AE EP++A  +N  GAGA+A  A  +G+P I++STDYV+ G    P  E 
Sbjct: 57  SAAAYTAVNHAEAEPDLAMVVNCAGAGAVAAEAARLGVPVIHLSTDYVYAGTGNRPWRED 116

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
            PT+PL +YG +KLAGE  VA+ T ++VILRTAW+YS FG+NF+ +MLRLA +R ++ VV
Sbjct: 117 DPTDPLGVYGVTKLAGERAVAAITPDHVILRTAWIYSPFGTNFVKTMLRLAVDRPQVRVV 176

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
            DQ G PTSAL IA  II IA NL+ +   +LRG+FHM A     SWADFAE IF +SA 
Sbjct: 177 ADQVGNPTSALDIADGIIAIARNLVADRSDALRGVFHM-AGRDEASWADFAEGIFEQSAA 235

Query: 236 RGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
           RGGP + V RI T ++PT A RPA S LDC KLA  H + +  W+
Sbjct: 236 RGGPVASVARITTDEFPTPAPRPANSRLDCGKLAELHGVILPPWR 280


>gi|116251390|ref|YP_767228.1| dTDP-4-dehydrorhamnose reductase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115256038|emb|CAK07119.1| putative dTDP-4-dehydrorhamnose reductase [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 295

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 152/291 (52%), Positives = 196/291 (67%), Gaps = 2/291 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+  V G  GQ+ QSL     +  VEI  VGRP++DL  P   A+ F +  PDVI++ AA
Sbjct: 1   MRIAVTGKQGQVVQSLLRRGAETGVEISAVGRPEMDLADPASIAAAFSALRPDVIVSAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE EPE+AFS+NA GAG +A+AA  IG P I+ISTDYVF G   +   E   T 
Sbjct: 61  YTAVDKAESEPELAFSVNAAGAGVVAQAAARIGAPVIHISTDYVFSGDKVSAYSEEDATA 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+++YG+SKLAGE+ VA+   N+VILRTAWVYS FG+NFL +MLRL++ R  + VV DQ 
Sbjct: 121 PISVYGRSKLAGEKAVAAANPNHVILRTAWVYSPFGNNFLKTMLRLSETRDHLRVVADQT 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PTSAL IA AI+ IA  ++ + + SLRGIFH+T   G  SWADFAE IF E ++ GG 
Sbjct: 181 GCPTSALDIADAILAIASRIVADPEPSLRGIFHLTGS-GEASWADFAEEIFTELSKSGGR 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V RI T  YPT A RPA S L+  KLA T+ IR+  WK+ +  ++ ++
Sbjct: 240 TVGVERIPTADYPTPAKRPANSRLNGDKLARTYGIRLPEWKQSMTIVMQDL 290


>gi|110349046|gb|ABG73090.1| RfbD [Rhizobium leguminosarum bv. trifolii TA1]
          Length = 295

 Score =  275 bits (703), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 151/291 (51%), Positives = 193/291 (66%), Gaps = 2/291 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+  V G  GQI QSL     + DVEI  VGRP++DL  P   A+ F +  PDVI++ AA
Sbjct: 1   MRIAVTGKQGQIVQSLLRRGAEMDVEISAVGRPEMDLADPASIAAAFSALRPDVIVSAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE EPE+AFS+NA GAGA  +   +IG P I+IST+YVF G       E   T 
Sbjct: 61  YTAVDKAESEPELAFSVNAAGAGAGCRGFCAIGAPVIHISTEYVFSGDRAFAYSEEDATA 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+++YG+SKLAGEE VA+   N+VILRTAWVYS FG+NFL +MLRL++ R  + VV DQ 
Sbjct: 121 PISVYGRSKLAGEEAVAAANPNHVILRTAWVYSPFGANFLKTMLRLSETRDHLRVVADQT 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PTSAL IA AI+ IA  ++ + + SLRG FH+T   G  SWADFAE IF E ++ GG 
Sbjct: 181 GCPTSALDIADAILAIATRVVADPEPSLRGTFHLTGS-GEASWADFAEEIFAELSKSGGR 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V RI T  YPT A RPA S L+  KLA T+ IR+  WK+ +  ++ ++
Sbjct: 240 TVGVERIPTADYPTPAKRPANSRLNGDKLARTYGIRLPEWKQSMAIVMQDL 290


>gi|241204006|ref|YP_002975102.1| dTDP-4-dehydrorhamnose reductase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857896|gb|ACS55563.1| dTDP-4-dehydrorhamnose reductase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 295

 Score =  271 bits (693), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 151/291 (51%), Positives = 195/291 (67%), Gaps = 2/291 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+  V G  GQ+ QSL     +  VEI  VGRP++DL  P   A+ F +  PDVI++ AA
Sbjct: 1   MRIAVTGKQGQVVQSLLRRGAEMGVEISAVGRPEMDLADPVSIAAAFSALRPDVIVSAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE EPE+AFS+NA GAGA+A+AA  IG P I+ISTDYVF G   +   E   T 
Sbjct: 61  YTAVDKAESEPELAFSVNAAGAGAVAEAAARIGAPVIHISTDYVFSGDKASAYSEEDATA 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+++YG+SKLAGE+ VA+   N+VILRTAWVYS FG+NF+ +MLRL++ R  + VV DQ 
Sbjct: 121 PISVYGRSKLAGEKAVAAANPNHVILRTAWVYSPFGANFVKTMLRLSETRDHLRVVADQT 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PTSAL IA AI+ IA  ++ +   SLRG FH+T   G  SWADFAE IF E ++ GG 
Sbjct: 181 GCPTSALDIADAILAIASRIVADPAPSLRGTFHLTGS-GEASWADFAEEIFTELSKSGGR 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V RI T  YPT A RPA S L+  KLA T+ IR+  WK+ +  ++ ++
Sbjct: 240 NVGVERIPTADYPTPAKRPANSRLNGDKLARTYGIRLPEWKQSMTFVMQDL 290


>gi|218680959|ref|ZP_03528856.1| putative dTDP-4-dehydrorhamnose reductase [Rhizobium etli CIAT 894]
          Length = 295

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 150/291 (51%), Positives = 196/291 (67%), Gaps = 2/291 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+  V G  GQ+ QSL     +  VE+  VGRP++DL  P+  A+ F +  PDVI++ AA
Sbjct: 1   MRIAVTGKQGQVVQSLLRRGAETGVEVSVVGRPEMDLADPESIAAAFSALRPDVIVSAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE E E+AFS+NA GAGA+AKAA  IG+P I+ISTDYVF G   +   E   T 
Sbjct: 61  YTAVDKAESEAELAFSVNAAGAGAVAKAAARIGVPVIHISTDYVFSGDKTSAYSEKDATA 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+++YG+SKLAGE+ VA+   N+VILRTAWVYS FG+NFL +MLRL++ R  + VV DQ 
Sbjct: 121 PISVYGRSKLAGEKAVAAANPNHVILRTAWVYSPFGANFLKTMLRLSETRDHLRVVADQT 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PTSAL IA AI+ IA  ++ +   SLRGIFH+T   G  SWADFAE IF    + GG 
Sbjct: 181 GCPTSALDIADAILAIATRIVADPAPSLRGIFHLTGS-GEASWADFAEEIFAALLKSGGR 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             ++ RI T  YPT A RPA S L+  KLA T+ IR+  WK+ +  ++ ++
Sbjct: 240 SVRIERIPTADYPTPAKRPANSRLNGEKLARTYGIRLPEWKKSMTVVMQDL 290


>gi|296447933|ref|ZP_06889842.1| dTDP-4-dehydrorhamnose reductase [Methylosinus trichosporium OB3b]
 gi|296254570|gb|EFH01688.1| dTDP-4-dehydrorhamnose reductase [Methylosinus trichosporium OB3b]
          Length = 300

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 172/280 (61%), Gaps = 1/280 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           ++  V G  GQ+  SL        EI+ +GRP +DL+      S       D I+  AAY
Sbjct: 3   IRIAVTGAQGQVVTSLLERASSTAEIVALGRPKLDLMDRDSVLSALRDSRCDAIVGAAAY 62

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDK+E EPEIA  +N  GAG +A+AA  +G+P ++ISTDYVFDG +  P  E  PT P
Sbjct: 63  TAVDKSEQEPEIAMRVNGAGAGFVAEAAAELGVPLVHISTDYVFDGTAARPYREDDPTAP 122

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG SKL GE +V +      ILRTAWVYS FG+NF+ +MLRL + R E+ VV DQ G
Sbjct: 123 LGVYGASKLEGETRVLAACPGATILRTAWVYSPFGANFVRTMLRLGETREEVGVVADQLG 182

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PTSAL IA A + +   L +++D +LRG+FHMT   G  SWAD AE IF  +AE G   
Sbjct: 183 NPTSALDIADATLAVVTRLAQDADPALRGVFHMTGS-GEASWADVAEAIFARAAEHGRAP 241

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
            +V RI T  YPT A RPA S LD SKLA  H + +  W+
Sbjct: 242 VRVRRITTADYPTPAKRPANSRLDNSKLARLHGVALPDWR 281


>gi|329848962|ref|ZP_08263990.1| dTDP-4-dehydrorhamnose reductase [Asticcacaulis biprosthecum C19]
 gi|328844025|gb|EGF93594.1| dTDP-4-dehydrorhamnose reductase [Asticcacaulis biprosthecum C19]
          Length = 293

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 186/280 (66%), Gaps = 2/280 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+ L+ G  GQ+  S+ ++  Q  +E+IR+G PDIDL +P    +   + SPDVII+ AA
Sbjct: 1   MRVLITGTEGQVDTSVKALGEQLGIEVIRIGLPDIDLSRPDSLEAPVRAASPDVIISSAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE EP++A  IN +  G +A+ A S+ +P +++STDYVF G      DE     
Sbjct: 61  YTAVDKAESEPDLARRINGDAPGELARIAASLNVPLLHLSTDYVFPGDKDGVYDEADTPE 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P ++YG +KLAGE ++A+ T+N+VILRTAWVYS +G+NF+ +MLRL K R EI+VV DQ 
Sbjct: 121 PASVYGATKLAGERQIAANTDNFVILRTAWVYSPYGNNFVKTMLRLGKTRDEINVVADQH 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PT A +IARA++ +A  +  + D  LRGIFH+T   G  +WADFAE IF ES +RGG 
Sbjct: 181 GCPTYAPEIARALLTVAQKIAADPDPKLRGIFHLTGT-GETTWADFAETIFLESVKRGGK 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTW 279
             KV  I T  YPT A RPA S L  +KL + + +++  W
Sbjct: 240 AVKVNPIATSDYPTPAKRPANSRLSGAKLHSIYGLQLDPW 279


>gi|260460163|ref|ZP_05808415.1| dTDP-4-dehydrorhamnose reductase [Mesorhizobium opportunistum
           WSM2075]
 gi|259033808|gb|EEW35067.1| dTDP-4-dehydrorhamnose reductase [Mesorhizobium opportunistum
           WSM2075]
          Length = 307

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 137/295 (46%), Positives = 192/295 (65%), Gaps = 7/295 (2%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ +V G +GQ+A SL  +     DVE++ +GRP++DL +P+       +  PD++++ A
Sbjct: 1   MRIVVTGRDGQVAASLLEAGQSRADVEVVAIGRPELDLARPETVFDAISAAKPDIVVSAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD+AEDEP+ AF++NA GAG +A+AA  +G+P I++STDYVFDG +     E   T
Sbjct: 61  AYTAVDQAEDEPDPAFAVNATGAGKVAEAAARLGVPVIHLSTDYVFDGSAPGAYVETDAT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            PL +YG SKLAGE+ VA+    ++ILRTAWVYS FG NF+ +MLRLA +R EISVV DQ
Sbjct: 121 APLGVYGASKLAGEQAVAAAGPRHLILRTAWVYSPFGRNFVKTMLRLAADRDEISVVADQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
           +G PTSAL IA AI+  A  L  N D +  G +H+ A  G  +W++FA +I   S   GG
Sbjct: 181 WGNPTSALDIADAILHAAAMLHRNEDLAAFGTYHL-AGTGEANWSEFARHILDTSLAFGG 239

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEG----VRNILVN 289
            +++V  I T  YPTKA RPA S L  +K A+    +   W++     VR +LV+
Sbjct: 240 HWARVRDIATMDYPTKARRPANSRLSSAKFASAFGWKAPDWRQSAETVVRRLLVD 294


>gi|315499261|ref|YP_004088065.1| dtdp-4-dehydrorhamnose reductase [Asticcacaulis excentricus CB 48]
 gi|315417273|gb|ADU13914.1| dTDP-4-dehydrorhamnose reductase [Asticcacaulis excentricus CB 48]
          Length = 299

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 139/291 (47%), Positives = 190/291 (65%), Gaps = 2/291 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+ +V G  GQ+  SL S+     +E+IRVG P+IDL KP+  A    +  PDVII+ AA
Sbjct: 1   MRIVVTGKEGQVDTSLQSLGEALGLEVIRVGLPEIDLSKPETLAEPIKAARPDVIISSAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE E E+A +IN +G GA+AK A  + IP +++STDYVF G       E     
Sbjct: 61  YTAVDKAESETELAQAINGDGPGALAKIAAELDIPLLHLSTDYVFAGDKDGIYTESDAPG 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+++YG +KL+GE ++A+ T N+VILRTAWVYS +G+NF+ +MLRL + R E++VV DQ 
Sbjct: 121 PVSVYGMTKLSGETQIAAATANHVILRTAWVYSPYGNNFVKTMLRLGETRDELNVVADQK 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PT A +IARA++ IA  + ++ D  LRGIFH+T   G  +WA FAE IF  SA RGG 
Sbjct: 181 GCPTYAPEIARALLHIAQRVSKDPDPKLRGIFHLTGQ-GETTWAGFAEVIFEGSALRGGK 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             KV  I T+ YPT A RPA S L   KLA  +++R+  W+  + + L  +
Sbjct: 240 AVKVTPIPTEAYPTPAKRPANSRLSGEKLAEVYDLRLDPWRVSLDDCLTRL 290


>gi|86357151|ref|YP_469043.1| dTDP-4-dehydrorhamnose reductase protein [Rhizobium etli CFN 42]
 gi|86281253|gb|ABC90316.1| dTDP-4-dehydrorhamnose reductase protein [Rhizobium etli CFN 42]
          Length = 295

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 194/291 (66%), Gaps = 2/291 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+  V G  GQ+ QSL     +  ++I  VGRP++DL  P   A+ F +   DVI++ AA
Sbjct: 1   MRIAVTGKQGQVVQSLLRRGAETGLDISAVGRPEMDLSDPASVAAAFSALRADVIVSAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE E E+AFS+NA GAGA+A+AA  IG+P I++STDYVF G   +   E   T 
Sbjct: 61  YTAVDKAESEAELAFSVNAAGAGAVAEAAARIGVPVIHLSTDYVFSGDKASAYCEEDATG 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+++YG+SKLAGE+ VA+   N+VILRTAWVYS FG+NFL +MLRLA+ R  + VV DQ 
Sbjct: 121 PISVYGRSKLAGEKAVAAANPNHVILRTAWVYSPFGNNFLKTMLRLAETRDHLRVVADQT 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PTSAL IA AI+ IA  +I + + SLRG FH+T   G  SWADFAE IF E  + GG 
Sbjct: 181 GCPTSALDIADAILAIATRIITDPEPSLRGTFHLTGS-GEASWADFAEEIFAELLKSGGR 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V RI T  YPT A RPA S L+  KLA T+ IR+  WK+ +  ++ ++
Sbjct: 240 SVGVERIPTADYPTPAKRPANSRLNGDKLARTYGIRLPEWKQSMTIVMQDL 290


>gi|327188679|gb|EGE55882.1| dTDP-4-dehydrorhamnose reductase protein [Rhizobium etli CNPAF512]
          Length = 295

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 151/291 (51%), Positives = 193/291 (66%), Gaps = 2/291 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+  V G  GQI QSL     +  VEII VGRP++DL  P   A+ F +  PDVI++ AA
Sbjct: 1   MRIAVTGKQGQIVQSLLRRGAETGVEIIAVGRPEMDLSDPASVAAAFSALRPDVIVSAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VDKAE E E+AFS+NA GAGAIA+AA  IG+P I++STDYVF G   +   E   T 
Sbjct: 61  YTGVDKAESEAELAFSVNAAGAGAIAEAAARIGVPVIHLSTDYVFSGDKASAYSEEDATA 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+++YG+SKLAGE+ VA+   N+VILRTAWVYS FG+NFL +MLRL++ R  + VV DQ 
Sbjct: 121 PISVYGRSKLAGEKAVAAANPNHVILRTAWVYSPFGANFLKTMLRLSETRDHLRVVADQT 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PTSAL IA AI+ IA  ++ +   SLRG FH+T   G  SWADFAE IF    + GG 
Sbjct: 181 GCPTSALDIADAILAIATRIVADPAPSLRGTFHLTGS-GEASWADFAEAIFAALLKSGGK 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V RI T  YPT A RPA S L+  KLA T+ IR+  WK+ +  ++ ++
Sbjct: 240 NVGVERIPTADYPTPAKRPANSRLNGDKLATTYGIRLPEWKQSMTIVMQDL 290


>gi|190891197|ref|YP_001977739.1| dTDP-4-dehydrorhamnose reductase [Rhizobium etli CIAT 652]
 gi|190696476|gb|ACE90561.1| dTDP-4-dehydrorhamnose reductase protein [Rhizobium etli CIAT 652]
          Length = 295

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 151/291 (51%), Positives = 194/291 (66%), Gaps = 2/291 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+  V G  GQ+ QSL     +  VEII VGRP++DL  P   A+ F +  PDVI++ AA
Sbjct: 1   MRIAVTGKQGQVVQSLLRRGAETGVEIIAVGRPEMDLSDPASVAAAFSAQRPDVIVSAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE E E+AFS+NA GAGAIA+AA  IG+P I++STDYVF G   +   E   T 
Sbjct: 61  YTAVDKAESEAELAFSVNAAGAGAIAEAAARIGVPVIHLSTDYVFSGDKASAYSEEDATA 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+++YG+SKLAGE+ VA+   N+VILRTAWVYS FG+NFL +MLRL++ R  + VV DQ 
Sbjct: 121 PISVYGRSKLAGEKAVAAANPNHVILRTAWVYSPFGANFLKTMLRLSETRDHLRVVADQT 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PTSAL IA AI+ IA  ++ +   SLRG FH+T   G  SWADFAE IF    + GG 
Sbjct: 181 GCPTSALDIADAILAIATRIVADPAPSLRGTFHLTGS-GEASWADFAEAIFAALLKSGGK 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V RI T  YPT A RPA S L+  KLA T+ IR+  WK+ +  ++ ++
Sbjct: 240 NVGVERIPTADYPTPAKRPANSRLNGDKLATTYGIRLPEWKQSMTIVMQDL 290


>gi|110635097|ref|YP_675305.1| dTDP-4-dehydrorhamnose reductase [Mesorhizobium sp. BNC1]
 gi|110286081|gb|ABG64140.1| dTDP-4-dehydrorhamnose reductase [Chelativorans sp. BNC1]
          Length = 295

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 137/289 (47%), Positives = 176/289 (60%), Gaps = 3/289 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK LV G NGQ+A+SL     +   +      RP++DL  P+  A      +PD+++N A
Sbjct: 1   MKILVTGKNGQLARSLLDRAARHPHLALDFAARPELDLADPRTIAPAIARHAPDLVVNAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD+AEDEPE+A ++N   AG IA+A  + GIP I+ISTDYVFDG    P  E  P 
Sbjct: 61  AYTAVDQAEDEPELAHAVNGAAAGLIARATAARGIPLIHISTDYVFDGALARPYREEDPV 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           NPL++YG SKLAGE  V     +++ILRTAWVYS +G NFL +ML+LA+ R EI VVCDQ
Sbjct: 121 NPLSVYGASKLAGERAVREQNPDHLILRTAWVYSPYGRNFLKTMLKLAEARDEIRVVCDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            G PTSA  IA  I+  A              +H+ A  G  SW +FA +IF ESA RGG
Sbjct: 181 IGNPTSAHDIAGGILAAAEARRVQGTRGWGKTYHL-AGSGEASWHEFAAHIFEESARRGG 239

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           P ++V  I T+ YPTKA RP  S L C + A+    R   W+E V  +L
Sbjct: 240 PSARVTPIATEDYPTKAVRPRNSRLCCDRFADAFGYRAPAWREAVVELL 288


>gi|39933196|ref|NP_945472.1| putative dTDP-6-deoxy-L-mannose-dehydrogenase [Rhodopseudomonas
           palustris CGA009]
 gi|39652821|emb|CAE25563.1| putative dTDP-6-deoxy-L-mannose-dehydrogenase [Rhodopseudomonas
           palustris CGA009]
          Length = 297

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 196/286 (68%), Gaps = 3/286 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+ +V G +GQ+AQ+L       + EI+ + RP+IDL +  D  +   +  PD ++N AA
Sbjct: 1   MRIVVTGRHGQVAQALYERAAGTNAEIVLLSRPEIDLTRQSDIETALSAVKPDAVVNAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVD+AE EP++A++INAEGAGA+A+AA  +G+P + +STDYVFDG +  P  E  PTN
Sbjct: 61  YTAVDQAESEPDLAYAINAEGAGAVARAAAKLGVPMVQLSTDYVFDGTAEQPYRETDPTN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL++YG SKLAGE  VA  T ++ +LRT+WVYS FG NF+ +ML LA++R E+ VV DQ 
Sbjct: 121 PLSVYGASKLAGERAVAKATPDHAVLRTSWVYSPFGKNFVRTMLALARQRDEVRVVWDQV 180

Query: 180 GTPTSALQIARAIIQIAHNLI-ENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
           G+PTSAL IA  ++ +  NL+ E + + LRGIFHMTADG   +WA FAE IF  S   GG
Sbjct: 181 GSPTSALDIADGVLGVVRNLLAEPTRSDLRGIFHMTADGT-ATWAAFAEAIFAASRAAGG 239

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           P +KV  I T +YPT A RP  S LD S LA  H IR+  W++ ++
Sbjct: 240 PSAKVIPIPTTEYPTPAKRPTNSRLDSSALAAAHGIRLPHWRQSLQ 285


>gi|323135558|ref|ZP_08070641.1| dTDP-4-dehydrorhamnose reductase [Methylocystis sp. ATCC 49242]
 gi|322398649|gb|EFY01168.1| dTDP-4-dehydrorhamnose reductase [Methylocystis sp. ATCC 49242]
          Length = 299

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 133/290 (45%), Positives = 175/290 (60%), Gaps = 1/290 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           ++  V G  GQ+  +L      DVE+I +GRP  DL       +       D I+N AAY
Sbjct: 6   LRLAVTGLTGQVVSALIERAPNDVEMIALGRPQFDLGVRDAVLATLRQTGCDAIVNAAAY 65

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EP++A  +N EGAG +A+AA  +G+P +++STDYVFDG    P  E  PT P
Sbjct: 66  TAVDKAESEPDVAMRVNGEGAGNVAEAAAELGVPLLHLSTDYVFDGARDRPYREDDPTGP 125

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
              YG+SKLAGEEK+A+   N+ ILRTAWVYS FG+NF+ +MLRL + R E+ VV DQ G
Sbjct: 126 TGAYGRSKLAGEEKIAAIHPNHAILRTAWVYSPFGANFVKTMLRLGETREEVGVVADQLG 185

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT+A+ IA A+I IA  L  +    LRG+FHMT   G  +WADFAE  F  +   G   
Sbjct: 186 NPTNAIDIADALIVIARRLAADPSPELRGVFHMTGQ-GEATWADFAESTFAIAERFGRKP 244

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            +V RI T  YPT A RPA S LD +KL     + +  W+  + N +  +
Sbjct: 245 VRVKRITTADYPTPARRPANSRLDNTKLNERFGVALPLWRASLENCVARL 294


>gi|86748689|ref|YP_485185.1| dTDP-4-dehydrorhamnose reductase [Rhodopseudomonas palustris HaA2]
 gi|86571717|gb|ABD06274.1| dTDP-4-dehydrorhamnose reductase [Rhodopseudomonas palustris HaA2]
          Length = 298

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 139/284 (48%), Positives = 184/284 (64%), Gaps = 2/284 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+  V G +GQ+A+SL      D++I+ + RP++DL +P+  A    +  PD ++N AAY
Sbjct: 1   MRLAVTGRHGQVARSLLERAPADIDIVPLARPEVDLQQPRAVAEAMAAARPDAVVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD AE E E+A  IN  GAGA+A AA  +GIP +++STDYVFDG    P  E   T P
Sbjct: 61  TAVDLAETEAELAHRINEAGAGAVAAAAARLGIPVVHLSTDYVFDGSLSRPYREDDETGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG SKLAGE  VA+   ++ ILRTAWVYS FG NF+ +ML LA+ R E+S+VCDQ G
Sbjct: 121 LGVYGASKLAGERAVAAGNPDHAILRTAWVYSPFGKNFVRTMLTLAETRDELSIVCDQRG 180

Query: 181 TPTSALQIARAIIQIAHNLIEN-SDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
            P+ AL IA  I  +  NL+    D +LRG+FHMT  G    WA FAE IF  SA+ GGP
Sbjct: 181 APSYALDIADGIFTVVRNLLARPDDAALRGVFHMTGRGD-TDWAGFAEAIFACSADAGGP 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
            ++V RI T  YPT A RPA S LD ++LA  H +R+  W++ +
Sbjct: 240 AARVKRIATSDYPTAARRPANSRLDTARLAARHGVRLPDWRDSL 283


>gi|91976052|ref|YP_568711.1| dTDP-4-dehydrorhamnose reductase [Rhodopseudomonas palustris BisB5]
 gi|91682508|gb|ABE38810.1| dTDP-4-dehydrorhamnose reductase [Rhodopseudomonas palustris BisB5]
          Length = 298

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 142/282 (50%), Positives = 180/282 (63%), Gaps = 2/282 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+  V G  GQ+ QSL      D++I+ + RP +DL  P   A    +  PD +I+ AAY
Sbjct: 1   MRLAVTGRVGQVVQSLLERAPADIDIVTIARPAVDLQDPVAVAEAIGAARPDAVISAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD AE E E+A+ IN  GAGA+A AA  +GIP +++STDYVFDG    P  E     P
Sbjct: 61  TAVDLAEKEAELAYRINEAGAGAVATAAADLGIPVVHLSTDYVFDGSLSRPYREDDAPAP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L++YG SKLAGE  VA+   ++ ILRTAWVYS FG NF+ +ML LA  R E+SVVCDQ G
Sbjct: 121 LSVYGASKLAGERAVAAANPDHAILRTAWVYSPFGKNFVRTMLMLADSRAEVSVVCDQRG 180

Query: 181 TPTSALQIARAIIQIAHNLIEN-SDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
            PT AL IA  ++ +A NL+   SD +LRG+FHM+  G   SWA FAE IF  SA  GGP
Sbjct: 181 APTCALDIADCVVAVARNLLARPSDGALRGVFHMSCTGE-TSWAGFAEAIFAHSAAAGGP 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKE 281
            ++V  I T +YPT A RPA S LD S+LA  H IR+  W +
Sbjct: 240 SARVKPIATSEYPTPARRPANSRLDTSRLAERHGIRLPNWTD 281


>gi|218660971|ref|ZP_03516901.1| dTDP-4-dehydrorhamnose reductase protein [Rhizobium etli IE4771]
          Length = 292

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 147/275 (53%), Positives = 184/275 (66%), Gaps = 2/275 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+  V G  GQ+ QSL     +  VEII VGRP++DL  P   A+ F +  PDVI++ AA
Sbjct: 1   MRIAVTGKQGQVVQSLLRRGAETGVEIIAVGRPEMDLSDPASIAAAFSALRPDVIVSAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE E E+AFS+NA GAGA+A+AA  IG+P I+ISTDYVF G   +   E   T 
Sbjct: 61  YTAVDKAESEAELAFSVNATGAGAVAEAAARIGVPVIHISTDYVFSGDKASAYCEVDATG 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+++YG+SKLAGE+ VA+   N+VILRTAWVYS FG+NFL +MLRL++ R  + VV DQ 
Sbjct: 121 PISVYGRSKLAGEKAVAAANPNHVILRTAWVYSPFGANFLKTMLRLSETRDHLRVVADQR 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PTSAL IA +I+ IA  ++ +   SLRG FH+T   G  SWADFAE IF    + GG 
Sbjct: 181 GCPTSALDIADSILAIATRIVADPAPSLRGTFHLTGS-GEASWADFAEEIFAALLKFGGK 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNI 274
              V RI T  YPT A RPA S L+  KLA T+ I
Sbjct: 240 NVGVERIPTTDYPTPAKRPANSRLNGDKLARTYGI 274


>gi|158605288|gb|ABW74898.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Sphingomonas sp. ATCC 53159]
          Length = 288

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 133/287 (46%), Positives = 184/287 (64%), Gaps = 4/287 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ LV G++GQ+AQSL+   V   E++    P+ DL KP+   +      PD+I++ AAY
Sbjct: 1   MRILVTGHDGQVAQSLAEQAVGH-ELVFTTYPEFDLSKPETIEAGVARVHPDLIVSAAAY 59

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE+A +IN +G G +A+A   IG P I++STDYVFDG    P  E  PT P
Sbjct: 60  TAVDKAESEPELAMAINGDGPGVLARAGAKIGAPIIHLSTDYVFDGSLDRPWREDDPTGP 119

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG +KLAGE+ V +      ++R AWVYS FG+NF+ +MLRLA+ R  ++VV DQ+G
Sbjct: 120 LGVYGATKLAGEQAVQASGATNAVIRLAWVYSPFGNNFVKTMLRLAETRDALNVVEDQWG 179

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            P+SAL IA AI+ +  +  ++  TS  G++H  A  G  +WADFA  IF ESA+RGGP 
Sbjct: 180 CPSSALDIATAILTVVGHWQQDGATS--GLYHF-AGTGETNWADFASTIFAESAKRGGPS 236

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           + V  I +  YPT A RPA S LDC++ A T   R   W++ +  +L
Sbjct: 237 ATVTGIPSSGYPTPATRPANSRLDCTRFAETFGYRAPAWQDSLNVVL 283


>gi|13476274|ref|NP_107844.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Mesorhizobium loti
           MAFF303099]
 gi|14027035|dbj|BAB53989.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Mesorhizobium loti
           MAFF303099]
          Length = 292

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 130/291 (44%), Positives = 181/291 (62%), Gaps = 2/291 (0%)

Query: 1   MKCLVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+  V G +GQ+  SL  +     V++I +GRP +DL  P        +  PD++++ AA
Sbjct: 1   MRLAVTGRDGQVVSSLLEAGQFAGVDVIAIGRPQLDLANPDTVIEAIAAARPDIVVSAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVD+AEDEP++AF +NA GAG +A+AA  +G+P I++STDYVFDG +     E   T 
Sbjct: 61  YTAVDQAEDEPDLAFRVNAVGAGKVAQAAARLGVPVIHLSTDYVFDGSASGAYVETDATA 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P ++YG SKLAGE+ VA+    ++ILRTAWVYS FG NF+ +MLRLA +R EISVV DQ+
Sbjct: 121 PASVYGASKLAGEQTVAAAGPRHLILRTAWVYSPFGKNFVKTMLRLAADRDEISVVADQW 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G P+SAL IA AI+  A  L  N D    G +H+ A  G  +W+ FA +I   S   GGP
Sbjct: 181 GNPSSALDIADAILHAAATLHRNKDFGAFGTYHL-AGTGETNWSGFARHILDTSRVSGGP 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            ++V+ I T  YPTKA RPA S L  +K A+        W++    ++  +
Sbjct: 240 SARVHDIMTTDYPTKARRPANSRLSSAKFASAFGWTAPDWRQSTEAVVRRV 290


>gi|1314582|gb|AAC44075.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Sphingomonas sp. S88]
          Length = 288

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 131/287 (45%), Positives = 182/287 (63%), Gaps = 4/287 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ LV G++GQ+AQ+L     +  E+I    P+ DL KP+   +      P++I++ AAY
Sbjct: 1   MRILVTGHDGQVAQALGEQA-EGHELIFTSYPEFDLSKPETIEAAVAKIQPELIVSAAAY 59

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDK+E EPE+A +IN +G G +A+A   IG P I++STDYVFDG    P  E  PT P
Sbjct: 60  TAVDKSESEPELAMAINGDGPGVLARAGAKIGAPIIHLSTDYVFDGSLDRPWREDDPTGP 119

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG +KLAGE+ V +      ++R AWVYS FG+NF+ +MLRLA+ R  ++VV DQ G
Sbjct: 120 LGVYGATKLAGEQAVQASGATNAVIRLAWVYSPFGNNFVKTMLRLAETRDTLNVVEDQQG 179

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            P+SAL IA AI+++  +  +N  TS  G++H T   G  +WADFA  IF ESA+ GGP 
Sbjct: 180 CPSSALDIATAILKVVGHWQQNGATS--GLYHFTGS-GETNWADFARAIFAESAKHGGPT 236

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           ++V  I T  YPT A RPA S L+C K A T   R   W++ V  ++
Sbjct: 237 AEVTGIPTSGYPTPAKRPANSRLNCDKFAETFGYRAPAWQDSVAEVV 283


>gi|209548785|ref|YP_002280702.1| dTDP-4-dehydrorhamnose reductase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534541|gb|ACI54476.1| dTDP-4-dehydrorhamnose reductase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 295

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 195/291 (67%), Gaps = 2/291 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+  V G  GQ+ QSL     +  ++I  VGRP++DL  P+  A+ F +  PDVI++ AA
Sbjct: 1   MRIAVTGKQGQVVQSLLRRGAETGIDISAVGRPEMDLANPESIAAAFSALRPDVIVSAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE E E+AFS+NA GAGA+A+AA  IG P I+ISTDYVF G   +   E   T 
Sbjct: 61  YTAVDKAESEAELAFSVNAAGAGAVAEAAARIGAPVIHISTDYVFSGDKASAYSEEDATA 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+++YG+SKLAGEE VA+   N+VILRTAWVYS FG+NFL +MLRL++ R  + VV DQ 
Sbjct: 121 PISVYGRSKLAGEEAVAAANPNHVILRTAWVYSPFGTNFLKTMLRLSETRDHLRVVADQT 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PTSAL IA AI+ IA  ++ +   SLRG FH+T   G  SWADFAE IF E ++ GG 
Sbjct: 181 GCPTSALDIADAILAIAARVVADPAPSLRGTFHLTGS-GEASWADFAEAIFAELSKSGGR 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V RI T  YPT A RPA S L+  KLA T+ +R+  WK+ +  ++ ++
Sbjct: 240 NVGVERIPTADYPTPAKRPANSRLNGDKLARTYGLRLPEWKQSMTIVMQDL 290


>gi|153010043|ref|YP_001371258.1| dTDP-4-dehydrorhamnose reductase [Ochrobactrum anthropi ATCC 49188]
 gi|151561931|gb|ABS15429.1| dTDP-4-dehydrorhamnose reductase [Ochrobactrum anthropi ATCC 49188]
          Length = 292

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 137/292 (46%), Positives = 180/292 (61%), Gaps = 3/292 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK LV G  GQ+ QSL     Q  D+E+I +GRP++DL KP    S   +  PD++++ A
Sbjct: 1   MKILVTGREGQVVQSLLEKAAQRSDLEVIALGRPELDLAKPDTVRSAIAAIKPDIVVSAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD AED  E+AF+ NA GA  +A+AA + G P I++STDYVF G +  P  E   T
Sbjct: 61  AYTAVDLAEDNKELAFAANATGAEVVAEAAKACGAPVIHLSTDYVFAGDADEPYVETDAT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P  +YG SKL GE  VA     ++I+RTAWVYS FG NF+ +ML+LA+ R  +SVV DQ
Sbjct: 121 GPRGVYGSSKLEGERLVAQSNPQHIIMRTAWVYSPFGKNFVKTMLKLAETRDALSVVSDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
           +G PTSAL IA AIIQ+A +L    D S  G++H+   G   +W+ FA  IF ESA  GG
Sbjct: 181 WGNPTSALDIADAIIQVADHLAATPDFSAYGVYHLVGMGN-TNWSSFARAIFDESATLGG 239

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P + V  I T  YPTKA RPA S L  +K     N     WK  +R+++  +
Sbjct: 240 PTANVTDITTADYPTKAVRPANSRLSTAKFQQVFNWSAPHWKSSLRDVVARL 291


>gi|32170825|gb|AAP57701.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Sphingomonas elodea]
          Length = 288

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 130/287 (45%), Positives = 179/287 (62%), Gaps = 4/287 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ LV G++GQ+AQSL     Q  E+I    P+ DL +P+   +      P++I++ AAY
Sbjct: 1   MRILVTGHDGQVAQSLGEQA-QGHELIFTSYPEFDLSRPETIEAAVAKIQPELIVSAAAY 59

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDK+E EPE+A +IN +G G +A+A   IG P I +STDYVFDG    P  E  PT P
Sbjct: 60  TAVDKSESEPELAMAINGDGPGVLARAGAKIGAPIIQLSTDYVFDGSLDRPWREDDPTGP 119

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG +KLAGE+ V +      ++R AWVYS FG+NF+ +MLRLA+ R  ++VV DQ G
Sbjct: 120 LGVYGATKLAGEQAVQASGATNAVIRLAWVYSPFGNNFVKTMLRLAETRDALNVVEDQQG 179

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            P+SAL IA AI+ +        D +  G++H  A  G  +WADFA  IF ESA+RGGP 
Sbjct: 180 CPSSALDIASAILAVVERW--QRDGAFSGVYHF-AGSGETNWADFARAIFAESAKRGGPT 236

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           + V  I +  YPT A RPA S LDCS+ A+T   R   W++ +  ++
Sbjct: 237 ATVTGIPSSDYPTPAKRPANSRLDCSRFADTFGYRAPAWQDSLAVVM 283


>gi|92118530|ref|YP_578259.1| dTDP-4-dehydrorhamnose reductase [Nitrobacter hamburgensis X14]
 gi|91801424|gb|ABE63799.1| dTDP-4-dehydrorhamnose reductase [Nitrobacter hamburgensis X14]
          Length = 307

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 130/285 (45%), Positives = 176/285 (61%), Gaps = 3/285 (1%)

Query: 4   LVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
           LV+G +GQ+A+ L    ++ ++ ++ VGRP++DL +  D A    + SP  IIN AAYTA
Sbjct: 13  LVVGKSGQLARCLQEAAIRRNLALVSVGRPELDLERGDDLAETVTAMSPAAIINAAAYTA 72

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VD+AE EP+ A+ +N + AG +A  A   GIP I++STDYVFDG   +P  E   T PLN
Sbjct: 73  VDRAEAEPKRAYRVNRDAAGRMAAVAREQGIPFIHVSTDYVFDGRKHSPYREDDQTGPLN 132

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YG+SKL GE  V       ++LRTAWVYS +G NF+ ++LRL+  +  + VV DQ+G+P
Sbjct: 133 VYGRSKLEGEAAVLKVDPGAIVLRTAWVYSPYGQNFVRTILRLSATQPAVLVVSDQYGSP 192

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
           TSAL +A AI+ I H        S+ GI+H+TA G  VSW DFA  IF + A RG P   
Sbjct: 193 TSALDLAEAILTIVHQ-ARADHGSVGGIYHLTAQGD-VSWHDFATAIFEQLARRGLPVPD 250

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +  I T  YPT A RPA S LDCSK A    +R+  W   +   L
Sbjct: 251 LQAIITDDYPTPARRPANSRLDCSKAAQVFGVRLPHWHSSLEECL 295


>gi|16519749|ref|NP_443869.1| dTDP-4-dehydrorhamnose reductase RmlD [Sinorhizobium fredii NGR234]
 gi|2500165|sp|P55463|RMLD_RHISN RecName: Full=Probable dTDP-4-dehydrorhamnose reductase; AltName:
           Full=dTDP-4-keto-L-rhamnose reductase; AltName:
           Full=dTDP-6-deoxy-L-lyxo-4-hexulose reductase; AltName:
           Full=dTDP-6-deoxy-L-mannose dehydrogenase; AltName:
           Full=dTDP-L-rhamnose synthase
 gi|2182409|gb|AAB91681.1| dTDP-4-dehydrorhamnose reductase RmlD [Sinorhizobium fredii NGR234]
          Length = 296

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 137/287 (47%), Positives = 182/287 (63%), Gaps = 1/287 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+  V G NGQIA +L +    DVEI+ +GRP+ DL      AS     +PD+I++ AAY
Sbjct: 1   MRLAVTGKNGQIALALKAQARPDVEILTLGRPNFDLACRSTVASSIRDAAPDIIVSLAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EP  AF++N +G  A+A+AA  +G+P I++STDYVFDG    P  E   T P
Sbjct: 61  TAVDKAESEPYEAFAVNRDGVQALAEAAAGLGVPVIHLSTDYVFDGAKPVPYCEEDRTGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +++YG+SKL GE  VAS   N+ ILRT+WVYS +G NF+  MLRLA    E++VV DQ G
Sbjct: 121 ISVYGRSKLEGEFAVASANPNHTILRTSWVYSRYGQNFVKKMLRLADTNDELNVVADQLG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PTSA  I+ A++ IA  ++ +S   LRGIFH++   G  SWA FA+Y+F    E  G  
Sbjct: 181 CPTSADDISVAVMTIARRMLSSSSADLRGIFHLSG-SGEASWAAFAKYVFSVYDEITGRQ 239

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            KV+ I   +YPT A RPA S L C KL  T  IR+  W+E  R ++
Sbjct: 240 IKVHDISAAEYPTPARRPANSRLHCDKLERTFGIRLPNWEESTRRLV 286


>gi|154247482|ref|YP_001418440.1| dTDP-4-dehydrorhamnose reductase [Xanthobacter autotrophicus Py2]
 gi|154161567|gb|ABS68783.1| dTDP-4-dehydrorhamnose reductase [Xanthobacter autotrophicus Py2]
          Length = 297

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 191/288 (66%), Gaps = 2/288 (0%)

Query: 1   MKCLVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+ +V G  GQ+  SL        VE+I +GRP++DL       S   + +PD I++ AA
Sbjct: 1   MRLIVTGKQGQVVSSLLERGPAASVEVIALGRPELDLADAASVRSAIAAAAPDAIVSAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE EP++AF++N  GAGA+A+AA ++G+P I++STDYVF G    P  E  PT 
Sbjct: 61  YTAVDKAECEPDLAFAVNETGAGAVAEAAGALGVPVIHLSTDYVFAGDKADPYVETDPTG 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+++YG SKLAGE+KVA+ T+N+ ILRTAWVYS FG+NFL +MLRL + R  + VV DQ 
Sbjct: 121 PVSVYGASKLAGEKKVAAATDNHAILRTAWVYSPFGANFLKTMLRLGESRDVLRVVADQR 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           GTPTSAL IA A+I +A  L  + D +LRG+FH+T  GG  +WADFA+ IF    E+ G 
Sbjct: 181 GTPTSALDIADAVIAVARRLKADPDPALRGVFHLTG-GGEGTWADFADAIFGGLKEKTGR 239

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             KV RI T  YPT A RPA S L   KL +++ I ++ W    R ++
Sbjct: 240 EVKVERITTADYPTPARRPANSRLSTKKLQSSYGIVLADWDASTRGVV 287


>gi|241203188|ref|YP_002974284.1| dTDP-4-dehydrorhamnose reductase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857078|gb|ACS54745.1| dTDP-4-dehydrorhamnose reductase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 297

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 133/290 (45%), Positives = 180/290 (62%), Gaps = 1/290 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+  V G +GQ+  +L ++ V  +EII +GRP++DLL+P   +       PDV+++ AAY
Sbjct: 1   MRIAVTGKSGQVTSALQALNVPGIEIIAIGRPELDLLEPSMVSEIIAKIKPDVVVSSAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   AF+IN +GA AIA A   + +P I++STDYVFDG       E  P  P
Sbjct: 61  TAVDKAESDEAAAFAINRDGAKAIAAATAELSLPVIHLSTDYVFDGDKPECYVESDPVGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +++YG+SKL GE  VA+   N+VILRTAWVYS FG NF+++MLRLA+ R E+SVV DQ G
Sbjct: 121 VSVYGRSKLEGEYAVAAANENHVILRTAWVYSTFGHNFVITMLRLAETREELSVVSDQLG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PTSA  IA AI++IA  L  +S   LRG+ H+ A  G  S A FA YI     E+ G  
Sbjct: 181 CPTSAGDIAGAIVKIAGRLSNDSTPDLRGVCHL-AGSGETSCAGFARYILSIHEEKTGRR 239

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             V  I T  YPT A RPA S L C KL + +++ +  W+   R  +  +
Sbjct: 240 VTVKDIATADYPTAAKRPANSRLCCDKLKSLYSVSMPEWRISARAAVTKL 289


>gi|186684650|ref|YP_001867846.1| dTDP-4-dehydrorhamnose reductase [Nostoc punctiforme PCC 73102]
 gi|186467102|gb|ACC82903.1| dTDP-4-dehydrorhamnose reductase [Nostoc punctiforme PCC 73102]
          Length = 296

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 131/290 (45%), Positives = 173/290 (59%), Gaps = 8/290 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L+IG+NGQ+ + L  +     +II V RP +DL +P    S   S  P +IIN AAYTAV
Sbjct: 6   LLIGSNGQVGKELQQILPSYGDIISVARPTVDLAQPDTLRSIIRSKQPQIIINAAAYTAV 65

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE EPE+A +INA     IA+ +  +G   I+ISTDYVFDG    P  E   TNPL++
Sbjct: 66  DKAESEPELASAINATAPLIIAQESQKLGAFLIHISTDYVFDGNGYRPYQETDATNPLSV 125

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQFGTP 182
           YGK+KLAGEE +     +++ILRTAWVY  FG SNF+ +MLRL  ER+E+ VV DQ G+P
Sbjct: 126 YGKTKLAGEEAIRETCAHHLILRTAWVYGTFGKSNFVKTMLRLGAERQELRVVADQIGSP 185

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY-- 240
           T A  IA  I Q    L       + G +H T + G  SW DFA  IF E+ + G P   
Sbjct: 186 TWAQDIATVIAQTIPQLTPK----IGGTYHYT-NSGVASWYDFAVAIFEEAQQLGFPLKV 240

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             +  I T +YPT A RPAYS L C K++       S W++ +R +L ++
Sbjct: 241 EHIVPITTAEYPTPARRPAYSVLACGKISAIVGTYPSHWRQRLRQMLADL 290


>gi|307320267|ref|ZP_07599686.1| dTDP-4-dehydrorhamnose reductase [Sinorhizobium meliloti AK83]
 gi|306894146|gb|EFN24913.1| dTDP-4-dehydrorhamnose reductase [Sinorhizobium meliloti AK83]
          Length = 309

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 128/292 (43%), Positives = 179/292 (61%), Gaps = 7/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCV--QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ LV G  GQ+  SL  +    +DVE+  +GRP+ DL +P       ++  PD++I+ A
Sbjct: 1   MRVLVTGTTGQLVTSLREVAAGSRDVELFAIGRPEFDLTRPIPMREAIIAARPDIVISAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYT+VD+AEDEP +A ++N  GA  +A+AA S+ IP I++S+DYVF G  RTP  E   T
Sbjct: 61  AYTSVDRAEDEPALARAVNVMGAACVAEAAASLDIPVIHLSSDYVFSGDDRTPRREDDET 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P  +YG +KLAGEE VAS T  ++ILRT+WVYS FG+NF+ +MLRLA  +  +SVV DQ
Sbjct: 121 GPRTVYGATKLAGEEAVASITARHIILRTSWVYSPFGTNFVKTMLRLASAQERLSVVSDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
           +G PTSAL +A AI+ IA    ++      G +H+T   G  +W+ FA ++   S   GG
Sbjct: 181 YGNPTSALDVAAAILLIATQPRQDR----FGTYHLTGT-GESNWSGFARHVLAVSRLHGG 235

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P + V  I T  YPTKA RP  S L  +K A T   R+  W+     ++  I
Sbjct: 236 PSAIVDDIATADYPTKARRPRDSRLCTNKFAGTFGWRLPDWQTSTETVVARI 287


>gi|170724102|ref|YP_001751790.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas putida W619]
 gi|169762105|gb|ACA75421.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas putida W619]
          Length = 286

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 124/290 (42%), Positives = 179/290 (61%), Gaps = 8/290 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ LV G+NGQ+AQ+L +      E+  +GR  +DL +P+         +P++IIN AAY
Sbjct: 1   MRVLVCGHNGQVAQALKTQLAGLGEVHLLGRDQLDLAQPEALREPLRQLAPELIINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE EP+ AF+INA+  G +A+ A  +G P I+ STDYVFDG    P  E    NP
Sbjct: 61  TAVDQAESEPDTAFAINAQAPGVLAEEALRLGAPLIHYSTDYVFDGEKAAPYTEQDVPNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG+SKLAGE+ +A+    ++ILRT+WVYS+ G NFLL+M RL +E+ ++ VV DQ G
Sbjct: 121 LGVYGRSKLAGEQAIAAVGGAHLILRTSWVYSLHGRNFLLTMQRLLQEKPQLRVVNDQIG 180

Query: 181 TPTSALQIA---RAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
            PT A  IA   RA+I+      +       G +H+TA  G  SW  FA+ I  +   RG
Sbjct: 181 APTWASTIALSTRALIE----RWQAGRAGAWGTYHLTAQ-GQTSWFGFAQAIGEQLKARG 235

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            P +++  I + +YPT A RPA S LDCS+LA   ++ +  W++ + + L
Sbjct: 236 LPCAELLPIPSSEYPTPARRPANSRLDCSRLAREWDVTLPHWQQALIDCL 285


>gi|17231982|ref|NP_488530.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Nostoc sp. PCC 7120]
 gi|17133626|dbj|BAB76189.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Nostoc sp. PCC 7120]
          Length = 294

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 130/288 (45%), Positives = 173/288 (60%), Gaps = 9/288 (3%)

Query: 3   CLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
            L++G+NGQ+ Q + ++     +II V RP IDL +            P +IIN AAYTA
Sbjct: 5   ILLLGSNGQVGQEIQNLLAPRYKIISVARPRIDLTQADSLRQIIREVQPQIIINAAAYTA 64

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VDKAE EPEIA +INA     IA+ +  +G   I+ISTDYVFDG    P  E  PTNPL+
Sbjct: 65  VDKAETEPEIATAINATAPQIIAEESQKLGSFLIHISTDYVFDGQQSHPYQETDPTNPLS 124

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQFGT 181
           +YGK+KLAGE  +     +++ILRTAWVY  FG SNF+ +MLRL  ER+EI VV DQ G+
Sbjct: 125 VYGKTKLAGEIAIQQTHPHHIILRTAWVYGSFGKSNFVKTMLRLGAERQEIRVVKDQIGS 184

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A  IA  I Q+   + E S     G +H T + G +SW +FA  IF ES + G P +
Sbjct: 185 PTWAQDIADTIAQVIPQIPEIS-----GTYHYT-NTGVISWYEFAVAIFAESQKLGFPLT 238

Query: 242 --KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             ++  I T +YPT A RPAYS L C K++         W++ +R +L
Sbjct: 239 VQQIIPITTAEYPTLAPRPAYSVLACEKMSQVLGTAPPHWQQRLRLML 286


>gi|119485671|ref|ZP_01619946.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Lyngbya sp. PCC 8106]
 gi|119456996|gb|EAW38123.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Lyngbya sp. PCC 8106]
          Length = 293

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 126/290 (43%), Positives = 171/290 (58%), Gaps = 8/290 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L+IG +GQ+ Q L  +     EI  VGR  +DL  P+  A       PD+I+N AAYTAV
Sbjct: 5   LLIGKDGQLGQELQQVLAPLGEIKSVGRDSLDLANPEAIAKMVAEVKPDLIVNAAAYTAV 64

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE E  +A +IN+   G +AK A  IG   I++STDYVFDG    P  E  PT PL +
Sbjct: 65  DKAETEQNLAQAINSTAPGILAKQAQEIGATLIHVSTDYVFDGSQSHPYLETDPTQPLGV 124

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQFGTP 182
           YG+SKLAGE+ + S   N  I+RTAWVY + G  NF+ +MLRL  ER E+ VVCDQ G+P
Sbjct: 125 YGQSKLAGEQAILSTQANAAIVRTAWVYGVGGKGNFVKTMLRLGAEREELRVVCDQVGSP 184

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY-- 240
           T    +A AI+Q++  +    +  + GI+H T + G  SW DFA  IF E+ + G P   
Sbjct: 185 TWTGDLAEAIVQLSQQI----NPEIAGIYHYT-NSGVTSWYDFAIAIFEEAKQLGFPLKI 239

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            +V  I T +YPT A RPAYS L+  K++         W++ +R +L  +
Sbjct: 240 QRVVPISTAEYPTPARRPAYSVLNTQKISAILGSYPPHWRQSLRKMLSKL 289


>gi|75909561|ref|YP_323857.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Anabaena variabilis
           ATCC 29413]
 gi|75703286|gb|ABA22962.1| dTDP-4-dehydrorhamnose reductase [Anabaena variabilis ATCC 29413]
          Length = 296

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 130/288 (45%), Positives = 169/288 (58%), Gaps = 9/288 (3%)

Query: 3   CLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
            L+IG NGQ+ Q +  +     ++I   RP IDL +            P +IIN AAYTA
Sbjct: 5   ILLIGGNGQVGQEIHQILAPKYKVISAARPRIDLTQADSLRQIIQEVQPQIIINAAAYTA 64

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VDKAE EPEIA +INA     IA+ +  +G   I+ISTDYVFDG    P  E  PTNPL+
Sbjct: 65  VDKAETEPEIATAINATAPQIIAEESQKLGSFLIHISTDYVFDGQQSHPYQETDPTNPLS 124

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQFGT 181
           +YGK+KLAGE  +      ++ILRTAWVY  FG SNF+ +MLRL  ER+EI VV DQ G+
Sbjct: 125 VYGKTKLAGEIAIQQTHPQHLILRTAWVYGSFGKSNFVKTMLRLGAERQEIRVVKDQIGS 184

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A  IA  I Q+   + E     + G +H T + G +SW DFA  IF ES + G P +
Sbjct: 185 PTWAQDIADTIAQVIPQIPE-----ISGTYHYT-NTGVISWYDFAVAIFAESQKLGFPLT 238

Query: 242 --KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             ++  I T +YPT A RPAYS L C K++         W+E +R +L
Sbjct: 239 VQQIIPITTAEYPTLAPRPAYSVLACEKMSQVLGTAPPHWQERLRLML 286


>gi|291568777|dbj|BAI91049.1| dTDP-4-dehydrorhamnose reductase [Arthrospira platensis NIES-39]
          Length = 292

 Score =  234 bits (598), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 130/290 (44%), Positives = 170/290 (58%), Gaps = 8/290 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G NGQ+   L  +     E+  VGR  +DL KP   +S      P +++N AAY
Sbjct: 1   MRILLTGKNGQLGSELQPLLTPLGEVFAVGRDTLDLAKPDAISSLMAEIKPHIVVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE E ++A +IN    G +A  +  I    I++STDYVFDG    P  E  PTNP
Sbjct: 61  TAVDKAETETDLATAINGIAPGILAAESQRINAKLIHVSTDYVFDGTQSHPYVETDPTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGS-NFLLSMLRLAKERREISVVCDQF 179
           L  YG SKLAGE+ + +   NY I+RTAWVY   G+ NF+ +MLRL++ER E+ VV DQ 
Sbjct: 121 LGQYGASKLAGEQAILATDANYAIIRTAWVYGAGGTGNFVKTMLRLSREREELRVVMDQV 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           GTPT    +A AI+Q+   L  NS+TS  GI+H T + G  SW DFA  IF E+   G P
Sbjct: 181 GTPTWTGDLATAIVQLIPQL--NSETS--GIYHYT-NSGVTSWYDFAIAIFEEAKLLGVP 235

Query: 240 Y--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               +V  I T +YPT A RPAYS L+  KLA         W+ G+R +L
Sbjct: 236 LKIQQVIPITTAEYPTPARRPAYSVLNGKKLATLLGNHPPQWRSGLRTML 285


>gi|284051015|ref|ZP_06381225.1| dTDP-4-dehydrorhamnose reductase [Arthrospira platensis str.
           Paraca]
          Length = 292

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 130/290 (44%), Positives = 169/290 (58%), Gaps = 8/290 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G NGQ+   L  +     E+  VGR  +DL KP   +S      P +++N AAY
Sbjct: 1   MRILLTGKNGQLGSELQPLLTPLGEVFAVGRDTLDLAKPDAISSLMAEIKPHIVVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE E ++A +IN    G +A  +  I    I++STDYVFDG    P  E  PTNP
Sbjct: 61  TAVDKAETETDLATAINGIAPGILAAESQRINAKLIHVSTDYVFDGTQSHPYVETDPTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGS-NFLLSMLRLAKERREISVVCDQF 179
           L  YG SKLAGE+ + +   NY I+RTAWVY   G+ NF+ +MLRL +ER E+ VV DQ 
Sbjct: 121 LGQYGASKLAGEQAILATDANYAIIRTAWVYGAGGTGNFVKTMLRLGREREELRVVMDQV 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           GTPT    +A AI+Q+   L  NS+TS  GI+H T + G  SW DFA  IF E+   G P
Sbjct: 181 GTPTWTGDLATAIVQLIPQL--NSETS--GIYHYT-NSGVTSWYDFAIAIFEEAKLLGVP 235

Query: 240 Y--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               +V  I T +YPT A RPAYS L+  KLA         W+ G+R +L
Sbjct: 236 LKIQQVIPITTAEYPTPARRPAYSVLNGKKLATLLGNHPPQWRSGLRTML 285


>gi|239831407|ref|ZP_04679736.1| dTDP-4-dehydrorhamnose reductase [Ochrobactrum intermedium LMG
           3301]
 gi|239823674|gb|EEQ95242.1| dTDP-4-dehydrorhamnose reductase [Ochrobactrum intermedium LMG
           3301]
          Length = 292

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 137/292 (46%), Positives = 185/292 (63%), Gaps = 3/292 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK  V G  GQ+ QSL     Q  D+E+I +GRP++DL +P    S   +  PDV+++ A
Sbjct: 1   MKIAVTGREGQVVQSLLEKASQRADLEVIALGRPELDLAEPGTVRSAIEAIKPDVVVSAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD AEDE E AF++NA GAGA+A+AA++ G+P I++STDYVF G +  P  E   T
Sbjct: 61  AYTAVDLAEDEQEHAFAVNAAGAGAVAQAAENCGVPVIHLSTDYVFAGDADKPYVETDAT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG SKL GE  VA     ++ILRTAWVYS FG NF+ +ML+LA+ R  +SVV DQ
Sbjct: 121 GPRSVYGSSKLEGERLVAQANPQHIILRTAWVYSPFGKNFVKTMLKLAETRDALSVVADQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
           +G PTSAL IA AII++A +L    + S  G++H+ A  G  +W+ FA  IF ESA  GG
Sbjct: 181 WGNPTSALDIADAIIRVADHLAAAPEFSAYGVYHL-AGTGDTNWSGFARAIFGESARLGG 239

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             + V  I T  YPTKA RPA S L  +K     N     W+  +R+++  +
Sbjct: 240 ATATVTDIATADYPTKARRPANSRLSTAKFQQAFNWSAPHWQSSLRDVVSRL 291


>gi|209526054|ref|ZP_03274587.1| dTDP-4-dehydrorhamnose reductase [Arthrospira maxima CS-328]
 gi|209493580|gb|EDZ93902.1| dTDP-4-dehydrorhamnose reductase [Arthrospira maxima CS-328]
          Length = 292

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 129/293 (44%), Positives = 169/293 (57%), Gaps = 8/293 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G NGQ+   L  +     E+  VGR  +DL KP   +S      P +++N AAY
Sbjct: 1   MRILLTGKNGQLGSELQPLLTPLGEVFAVGRDTLDLAKPDAISSLMAEIQPHIVVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE E ++A +IN    G +A  +  I    I++STDYVFDG    P  E  PTNP
Sbjct: 61  TAVDKAETETDLATAINGIAPGILAAESQRINAKLIHVSTDYVFDGTQSHPYVETDPTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGS-NFLLSMLRLAKERREISVVCDQF 179
           L  YG SKLAGE+ + +   NY I+RTAWVY   G+ NF+ +MLRL  ER E+ VV DQ 
Sbjct: 121 LGQYGASKLAGEQAILATDANYAIIRTAWVYGAGGTGNFVKTMLRLGGEREELKVVMDQV 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           GTPT    +A AI+++   L  NS+TS  GI+H T + G  SW DFA  IF E+   G P
Sbjct: 181 GTPTWTGDLATAIVRLIPQL--NSETS--GIYHYT-NSGVTSWYDFAIAIFEEAKLLGLP 235

Query: 240 Y--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
               +V  I T +YPT A RPAYS L+  KLA         W+ G+R +L  +
Sbjct: 236 LKIQQVIPITTAEYPTPARRPAYSVLNGKKLATLLGNHPPQWRSGLRTMLTTL 288


>gi|254416235|ref|ZP_05029989.1| dTDP-4-dehydrorhamnose reductase [Microcoleus chthonoplastes PCC
           7420]
 gi|196176917|gb|EDX71927.1| dTDP-4-dehydrorhamnose reductase [Microcoleus chthonoplastes PCC
           7420]
          Length = 295

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 128/293 (43%), Positives = 170/293 (58%), Gaps = 7/293 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G  GQ+   L        E++ V R  +DL +P         F PD+I+N AAY
Sbjct: 2   MRILLTGMAGQLGSELQQTLAPLGEVMGVDRQGLDLTQPDKIRQVIGEFKPDMIVNAAAY 61

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE E E+A +IN      +A+AA  +G   I++STDY+FDG   TP  E    +P
Sbjct: 62  TAVDKAETETELANAINGTAPTIMAEAAQQLGAALIHVSTDYIFDGKKNTPYTEDDKPDP 121

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQF 179
           +N YG+SKL GEE V  + +  +ILRTAWVY ++G  NF+ +MLRL  ER E+ VV DQ 
Sbjct: 122 INAYGQSKLLGEEGVLKHCDRALILRTAWVYGVYGKGNFVKTMLRLGAEREELRVVVDQV 181

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           GTPT    +A AI Q+   L   SDT L GI+H T + G +SW DFA  IF E+ E G P
Sbjct: 182 GTPTWTGDLASAIAQLVQYL--KSDT-LTGIYHFT-NSGAISWYDFAVAIFEEAQEIGFP 237

Query: 240 YS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
               +V  I T +YPT A RPAYS L   K++       S W+ G+R +L  +
Sbjct: 238 LQVKRVVPITTAEYPTAAARPAYSVLSTRKISAVVGNHPSHWRTGLRRMLKQL 290


>gi|288963205|ref|YP_003453484.1| dTDP-4-dehydrorhamnose reductase [Azospirillum sp. B510]
 gi|288915457|dbj|BAI76940.1| dTDP-4-dehydrorhamnose reductase [Azospirillum sp. B510]
          Length = 296

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 179/288 (62%), Gaps = 3/288 (1%)

Query: 1   MKCLVIGNNGQIA-QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV+G+NGQ+  + + +    D EI+ +  P+ D+ +P D      + +PD+++N  A
Sbjct: 1   MKILVLGSNGQLGFELMRANWAPDTEIVGLPYPEFDVTRPGDVEKAVATHAPDLLVNATA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           +TAVDKAE E E++F++N +G GA+A A  + GIP I++STDYVFDG       E  P N
Sbjct: 61  HTAVDKAESEVELSFAVNRDGPGAMAAACAARGIPFIHVSTDYVFDGTKDGLYSEDDPIN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YG SK AGEE V   + ++VILRT+WVYS +G+NF+ +MLR  KER E+ VV DQ 
Sbjct: 121 PLGVYGASKAAGEEAVRRASPHHVILRTSWVYSAYGNNFVKTMLRFGKEREEMRVVADQH 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT+A  +A AI+QIA   IE + ++  G +H+T  G   +W  FAE+IF    ER G 
Sbjct: 181 GSPTAAADLAAAIVQIA-GTIETTGSAAWGTYHLTGSGY-TTWHGFAEHIFRRLEERTGK 238

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             ++  I T  YPT A RPA S LDCS       +    W++ +  ++
Sbjct: 239 RPRLTAIGTADYPTPARRPANSRLDCSGAKERLGVSCPPWQDSLDRVI 286


>gi|104779534|ref|YP_606032.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas entomophila L48]
 gi|95108521|emb|CAK13215.1| dTDP-4-dehydrorhamnose reductase (dTDP-4-keto-L-rhamnose reductase)
           (dTDP-6-deoxy-L-mannose dehydrogenase) (dTDP-L-rhamnose
           synthetase) [Pseudomonas entomophila L48]
          Length = 286

 Score =  229 bits (583), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 124/290 (42%), Positives = 170/290 (58%), Gaps = 8/290 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G NGQ+AQ+L        E++ +GR  +DL +P+          PD+IIN AA+
Sbjct: 1   MKILVCGRNGQVAQALQGALDGHGEVLSLGRDRLDLARPEALREPLRQLKPDLIINAAAH 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE E ++AF+INAE    +A+ A  +G P I+ STDYVFDG   T  +E   TNP
Sbjct: 61  TAVDQAESEAQLAFAINAEAPRVLAEEAARLGAPLIHYSTDYVFDGTKATAYNEDDATNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG SKLAGE+ +A     ++ILRT+WVYS+ G NFLL+M +L +ER ++ VV DQ G
Sbjct: 121 LGVYGSSKLAGEQAIAKVGGEHLILRTSWVYSLQGRNFLLTMQKLLQERPQLKVVDDQVG 180

Query: 181 TPTSALQIA---RAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
            PT A  IA   RA+++              G +H+TA  G  SW  FA  I  +   RG
Sbjct: 181 APTWAATIAASTRALVE----RWRQGQAGAWGTYHLTAQ-GETSWYGFALAIGEQLKARG 235

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            P +++  I + +YPT A RP  S LDCS+LA    +    W E + + L
Sbjct: 236 LPCAELLPIPSSEYPTPAKRPLNSRLDCSRLAREWQVSQPHWHEALIDCL 285


>gi|119513383|ref|ZP_01632416.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Nodularia spumigena CCY9414]
 gi|119461962|gb|EAW42966.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Nodularia spumigena CCY9414]
          Length = 294

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 126/287 (43%), Positives = 167/287 (58%), Gaps = 8/287 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L++G+NGQ+ Q L  +     +II + RP IDL +P +         P +IIN AAYTAV
Sbjct: 6   LLLGSNGQVGQELEKILSPKHKIIPLARPKIDLTQPDNLRQIIREIQPQIIINAAAYTAV 65

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE EPE+A +INA+    IA+ +  +G   I+ STDYVFDG    P  E   TNPL +
Sbjct: 66  DKAETEPELATAINAKAPQIIAEESQKLGCFLIHFSTDYVFDGQQTRPYQETDRTNPLGV 125

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGS-NFLLSMLRLAKERREISVVCDQFGTP 182
           YG++K AGE  +     +++ILRTAWVY  FG  NF+ +MLRL KER EI VV DQ G+P
Sbjct: 126 YGQTKRAGEIAIEQTHPHHIILRTAWVYGTFGKGNFVKTMLRLGKERSEIGVVTDQIGSP 185

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS- 241
           T A  IA AI  I    I      + G +H T + G +SW DFA  IF E+   G P + 
Sbjct: 186 TWAQDIADAIAHI----IPQLTPEIAGTYHYT-NSGVISWYDFAVAIFAEAQHLGFPLTP 240

Query: 242 -KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            +V  I T +YPT A RPAY  L C K++         W++ +R +L
Sbjct: 241 PQVIPITTAEYPTLARRPAYPVLACGKISQLLGTYPPHWRQRLRLML 287


>gi|150376941|ref|YP_001313537.1| dTDP-4-dehydrorhamnose reductase [Sinorhizobium medicae WSM419]
 gi|150031488|gb|ABR63604.1| dTDP-4-dehydrorhamnose reductase [Sinorhizobium medicae WSM419]
          Length = 306

 Score =  228 bits (581), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 125/289 (43%), Positives = 179/289 (61%), Gaps = 7/289 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK L  G  GQ+   L+ + V+  DVE+I +GRP+ DL+ P       ++ SPDV+++ A
Sbjct: 1   MKVLATGTTGQVVTCLTEIAVRLGDVELITIGRPEFDLINPVPLREAIVAASPDVVVSAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD+AEDEP  A ++N  GA  +A+AA  +G+P I++STDYVF G    P  E   T
Sbjct: 61  AYTAVDRAEDEPARARAVNVAGAACVAEAAARLGVPLIHLSTDYVFSGDDPGPRKENDQT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P  +YG SKL GE+ VAS T  +VILRT+WVYS FG+NF+ ++LRLAK R  +SVV DQ
Sbjct: 121 RPRTLYGASKLDGEKAVASITPRHVILRTSWVYSPFGTNFVRTILRLAKSREILSVVSDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            G PTSAL +A AI++IA +   ++     G++H+   GG  +W+DFA +I   S   GG
Sbjct: 181 HGNPTSALDLAAAILEIARSRKGDA----FGVYHLAGTGG-TNWSDFARHILAVSHLNGG 235

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           P++ +  I +  YPT+A RP  S L   K        +  W++  + ++
Sbjct: 236 PFATIRGIASADYPTRARRPQDSRLCTDKFEGIFGWCLPPWQDSTKLVV 284


>gi|261856084|ref|YP_003263367.1| dTDP-4-dehydrorhamnose reductase [Halothiobacillus neapolitanus c2]
 gi|261836553|gb|ACX96320.1| dTDP-4-dehydrorhamnose reductase [Halothiobacillus neapolitanus c2]
          Length = 306

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 128/291 (43%), Positives = 170/291 (58%), Gaps = 8/291 (2%)

Query: 3   CLVIGNNGQIAQSLSSMCVQDVEIIRVGRPD----IDLLKPKDFASFFLSFSPDVIINPA 58
           CL++G+ GQ+A  L         +I   R      IDL +  DF S      P+ I+N A
Sbjct: 8   CLILGDQGQVAYELKRELATLGRVIAASRSTLPVAIDLAQHNDFESLIRQTKPNCIVNAA 67

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAE EPE+A  INAE    +A+AA    IP I+ STDYVFDG ++ P  E  PT
Sbjct: 68  AYTAVDKAEQEPELAMRINAEAVAELAQAAAKANIPLIHYSTDYVFDGTAQQPYQEDQPT 127

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           NP  +YG+SKLAGE+ +A+   N++ILRT+WVY   G NFL +M RLA+ER E+SVV DQ
Sbjct: 128 NPQGVYGQSKLAGEQAIAASGANHLILRTSWVYGTRGGNFLRTMRRLAREREELSVVADQ 187

Query: 179 FGTPTSALQIARAIIQIAHNLIENSD--TSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
            G PT +  IA+A  QI   L  +    T   GI+H+ + G   SW DFA  I     ++
Sbjct: 188 TGCPTWSRHIAQATAQILIQLKRDPSLITEHSGIYHLVSSGQG-SWHDFATAIIEHQRQQ 246

Query: 237 GG-PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
                 ++  I T Q+PT A RPAYS L+  KLA T  +R+  W+E +  +
Sbjct: 247 ETIACQRIVPITTAQFPTPAKRPAYSVLNTDKLAETFGVRLPDWREALSQV 297


>gi|29726035|gb|AAO88959.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Vibrio cholerae]
          Length = 296

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 124/289 (42%), Positives = 170/289 (58%), Gaps = 6/289 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           +K  + G NGQ+   L+      V ++ + R  +D+          L+F+PDVIIN AAY
Sbjct: 7   LKVALTGANGQLGYQLAKKLADKVTLLALDRAALDIANNGQVEKTLLAFAPDVIINAAAY 66

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE E E+A +IN  G   +AK A  +    I++STDYVFDG S  P  E  PTNP
Sbjct: 67  TAVDKAEQERELAKAINETGPQNMAKVAAKLDAVLIHVSTDYVFDGQSDKPYVETDPTNP 126

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            +IYG++KL GE+ V  Y   ++ILRTAWV++  G+NF+ +MLRLA+ + E+ VV DQ G
Sbjct: 127 QSIYGQTKLNGEQAVVKYCAKHIILRTAWVFAEHGNNFVKTMLRLAQSQPELGVVADQMG 186

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG-- 237
            PT A  IA AII +   L   ++ +  GI+H +  G P VSW  FA  IF  + ++   
Sbjct: 187 GPTYAGDIAEAIISMVAQLSAENEQNY-GIYHYS--GAPYVSWHQFACSIFQHAVQQQLI 243

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
               KV  I T QYPT A RPA+S LDCSK+     +  S W+  + N+
Sbjct: 244 AQAPKVNAITTAQYPTPAKRPAFSMLDCSKIQQAFAVSPSNWQAALNNL 292


>gi|282898611|ref|ZP_06306599.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Cylindrospermopsis
           raciborskii CS-505]
 gi|281196479|gb|EFA71388.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Cylindrospermopsis
           raciborskii CS-505]
          Length = 303

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 125/296 (42%), Positives = 178/296 (60%), Gaps = 16/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G +GQ+   L    +   ++I +GR ++DL + +   S      PD+I+NPAAY
Sbjct: 1   MKILLTGISGQVGWELQRSLMTVGDVICLGRNELDLSRYETIPSTIREIKPDLIVNPAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE EP++A SIN    G +A+ A  +G   ++ STDYVFDG   TP  E  PT P
Sbjct: 61  TAVDRAELEPDLAMSINGVAPGILAEEAKRLGAAIVHYSTDYVFDGNQNTPYKENDPTFP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YGK+KLAGE+ + +   N++I RT+WVY + G NFLL+M RLAKER EI VV DQ G
Sbjct: 121 QNVYGKTKLAGEKSIQAVGTNHLIFRTSWVYGLRGKNFLLTMQRLAKEREEIRVVDDQIG 180

Query: 181 TPTSALQIARA----IIQIAHNLIENSDTSLR-------GIFHMTADGGPVSWADFAEYI 229
           +PT +  IA      I QI   ++ +  + L        GI+H++  GG  SW  FA+ I
Sbjct: 181 SPTWSRMIAEVTAQIIAQIRGQMVISGTSYLADFMAEKGGIYHLSC-GGKTSWYGFAKAI 239

Query: 230 FWE--SAERGGPY--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKE 281
             +  + ++ G Y   ++  I T +YPT A RP+YS LD  KL +T  ++IS W+E
Sbjct: 240 LIDKFADDQYGQYKLQRLVPITTPEYPTPAPRPSYSLLDNQKLLDTFGLKISNWQE 295


>gi|330505517|ref|YP_004382386.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas mendocina NK-01]
 gi|328919804|gb|AEB60635.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas mendocina NK-01]
          Length = 292

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 122/290 (42%), Positives = 171/290 (58%), Gaps = 4/290 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G+ GQ+A+ L  + + + E+I +GR D DL +P+      +   P ++IN AAY
Sbjct: 1   MKILISGHTGQVARELQ-LALHEHELISLGRQDFDLSRPQSLRETIMRQRPALVINAAAY 59

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE E E+AF+INAE  GA+A A   + IP I+ STDYVFDG   TP  E     P
Sbjct: 60  TAVDQAEQERELAFAINAEAPGAMADACFELDIPLIHYSTDYVFDGSKATPYREADTPRP 119

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG SK+AGE+ +     +++ILRT+WVYS  G NFLL+MLRL +ER E+SVV DQ G
Sbjct: 120 LGVYGASKVAGEQALRISGCDHLILRTSWVYSQHGRNFLLTMLRLLQEREELSVVDDQIG 179

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT A  IA A  ++     +       G FH+T   G  SW  FA  I       G P 
Sbjct: 180 APTWAGSIASATAEMIDKWQQGRHRW--GTFHLTCQ-GETSWFGFASAIAEHLRTAGKPC 236

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           +++  I + +YPT A RP  S LD ++L     IR+  W++ ++  L ++
Sbjct: 237 ARLRPIPSSEYPTPAQRPLNSRLDGARLEEEWQIRLPDWQQALQQCLNDM 286


>gi|229587852|ref|YP_002869971.1| putative dTDP-4-dehydrorhamnose reductase [Pseudomonas fluorescens
           SBW25]
 gi|229359718|emb|CAY46566.1| putative dTDP-4-dehydrorhamnose reductase [Pseudomonas fluorescens
           SBW25]
          Length = 289

 Score =  224 bits (572), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 122/292 (41%), Positives = 171/292 (58%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G +GQ+++ L        E+I +GR  +DL           +  PD+IIN AA+
Sbjct: 1   MKVLITGQHGQVSRELQLQLQGLGELIVLGRDQLDLANADQIRQQIRAHRPDLIINAAAH 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE EP+ AF+INA   G +A+ A ++GIP I+ STDYVFDG    P  E    NP
Sbjct: 61  TAVDQAESEPDAAFAINAIAPGVLAEEAKALGIPLIHYSTDYVFDGSKPDPYTEADTPNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG+SKLAGEE +A+   +Y+ILRT+WVYS  G NFLL+M RL +E+ ++ +V DQ G
Sbjct: 121 LGVYGQSKLAGEEAIAAVGGDYLILRTSWVYSSHGKNFLLTMQRLLQEKPQMRIVADQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIEN---SDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
            PT A  IAR+       LIE     +    GI+H+T + G  SW  FAE I      +G
Sbjct: 181 APTWAGSIARST----RALIERWQAGEPGEWGIYHLT-NQGETSWFGFAEAIGAHLRTQG 235

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
              +++  I +  YPT A RP  S LDCS+L    ++   +W++ +R  L  
Sbjct: 236 KACAELEAIPSSAYPTPAKRPLNSRLDCSRLQQQWHVSQPSWQDALRECLAQ 287


>gi|319788035|ref|YP_004147510.1| dTDP-4-dehydrorhamnose reductase [Pseudoxanthomonas suwonensis
           11-1]
 gi|317466547|gb|ADV28279.1| dTDP-4-dehydrorhamnose reductase [Pseudoxanthomonas suwonensis
           11-1]
          Length = 310

 Score =  224 bits (572), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 119/301 (39%), Positives = 166/301 (55%), Gaps = 15/301 (4%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPD----------IDLLKPKDFASFFLSFSP 51
           + L++G NGQ+ + L    +   E++ + R             DL +P+  A+     +P
Sbjct: 3   RILLVGGNGQLGRELRRSLIALGEVVAMTRDGRLHDGGSAIAADLDEPQRLAAVVREVAP 62

Query: 52  DVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTP 111
           D ++N AAYTAVDKAE EPE AF IN E  G +A+A  + GIP ++ STDYVFDG    P
Sbjct: 63  DAVVNAAAYTAVDKAESEPEAAFRINGEAPGVLAQACAAAGIPLVHYSTDYVFDGQGTRP 122

Query: 112 IDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERRE 171
             E  PT PL +YG SKLAGEE + +    +++ RTAWVY+    NFL +MLRL  ER E
Sbjct: 123 YREDDPTAPLGVYGASKLAGEEAIRAAGGQHLVFRTAWVYAAHSHNFLRTMLRLGAERDE 182

Query: 172 ISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFW 231
           + VV DQ GTPT A  IA          +   D  + G +H+ ADG   SW  FAE IF 
Sbjct: 183 LRVVDDQVGTPTPAAMIADVTAVALRRAL--GDAGVSGTWHLVADGH-TSWHGFAEAIFA 239

Query: 232 ESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           E+   G       V+ + + ++PT A RPAYS LD S L     +++  W+E +  ++  
Sbjct: 240 EAVAAGVLARAPTVHPVTSAEFPTPARRPAYSRLDTSALQRDFGVQLLHWREALVPVMAE 299

Query: 290 I 290
           +
Sbjct: 300 L 300


>gi|332705309|ref|ZP_08425387.1| dTDP-4-dehydrorhamnose reductase [Lyngbya majuscula 3L]
 gi|332355669|gb|EGJ35131.1| dTDP-4-dehydrorhamnose reductase [Lyngbya majuscula 3L]
          Length = 296

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 129/292 (44%), Positives = 166/292 (56%), Gaps = 6/292 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+ G  GQ+ Q L        ++I VGR D+DL +P+          PDVI+N AAYT
Sbjct: 3   KILLTGITGQVGQELEDTLSPLGQVIGVGRSDMDLAEPESIRQVIHQIKPDVIVNAAAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE E  +A SINA     +A+ A ++G   ++ISTDYVFDG   TP  E    NP+
Sbjct: 63  AVDKAETELALAKSINAVAPTIMAEEAQNLGAILLHISTDYVFDGKKNTPYTEQDTPNPI 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQFG 180
             YGKSKL GEE V    +  +ILRTAWVY   G  NF+ +MLRL  ER E+ VV DQ G
Sbjct: 123 GSYGKSKLQGEEGVQQKCDRILILRTAWVYGTRGHGNFVKTMLRLGAEREELRVVADQVG 182

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP- 239
           TPT A  IA  I Q+   +  +S+  L GI+H T + G  SW DFA  IF E+   G P 
Sbjct: 183 TPTWAKDIAVTITQLLQAM--DSNPMLGGIYHFT-NTGVTSWYDFAVAIFEEAKLLGFPL 239

Query: 240 -YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              +V  I T +YPT A RPAYS L   K++ T       W++ +R +L  +
Sbjct: 240 KLQRVVPITTPEYPTPAQRPAYSVLSNQKISQTLGSYPPHWRQSLRQMLAEL 291


>gi|296531721|ref|ZP_06894550.1| dTDP-4-dehydrorhamnose reductase protein [Roseomonas cervicalis
           ATCC 49957]
 gi|296267953|gb|EFH13751.1| dTDP-4-dehydrorhamnose reductase protein [Roseomonas cervicalis
           ATCC 49957]
          Length = 305

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 125/290 (43%), Positives = 177/290 (61%), Gaps = 5/290 (1%)

Query: 1   MKCLVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+ L+ G  GQ+AQ+L  +   +  E+  +  P +DL +    A+   +  P+++IN AA
Sbjct: 1   MRILIAGREGQVAQALLRAFAPEGHEVTALEPPALDLTRRDSIAAAIAAARPELVINAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAED+  +AF++N +GA  +A+AA  +G P ++ STDYVFDG    P  E +PT+
Sbjct: 61  YTAVDKAEDDAALAFAVNRDGAAWLAEAASGVGAPFVHFSTDYVFDGAGGAPYAEDAPTS 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YG+SK  GEE V +     VILRTAWV S  G+NF+ +MLRLA  R EI VV DQ 
Sbjct: 121 PLGVYGRSKREGEEAVLAANPRSVILRTAWVCSADGNNFVKTMLRLAATRDEIGVVADQL 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLR-GIFHMTADGGP-VSWADFAEYIFWESAERG 237
           G PT A  +A A+  +A +L++      R G+FH+T  G P  SW  FAE IF  +A RG
Sbjct: 181 GAPTFAADLAEAVRAMAPHLLQAPAGDPRFGLFHLT--GAPHTSWHGFAEAIFAGAAARG 238

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               ++  I T  YPT+A RPA   LDC ++A  H I+ + W+  +  +L
Sbjct: 239 HKVPRLKAIGTADYPTRAQRPADGRLDCRRIATLHGIQAADWRRSLEAVL 288


>gi|218438467|ref|YP_002376796.1| dTDP-4-dehydrorhamnose reductase [Cyanothece sp. PCC 7424]
 gi|218171195|gb|ACK69928.1| dTDP-4-dehydrorhamnose reductase [Cyanothece sp. PCC 7424]
          Length = 294

 Score =  224 bits (570), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 123/292 (42%), Positives = 165/292 (56%), Gaps = 8/292 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+IGNNGQ+ Q L S      ++  V R  +DL +P +         P++I+N AAYT
Sbjct: 3   KILLIGNNGQVGQELQSTLAPIGDLTGVARDQLDLTQPDNIRQVIQDTHPEIIVNAAAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE E E+A+++N      +A+    +G   I+ISTDYVFDG    P+ E   TNP+
Sbjct: 63  AVDKAESETELAYTVNETAPKILAQECQKLGATLIHISTDYVFDGTRGIPLTEEDKTNPI 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGS-NFLLSMLRLAKERREISVVCDQFG 180
             YG SKLAGE+ +     NY+ILRTAWVY  +G  NF+ +MLRL  +R ++ VV DQ G
Sbjct: 123 GAYGASKLAGEQAIQDNCQNYIILRTAWVYGTYGKGNFVKTMLRLGADREQLRVVADQIG 182

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPT A  IA  I Q    LI+       GI+H T + G  SW DFA+ IF E+   G P 
Sbjct: 183 TPTWAKDIADTITQ----LIQLEQKVAPGIYHFT-NSGVASWYDFAKAIFEEATAIGFPL 237

Query: 241 --SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              +V  I T +YPT A RPAYS L   KL          W++ ++ +L  +
Sbjct: 238 KIKEVVPITTPEYPTPAKRPAYSVLSNQKLRALLGHYPPHWRDSLKQMLFQL 289


>gi|332971546|gb|EGK10496.1| dTDP-4-dehydrorhamnose reductase [Kingella kingae ATCC 23330]
          Length = 308

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 122/289 (42%), Positives = 165/289 (57%), Gaps = 5/289 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G NGQ+   L +      EI    R  +D+   +       +F PD+IIN AA+
Sbjct: 17  MKYLITGANGQVGSQLVAQLQGKAEIFAADRATLDITNRETVFQAARTFRPDIIINAAAH 76

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EP++A +IN  GA  +A AA  +G   ++ISTDYVFDG   T   E  P  P
Sbjct: 77  TAVDKAESEPDLAHAINCTGAENLALAAQEVGAIVLHISTDYVFDGKGETAYRETDPVAP 136

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            + YGKSKLAGE+ V +    ++ILRTAWV+   G+NF+ +MLRL   R  + VV DQFG
Sbjct: 137 QSTYGKSKLAGEQAVQAACTRHIILRTAWVFGEHGNNFVKTMLRLGASRDTLGVVADQFG 196

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG-- 237
           +PT A  IA A+I +A  ++   D  L G++H +  G P VSW  FA  IF ++  +G  
Sbjct: 197 SPTYAGDIAAALIVMAEQIVNQKDNELFGVYHFS--GSPYVSWHGFASEIFVQAVAQGVL 254

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
                +  I T  YPT A RPA S LDC K+     I  S W++ + N+
Sbjct: 255 AKSPTLNAITTADYPTPAVRPANSRLDCGKVQAAFGIAPSDWRKALLNL 303


>gi|113475071|ref|YP_721132.1| dTDP-4-dehydrorhamnose reductase [Trichodesmium erythraeum IMS101]
 gi|110166119|gb|ABG50659.1| dTDP-4-dehydrorhamnose reductase [Trichodesmium erythraeum IMS101]
          Length = 293

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 128/290 (44%), Positives = 169/290 (58%), Gaps = 8/290 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G NGQ+   L +   +  E+  VGR ++DL      +       P++IIN AAY
Sbjct: 1   MKILLTGINGQLGNQLQTPLKKIGEVSVVGRENLDLADSNAISQLIGQVQPELIINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDK+E EPE+A ++N    G +AK A  +G   I+ISTDYVFDG    P  E   TNP
Sbjct: 61  TAVDKSEKEPELADAVNRIAPGIMAKEAKKLGATLIHISTDYVFDGSQSRPYTETDLTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQF 179
           L IYGKSKLAGEE +     N++I+RTAWVY  +G  NF+ +MLRL K+R E+ VV DQ 
Sbjct: 121 LGIYGKSKLAGEEAIRETEVNHIIIRTAWVYGAYGKGNFVKTMLRLGKDREELRVVYDQV 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PT    +A AI QI  +L  NS T   G +H T + G +SW DFA  IF E+ + G P
Sbjct: 181 GCPTWTGDLAEAIAQIIPHL--NSQT--YGTYHYT-NSGAISWYDFAMAIFEEAKKLGFP 235

Query: 240 Y--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               +V  I T +YPT A RPA+S L+  K++         W   +R +L
Sbjct: 236 LEVKRVVPITTAEYPTPAKRPAFSVLNSGKISKVLGNHPPYWLNSLRQML 285


>gi|166362760|ref|YP_001655033.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Microcystis aeruginosa
           NIES-843]
 gi|166085133|dbj|BAF99840.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Microcystis aeruginosa
           NIES-843]
          Length = 291

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 124/292 (42%), Positives = 172/292 (58%), Gaps = 9/292 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+IG  GQ+ Q L     Q  E+I +GR ++DL   +          PD ++N +AYT
Sbjct: 3   KVLLIGAKGQVGQELQVTLPQLGEVISIGREELDLTNSQKIGQLIREIHPDYLVNASAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE EP++A+SINA     +A+AA+      ++ISTDYVFDG   TP  E   TNPL
Sbjct: 63  AVDKAETEPDLAYSINAIAPKIMAEAAEKTKAKFLHISTDYVFDGRKNTPYLETDLTNPL 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQFG 180
            +YG+SKL GEE++ +  +  +ILRTAWVY  +G SNF+ +M+RL KER E+ VV DQ G
Sbjct: 123 GVYGQSKLRGEEEINTVNSQAIILRTAWVYGSYGKSNFVKTMVRLGKEREELKVVVDQLG 182

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT A  IA AI Q    L+ N+D    GI++ T + G  SW D  + IF E+   G P 
Sbjct: 183 SPTWAKDIATAITQ----LLINADNP-AGIYNFT-NSGVASWFDLTKAIFEEAKTSGIPL 236

Query: 241 --SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              +V  I T +YPT A RPAYS L   K++         W++ ++ +L  +
Sbjct: 237 KIQRVIPITTAEYPTPAVRPAYSVLSGQKISQQLGYIPPYWRDSLKAMLTQL 288


>gi|257058395|ref|YP_003136283.1| dTDP-4-dehydrorhamnose reductase [Cyanothece sp. PCC 8802]
 gi|256588561|gb|ACU99447.1| dTDP-4-dehydrorhamnose reductase [Cyanothece sp. PCC 8802]
          Length = 296

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 126/290 (43%), Positives = 170/290 (58%), Gaps = 9/290 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K LV G +GQ+ Q L        E+I V R  IDL KP           P++IIN AAYT
Sbjct: 4   KILVTGIDGQVGQELKKTLNPLGEVIGVNRQTIDLTKPDRLRQLIQEIHPNIIINGAAYT 63

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE EPE+A ++N      IA+ A  +G   ++ISTDYVFDG    P  E  PT+P+
Sbjct: 64  AVDQAEKEPELALAVNGIAPTIIAEEAHKLGAFLLHISTDYVFDGTKNIPYTEEDPTHPV 123

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQFG 180
           ++YG+SKLAGE+ +  +++ YVILRTAWVY  +G SNF+ +MLRL +ER +I VV DQ G
Sbjct: 124 SVYGQSKLAGEQGIQKHSDRYVILRTAWVYGSYGKSNFVKTMLRLGQEREQIRVVSDQIG 183

Query: 181 TPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           +PT A  IA+ I Q+   L ++N+      I+H T + G  SW DFA  IF E+   G P
Sbjct: 184 SPTWAQDIAQTINQLLLTLDLKNTAE----IYHFT-NSGVASWYDFAVTIFEEAQNIGFP 238

Query: 240 Y--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               +V  I T  YPT A RP+YS L   K+  T       W+  ++ +L
Sbjct: 239 LKVQQVDPITTADYPTPAKRPSYSVLSGQKITATLGKYPPYWRNSLKQML 288


>gi|5545319|dbj|BAA82534.1| dTDP-4-keto-L-rhamnose reductase [Actinobacillus
           actinomycetemcomitans]
          Length = 292

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 125/288 (43%), Positives = 168/288 (58%), Gaps = 6/288 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+ G NGQ+   L+       EI+ V   ++D+           +F PDV+IN AA+T
Sbjct: 3   KFLITGANGQVGHCLTQQLQGKHEILAVDHDELDITNQSAVKKTVKNFRPDVVINAAAHT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE E E++ +IN +G   +A+AA S+G   ++ISTDYVFDG       E   T+P 
Sbjct: 63  AVDRAETEIELSEAINVKGPQYLAEAAKSVGAAILHISTDYVFDGRRAGKYKETDATDPQ 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           +IYGK+KLAGE+ V    + +++LRTAWV+   GSNF+ +MLRLAK R  + VV DQ G 
Sbjct: 123 SIYGKTKLAGEQAVVEANDKFIVLRTAWVFCEHGSNFVKTMLRLAKTRDTLGVVADQIGG 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG--G 238
           PT A  IA A+IQIA  +I        GI+H T  G P VSW DFA  IF E+  +    
Sbjct: 183 PTYAGDIAAALIQIAEKIIAGKSVEY-GIYHFT--GEPYVSWCDFARAIFDEAVSQNMLE 239

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
               V  I T  YPT A RPA SCLD +K+     I+ S W+  ++NI
Sbjct: 240 KVPLVNAITTADYPTPAKRPANSCLDLTKIQQVFGIQPSDWQRALKNI 287


>gi|254295529|ref|YP_003061551.1| dTDP-4-dehydrorhamnose reductase [Hirschia baltica ATCC 49814]
 gi|254044060|gb|ACT60854.1| dTDP-4-dehydrorhamnose reductase [Hirschia baltica ATCC 49814]
          Length = 334

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 140/327 (42%), Positives = 186/327 (56%), Gaps = 39/327 (11%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQD-VEIIRVGRPDIDLLKPKD------FASFFLSFSPDV 53
           MK  V G NGQ+ ++L  +  QD +++   GRP +DL +  D               PDV
Sbjct: 1   MKVFVTGENGQVVKALIKLADQDSLDVYTAGRPWLDLSELADDDKCEHLRLMIEDIGPDV 60

Query: 54  IINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDG------- 106
           +IN AAYT VDKAE+E ++A ++N  GAGA+A AA  + +P I ISTDYVF G       
Sbjct: 61  VINAAAYTNVDKAEEEGDMAAAVNTTGAGAVAMAAAKLNLPIIQISTDYVFAGDKTADIY 120

Query: 107 ---------------------LSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTN-NYVI 144
                                LS     E   T+P  +YG++KL GE K+A+Y N  +VI
Sbjct: 121 DPENPEYADYDAEDLADIRANLSDGTYVETDATHPQGVYGQTKLEGE-KLAAYVNPKHVI 179

Query: 145 LRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSD 204
           LRTAWVYS  G+NFL +MLR+   R E+ VV DQFG PT A  IA+ I+++A N++E  D
Sbjct: 180 LRTAWVYSETGNNFLKTMLRVGAARGELGVVNDQFGAPTHADAIAQGIVKVARNIVEQPD 239

Query: 205 -TSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCL 263
            T L G+FHMT  G   SW  FAE IF  S   GGP  K+  I T++YP  A RPA S L
Sbjct: 240 NTELYGVFHMTCRGY-TSWHGFAEAIFKASELAGGPTPKLNSITTEEYPLPAPRPANSRL 298

Query: 264 DCSKLANTHNIRISTWKEGVRNILVNI 290
           DCSK+A  HN+ +  W++ V   +V +
Sbjct: 299 DCSKIARVHNVELPQWQDMVMKTVVKV 325


>gi|218245359|ref|YP_002370730.1| dTDP-4-dehydrorhamnose reductase [Cyanothece sp. PCC 8801]
 gi|218165837|gb|ACK64574.1| dTDP-4-dehydrorhamnose reductase [Cyanothece sp. PCC 8801]
          Length = 296

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 126/293 (43%), Positives = 170/293 (58%), Gaps = 9/293 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K LV G +GQ+ Q L        E+I V R  IDL KP           P++IIN AAYT
Sbjct: 4   KILVTGIDGQVGQELKKTLNPLGEVIGVNRQTIDLTKPDRLRQLIQEIHPNIIINGAAYT 63

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE EPE+A ++N      IA+ A  +G   ++ISTDYVFDG    P  E  PT+PL
Sbjct: 64  AVDQAEKEPELALAVNGIAPTIIAEEAHKLGAFLLHISTDYVFDGTKNIPYTEEDPTHPL 123

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQFG 180
           ++YG+SKLAGE+ +  +++ YVILRTAWVY  +G SNF+ +MLRL +ER +I VV DQ G
Sbjct: 124 SVYGQSKLAGEQGIQKHSDRYVILRTAWVYGSYGKSNFVKTMLRLGQEREQIRVVSDQIG 183

Query: 181 TPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           +PT A  IA+ I Q+   L ++N+      I+H T + G  SW DFA  IF E+   G P
Sbjct: 184 SPTWAQDIAQTINQLLLTLDLKNTAE----IYHFT-NSGVASWYDFAVTIFEEAQNIGFP 238

Query: 240 Y--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
               +V  I T  YPT A RP+ S L   K+  T       W+  ++ +L  +
Sbjct: 239 LKVQQVDPITTADYPTPAKRPSSSVLSGQKITATLGKYAPYWRNSLKQMLTQL 291


>gi|41205693|gb|AAR99613.1| dTDP-4-dehydrorhamnose reductase [Geobacillus stearothermophilus]
          Length = 282

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 126/288 (43%), Positives = 165/288 (57%), Gaps = 13/288 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK +V G NGQ+ Q L     Q +VE+    + D+D+              PD++IN AA
Sbjct: 1   MKIVVTGANGQLGQELVGQLQQTNVELYSFTKSDLDITNDSIVNETITKIKPDILINAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VD+AE E E A+ +NA G   +A AA+ +G    YISTDYVFDG S TP  E+  TN
Sbjct: 61  YTKVDQAEIEEETAYLVNAFGQRNLAIAAEKVGAKICYISTDYVFDGTSMTPYREYDRTN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YGKSK AGEE   S  + Y I+RTAWVY  FG NF+ +MLRLAKE+ EI VV DQ 
Sbjct: 121 PLGVYGKSKYAGEELTKSLCSRYFIVRTAWVYGEFGQNFVKTMLRLAKEKEEIGVVNDQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT  + +AR II++         T   GI+H T + G  SW +FA+ IF ES      
Sbjct: 181 GSPTYTVDLARFIIELVQ-------TEKFGIYHAT-NSGSCSWYEFAKAIFEES----NI 228

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           + KV  I T+Q+P  A RP YS LD   +       +  W+E ++  L
Sbjct: 229 HVKVNPITTEQFPRPAARPKYSVLDNFAMKVNGFPMLRHWREALKEFL 276


>gi|220909659|ref|YP_002484970.1| dTDP-4-dehydrorhamnose reductase [Cyanothece sp. PCC 7425]
 gi|219866270|gb|ACL46609.1| dTDP-4-dehydrorhamnose reductase [Cyanothece sp. PCC 7425]
          Length = 298

 Score =  223 bits (567), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 120/292 (41%), Positives = 171/292 (58%), Gaps = 8/292 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L++G+ GQ+   L  +     E++ + R  +DL  P+          P VIIN AAYT
Sbjct: 10  KILLLGSQGQVGAELQHILSSASELMALSRAQLDLAHPQRLPDLIAEIQPQVIINAAAYT 69

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE EPE+A  +NA+    +A AA       +++STDYVF G   TP  E  PT PL
Sbjct: 70  AVDRAESEPEVAEIVNAKVPTELAIAARQCNALLVHLSTDYVFAGQQSTPYRETDPTAPL 129

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGS-NFLLSMLRLAKERREISVVCDQFG 180
           ++YG++KLAGEE +    + ++ILRTAWVY ++G  NF+ +MLRL  +R E+ VV DQ G
Sbjct: 130 SVYGQTKLAGEEGIRQVWDRHLILRTAWVYGVYGKGNFVKTMLRLGADRSELRVVADQVG 189

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT A  +A A   IAH L+++      G +H T + G  SW DFA  IF E+ +RG   
Sbjct: 190 SPTWAADLAGA---IAH-LVQHFQPDWAGTYHYT-NSGVTSWYDFAIAIFEEARQRGFKL 244

Query: 241 S--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              +V  I T +YPT A RPAYS L+C K ++        W++ +R +L N+
Sbjct: 245 QVEQVMPITTPEYPTPATRPAYSVLNCQKFSSLLGAAPPHWRQSLRQMLTNL 296


>gi|91776363|ref|YP_546119.1| dTDP-4-dehydrorhamnose reductase [Methylobacillus flagellatus KT]
 gi|91710350|gb|ABE50278.1| dTDP-4-dehydrorhamnose reductase [Methylobacillus flagellatus KT]
          Length = 306

 Score =  222 bits (565), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 118/298 (39%), Positives = 167/298 (56%), Gaps = 14/298 (4%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+ G NGQ+  +L        E++ + R  +DL KP           PD+IINPAAYT
Sbjct: 6   KILLTGINGQVGHALYPKLQSLGEVVALDRSQLDLSKPDHIRDVVRQTKPDLIINPAAYT 65

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE EPE+A++IN    G +A+ A  +    ++ STDYVFDG   TP  E   TNPL
Sbjct: 66  AVDKAESEPELAYAINGTAPGILAEEAAKLNALLVHYSTDYVFDGTKTTPYTELDETNPL 125

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG SKLAGE+ +     N++I RT+WVY  +G NF+ ++LRLA ER  +++V DQFG 
Sbjct: 126 SVYGASKLAGEKAIQEVGANHLIFRTSWVYGAYGKNFMRTILRLAAERDSLNIVADQFGA 185

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYI---FWESAER-- 236
           PTS   IA A I   H      D + RG++H+  + G  SW  FA  I   + E A++  
Sbjct: 186 PTSTESIADATITALHAW----DGTQRGVYHL-VNTGETSWHGFALEIIRQYGEIAQKKN 240

Query: 237 ----GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                     V  I T +YPT AHRPA S +   K  +T    ++ W+  +R+ + ++
Sbjct: 241 LAKLKSTVENVVGITTAEYPTPAHRPANSKMSTEKFMSTFKTELAPWELALRSTVTHL 298


>gi|84684393|ref|ZP_01012294.1| hypothetical protein 1099457000260_RB2654_12249 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667372|gb|EAQ13841.1| hypothetical protein RB2654_12249 [Rhodobacterales bacterium
           HTCC2654]
          Length = 288

 Score =  221 bits (564), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 170/288 (59%), Gaps = 9/288 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G  GQ+A+ L++   + V +  +GR   DL +P+  A      +PDV+IN AAY
Sbjct: 1   MKALVFGTTGQVARELAATTPKGVRLEALGRDRADLSRPEKCAEAIRHAAPDVVINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE++  +A  +N E  G +A+A  ++GIP  ++STDYVF G    P    +PT P
Sbjct: 61  TAVDRAEEDEALATVVNGEAPGEMARACAALGIPFFHVSTDYVFSGEGDAPWAVDAPTRP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           LN YG+SKLAGE  + +    + ILRT+WV S  G NF+ +MLRL++ R  +++V DQ G
Sbjct: 121 LNAYGRSKLAGETAIRAAGGPHAILRTSWVVSGHGGNFVKTMLRLSETRDRLTIVADQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A  IA A+  +A  L+  +D S  G FH +  G P VSWADFA  I  +S    G 
Sbjct: 181 GPTPASDIAAALWSMAVALV--ADPSKGGTFHFS--GAPDVSWADFAREILRQS----GR 232

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + V  I TK YPT A RPA S LDC       +I    W+ G+ +IL
Sbjct: 233 TTVVEDIATKDYPTPARRPANSRLDCRATEAAFDIVRPDWRVGLTDIL 280


>gi|159027476|emb|CAO89441.1| rfbD [Microcystis aeruginosa PCC 7806]
          Length = 291

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 124/289 (42%), Positives = 171/289 (59%), Gaps = 9/289 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+IG  GQ+ Q L        E+I +GR ++DL   +          PD ++N AAYT
Sbjct: 3   KVLLIGAKGQVGQELQVTLPYLGEVISIGREELDLTNSEKIGQLIREIRPDYLVNAAAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE EP++A+SINA     +A++A+ I    ++ISTDYVFDG   TP  E   TNPL
Sbjct: 63  AVDKAETEPDLAYSINAIAPKIMAESAEKIKAKFLHISTDYVFDGRKNTPYLETDLTNPL 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQFG 180
            +YG+SKL GEE++ +  +  +ILRTAWVY  +G SNF+ +MLRL KER E+ VV DQ G
Sbjct: 123 GVYGQSKLRGEEEIKTVNSQAIILRTAWVYGSYGKSNFVKTMLRLGKEREELKVVVDQVG 182

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT +  IA AI Q    L+ N+D    GI++ T + G  SW D  + IF E+   G P 
Sbjct: 183 SPTWSKDIATAITQ----LLINADNP-TGIYNFT-NSGVASWFDLTKAIFEEAKISGIPL 236

Query: 241 --SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              +V  I T +YPT A RPAYS L   K++         W++ ++ +L
Sbjct: 237 KIQRVIPITTAEYPTPAVRPAYSVLSSQKISQQLGYIPPYWRDSLKAML 285


>gi|300114907|ref|YP_003761482.1| dTDP-4-dehydrorhamnose reductase [Nitrosococcus watsonii C-113]
 gi|299540844|gb|ADJ29161.1| dTDP-4-dehydrorhamnose reductase [Nitrosococcus watsonii C-113]
          Length = 294

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 168/281 (59%), Gaps = 3/281 (1%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G +GQ+   L        E+   GR  ++L +      +     P +I+N AAYT
Sbjct: 7   RILLVGASGQVGWELQRSLAPLGEVFIPGRERLNLAQVDSIRPYLAEIQPTLIVNAAAYT 66

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE+EPE A +IN +  G +A+ A   G   I+ STDYVFDG    P  E     PL
Sbjct: 67  AVDKAEEEPEQALAINGKAPGVLAETARQQGAALIHYSTDYVFDGQGVYPYREGDTPRPL 126

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           N+YG++KLAGE+ +A+    Y+ILRT+WVY + G NFLL+M RLA+ER  ++VV DQ+GT
Sbjct: 127 NVYGQTKLAGEQAIAAVGGAYLILRTSWVYGLRGHNFLLTMQRLAQEREVLTVVNDQWGT 186

Query: 182 PTSALQIARAIIQI-AHNLIENSDT-SLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PT +  IA    QI A +  +  D+    GI+H++  GG  +W  FA+ I    A+  GP
Sbjct: 187 PTWSRLIAEGTAQIVAQSRGQRQDSIPQAGIYHLSC-GGKTTWHGFAQAILARLAQGAGP 245

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
            +++  I +  YP  A RPA+SCLD +++ +T  I++ +W+
Sbjct: 246 VARLEAIPSADYPIPARRPAFSCLDNTRIKDTFGIQLPSWR 286


>gi|292492258|ref|YP_003527697.1| dTDP-4-dehydrorhamnose reductase [Nitrosococcus halophilus Nc4]
 gi|291580853|gb|ADE15310.1| dTDP-4-dehydrorhamnose reductase [Nitrosococcus halophilus Nc4]
          Length = 296

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 116/285 (40%), Positives = 170/285 (59%), Gaps = 4/285 (1%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G +GQ+   L        E+I + R  +DL + ++  S      P +I+N AAYT
Sbjct: 7   RILLLGASGQVGWELQRTLAPLGEVIALRRDRLDLAQVENIGSCLADIQPILIVNAAAYT 66

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE+EPE A +IN +  G +A+AA   G   I+ STDYVFDG + +P  E     PL
Sbjct: 67  AVDQAEEEPERAMAINGDVPGILAEAARQQGAALIHYSTDYVFDGENTSPYRETDTPRPL 126

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           N+YG++KLAGE+ +A+    Y+ILRT+WVY + G NFLL+M RLA+ER  + VV DQ+GT
Sbjct: 127 NVYGQTKLAGEKAIAAVGGAYLILRTSWVYGLRGRNFLLTMQRLAQEREALKVVDDQWGT 186

Query: 182 PTSALQIARAIIQI---AHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
           PT +  IA    QI   +   +++      G +H++  GG  +W  FA  I    A+R  
Sbjct: 187 PTWSRLIAEGTAQIIAQSRGQMQDYIRQQAGTYHLSC-GGKTTWYGFARVILDRLAQRTT 245

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
           P +++  I T  YPT A RPA+S LD S + +T  I++  WKE +
Sbjct: 246 PVARLEAIPTSGYPTPAQRPAFSSLDNSHVRDTFGIQLPHWKEAL 290


>gi|307130157|ref|YP_003882173.1| dTDP-4-dehydrorhamnose reductase [Dickeya dadantii 3937]
 gi|306527686|gb|ADM97616.1| dTDP-4-dehydrorhamnose reductase [Dickeya dadantii 3937]
          Length = 287

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 121/289 (41%), Positives = 167/289 (57%), Gaps = 8/289 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G NGQ+ +       +  E+      ++D+   +   +   ++ PDVI+N AAY
Sbjct: 1   MKVLLTGANGQLGRCFQDRLPEGWEVWTTDSDELDITNREQVLTAIAAYPPDVIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE A  +N  G   +A AA  +G   +++STDYVFDG +  P  E  PTNP
Sbjct: 61  TAVDKAESEPEQAVLVNKAGPENLALAAKLVGARLVHVSTDYVFDGKATVPYVETDPTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG++KL GE  V +     +I+RTAWV+S +G+NF+ +MLRL KER  +SVV DQ G
Sbjct: 121 LGVYGQTKLDGERAVVAVLPESIIIRTAWVFSEYGNNFVKTMLRLGKEREMLSVVADQRG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG--G 238
            PT A  IA+AII +    ++       G++H   D   VSW  FA  IF  + E+    
Sbjct: 181 CPTYAGDIAQAIIILLQQQVDTG-----GLYHFCGD-EEVSWHGFASAIFTIAGEQQTLT 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               V  I T+QYPT A RPAYS LDCSK+     I+ S W+E +  I+
Sbjct: 235 KVPVVNAITTEQYPTPAARPAYSTLDCSKITQLVGIQPSAWREALGIII 283


>gi|126654758|ref|ZP_01726292.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Cyanothece sp.
           CCY0110]
 gi|126623493|gb|EAZ94197.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Cyanothece sp.
           CCY0110]
          Length = 292

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 121/292 (41%), Positives = 166/292 (56%), Gaps = 7/292 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+ G++GQ+ Q L        E+I   R  +DL  P +         PD+IIN AAYT
Sbjct: 3   KILLTGSDGQVGQDLQQTLSPIGEVIATNRQQLDLTSPDNIRQVIQKIQPDIIINSAAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE E ++AF++N      IA+ A  IG   ++ISTDYVFDG   TP  E   T+PL
Sbjct: 63  AVDKAESESDLAFAVNGVAPAIIAEEAKKIGAFLLHISTDYVFDGKKNTPYLETDITHPL 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQFG 180
            +YGKSKLAGE+ +    + YVILRTAWVY   G  NF+ +MLRL +++ ++ +V DQ G
Sbjct: 123 GVYGKSKLAGEQGIEKNGDRYVILRTAWVYGTEGKGNFVKTMLRLGQQKEQLGIVSDQVG 182

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT +  IA  I QI   L   +    R I+H T + G  SW D A  IF E+   G P 
Sbjct: 183 SPTWSYDIANTISQILTKL---NLAETREIYHFT-NSGVASWYDLAVAIFEEAKNLGFPL 238

Query: 241 S--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           +  +V  I T++YPT A RP YS L   K AN        W++ ++ +L+ +
Sbjct: 239 NIKQVNPITTEEYPTPAKRPHYSVLSGKKTANLLGYNAPYWRDSLKEMLIKL 290


>gi|172037461|ref|YP_001803962.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Cyanothece sp. ATCC 51142]
 gi|171698915|gb|ACB51896.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Cyanothece sp. ATCC 51142]
          Length = 293

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 118/290 (40%), Positives = 167/290 (57%), Gaps = 7/290 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+ G++GQ+ Q L    V   E++   R  +DL  P +         PD+I+N AAYT
Sbjct: 3   KILLTGSDGQVGQDLQQTLVPIGEVVATNRQQLDLTSPNNIRQVIQEIQPDIIVNSAAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE E ++AF+INA     +A+ A  IG   ++ISTDYVFDG   TP  E   T+PL
Sbjct: 63  AVDKAESESDLAFAINAIAPAIMAEEAKKIGAFLLHISTDYVFDGTQNTPYLETDKTHPL 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQFG 180
            +YG+SKLAGE+ +    + YVILRTAWVY   G  NF+ +MLRL +E+ ++ +V DQ G
Sbjct: 123 GVYGQSKLAGEQGIEKNGDRYVILRTAWVYGTEGKGNFVKTMLRLGQEKEQLGIVSDQVG 182

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPT +  IA  I Q+   L + +    R I+H T + G  SW D A  +F E+   G P 
Sbjct: 183 TPTWSYDIANTISQM---LTQLNLAETREIYHFT-NSGVASWYDLAVAVFEEAKNIGFPL 238

Query: 241 S--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
           +  ++  I T++YPT A RP YS L   K A         W++ ++ +L+
Sbjct: 239 NIKQINPITTQEYPTPAKRPHYSVLSGKKTAKLLGYNAPYWRDSLKKMLI 288


>gi|152978506|ref|YP_001344135.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus succinogenes 130Z]
 gi|150840229|gb|ABR74200.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus succinogenes 130Z]
          Length = 291

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 124/290 (42%), Positives = 174/290 (60%), Gaps = 10/290 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+ G  GQ+   L+       EI+ V R  +D+       +  +SF PDVIIN AA+T
Sbjct: 3   KFLITGAKGQVGYCLTQQLTGKAEILAVDRDGLDITDQSAVRNAVISFQPDVIINAAAHT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE E E++ +IN +G   +A+AA+ IG   ++ISTDYVF+G       E   TNP 
Sbjct: 63  AVDRAETEVELSEAINVKGPQYLAEAANEIGAAILHISTDYVFEGNGTNEYQEDDQTNPQ 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
            +YG++KLAGE  V      +++LRTAWV+   G+NF+ +M+RL KER  + VV DQFG 
Sbjct: 123 GVYGRTKLAGEIAVQQANPKHIVLRTAWVFGERGNNFVKTMIRLGKEREVLGVVGDQFGG 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAER---- 236
           PT A  IA A+I IA+ +I N  T + G++H T  G P VSWA+FA+ IF E+  +    
Sbjct: 183 PTYAGDIAAALIHIANEII-NGKTDVFGVYHFT--GKPYVSWAEFAKAIFNEAVSQKILE 239

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
             P   V  I T +YPT A RPA S L+  K+  T  I+ S W++ ++NI
Sbjct: 240 KSPL--VNAIATHEYPTPAKRPANSRLNLDKIDRTFGIKPSDWQKALKNI 287


>gi|282898470|ref|ZP_06306460.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Raphidiopsis brookii
           D9]
 gi|281196636|gb|EFA71542.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Raphidiopsis brookii
           D9]
          Length = 303

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 121/296 (40%), Positives = 175/296 (59%), Gaps = 16/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G +GQ+   L    +   ++I +GR ++DL + +   S      PD+I+NPAAY
Sbjct: 1   MKILLTGISGQVGWELQRSLMTVGDVICLGRNELDLSRCETITSTIREIKPDLIVNPAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE EP++A SIN    G +A+ A  +G   I+ STDYVFDG   TP  E   T P
Sbjct: 61  TAVDRAESEPDLAMSINGVAPGILAEEAKRLGGAIIHYSTDYVFDGNQNTPYKENDSTFP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YGK+KLAGE+ + +   N++I RT+WVY + G+NFLL+M RLAKER EI VV DQ G
Sbjct: 121 QNVYGKTKLAGEKAIQAVGVNHLIFRTSWVYGLRGNNFLLTMQRLAKEREEIRVVDDQIG 180

Query: 181 TPTSALQIARAIIQI-----------AHNLIENSDTSLRGIFHMTADGGPVSWADFAEYI 229
           +PT +  IA    Q+             + + N      GI+H++++ G  SW  FA+ I
Sbjct: 181 SPTWSRMIAEVTAQMIAQIRCQMVISGGDYLANFMAEKGGIYHLSSE-GKTSWYGFAKAI 239

Query: 230 FWE--SAERGGPY--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKE 281
             +  + ++ G Y   ++  I T +YPT A RP YS LD  KL +T  ++IS W++
Sbjct: 240 LIDKFADDQYGQYKLQRLVPITTPEYPTPAPRPGYSLLDNQKLFDTFGLKISNWQQ 295


>gi|1944161|dbj|BAA19635.1| dTDP-4-rhamnose reductase [Aggregatibacter actinomycetemcomitans]
          Length = 292

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 124/290 (42%), Positives = 166/290 (57%), Gaps = 10/290 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+ G NGQ+   L+       EI+ V   ++D+           +F PDV+IN AA+T
Sbjct: 3   KFLITGANGQVGYCLTQQLQGKHEILAVDHDELDITNQNAVKKTVENFRPDVVINAAAHT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE E E++ +IN +G   +A+ A S+G   ++ISTDYVFDG       E    +P 
Sbjct: 63  AVDRAETEIELSEAINVKGPQYLAETAKSVGAAILHISTDYVFDGRRAGKYKETDAVDPQ 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
            IYGK+KLAGE+ V    + +++LRTAWV+   GSNF+ +MLRLAK R  + VV DQ G 
Sbjct: 123 GIYGKTKLAGEQAVVEANDKFIVLRTAWVFCEHGSNFVKTMLRLAKTRDTLGVVADQIGG 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG--- 237
           PT A  IA A+IQIA  +I        GI+H T  G P VSW DFA  IF E+  +    
Sbjct: 183 PTYAGDIAAALIQIAEKIIAGESVEY-GIYHFT--GEPYVSWCDFARAIFDEAVSQNMLE 239

Query: 238 -GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
             P   V  I T  YPT A RPA SCLD +K+     I+ S W+  ++NI
Sbjct: 240 KAPL--VNAIITADYPTPAKRPANSCLDLTKIQQAFGIQPSDWQRALKNI 287


>gi|330806982|ref|YP_004351444.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375090|gb|AEA66440.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 289

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 118/289 (40%), Positives = 167/289 (57%), Gaps = 2/289 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+IG NGQ++++L S      E+I  G   +DL +P    +   +  P +IIN AA+
Sbjct: 1   MRILIIGQNGQVSRALQSRLSGLGELIVRGSDQLDLAQPDSLRAPIEALKPGLIINAAAH 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE EPE AF+INA   G +A+AA ++G+P I+ STDYVFDGL   P  E    NP
Sbjct: 61  TAVDQAESEPERAFAINATAPGILAQAAVALGVPLIHYSTDYVFDGLKPAPYTEDDTPNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L++YG+SKLAGE  +      ++ILRT+WVYS  G NFLL+M RL +E+ ++ VV DQ G
Sbjct: 121 LSVYGRSKLAGENAIRQAGGQHLILRTSWVYSTEGRNFLLTMQRLLQEKPQLRVVADQVG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT A  IA +  Q+     +       G +H+TA  G  SW  FA+ I     +R  P 
Sbjct: 181 APTWAGTIADSTAQLIERW-QAGQPGAWGTYHLTAR-GETSWFGFAQAIGENLLDRHKPC 238

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           + +  I +  YPT A RP  S LDC++L     +    W+  ++  L  
Sbjct: 239 ALLEPIESSAYPTPAPRPLNSRLDCTRLFKEWGVSQPDWRSALQQCLAG 287


>gi|240948931|ref|ZP_04753287.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus minor NM305]
 gi|240296746|gb|EER47357.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus minor NM305]
          Length = 292

 Score =  218 bits (556), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 122/289 (42%), Positives = 171/289 (59%), Gaps = 8/289 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+ G  GQ+   L+       EI+ V R ++D+           +F PDVIIN AA+T
Sbjct: 3   KFLITGAKGQVGHCLTEQLTGKAEILAVDRDELDITDQSAVKKIVKTFKPDVIINAAAHT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE E E++ +IN +G   +A+AA+ IG   ++ISTDYVF+G       E   TNP 
Sbjct: 63  AVDRAESEVELSEAINVKGPQYLAEAANEIGAMILHISTDYVFEGTGSGEYKEDDQTNPQ 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
            +YG++KLAGE  V    +  +ILRTAWV+   G NF+ +MLRLAK+R  + +V DQFG 
Sbjct: 123 GVYGRTKLAGEIAVQQANSRSIILRTAWVFGEHGHNFVKTMLRLAKDRDSLGIVGDQFGG 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGPY 240
           PT A  IA+ +I+IA+ ++   + +  G++H T  G P VSW +FA+ IF E AE     
Sbjct: 183 PTYAGDIAKTLIEIANQILAGKEDAF-GVYHFT--GKPYVSWYEFAKAIFAE-AELQNIL 238

Query: 241 SK---VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
            K   V  I T  YPT A RPA S LD +K+    NI  S W++ ++NI
Sbjct: 239 EKSPLVNSIATSDYPTPAKRPANSRLDLTKIKQVFNIEPSNWQKALKNI 287


>gi|307153969|ref|YP_003889353.1| dTDP-4-dehydrorhamnose reductase [Cyanothece sp. PCC 7822]
 gi|306984197|gb|ADN16078.1| dTDP-4-dehydrorhamnose reductase [Cyanothece sp. PCC 7822]
          Length = 294

 Score =  218 bits (555), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 170/292 (58%), Gaps = 8/292 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G+NGQ+ Q L +      EII V R  +DL + +          P++I+N AAYT
Sbjct: 3   RILLLGSNGQLGQELQTTLAPLGEIISVARDQLDLTQTESIRQLIAQVHPEMIVNAAAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE E E+A+++N      +A+ +  +    +++STDYVFDG    P+ E   TNP+
Sbjct: 63  AVDKAESETELAYAVNEIAPKILARESQKLAATFLHVSTDYVFDGTRGIPLTETDETNPI 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQFG 180
            +Y KSKLAGE+ +A     Y+ILRTAWVY  +G SNF+ ++LRL  ER ++ VV DQ G
Sbjct: 123 GVYAKSKLAGEKAIAENCERYIILRTAWVYGTYGKSNFVKTLLRLGAEREQLRVVADQVG 182

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPT A  IA AI +    L+E  + +  GI+H T + G  SW DFA  IF E+   G P 
Sbjct: 183 TPTWAKDIADAIAK----LLELEEKTPTGIYHFT-NSGVASWYDFARAIFEEAKLIGFPL 237

Query: 241 --SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             ++V  I T +YPT A RPAYS L   K+          W++ ++ +L  +
Sbjct: 238 KINEVVPITTAEYPTPAKRPAYSVLSQQKIRPLLGNYPPYWRDSLKQMLFQL 289


>gi|330873322|gb|EGH07471.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 301

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 120/301 (39%), Positives = 171/301 (56%), Gaps = 13/301 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID-----LLKPKDFASFFLSFSPDVII 55
           MK L++G NGQ+   L        E+I + R   D     L   +   +   + +PDVI+
Sbjct: 1   MKILLLGKNGQVGWELQRSLAALGEVIALDRQGADGLCGDLADLEGLTATIHTLAPDVIV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVDKAE EP++A  IN E  G +A+ A ++G   ++ STDYVFDG   +   E 
Sbjct: 61  NAAAYTAVDKAESEPDVALLINGEAPGVLAREAAALGAWLVHYSTDYVFDGSGDSQWQED 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
           +PT PL++YG+SKL GE+ + +     ++LRT+WVY+  GSNF  +MLRLA ER  ++VV
Sbjct: 121 APTGPLSVYGRSKLMGEQAIQASGAKALVLRTSWVYAAKGSNFAKTMLRLAAERDSLNVV 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDT-SLRGIFHMTADGGPVSWADFAEYIFWESA 234
            DQ+G PT A  IA     I   ++ + D+ +L GI+H+ A  G  SW  FA ++  E A
Sbjct: 181 SDQYGAPTGAELIADVTAHILRRVLGDQDSAALAGIYHLAA-AGETSWHGFARFVL-EHA 238

Query: 235 ERGG-----PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           ER G        KV  I T+ YP  A RP  S L   KL  T  +++  W++G + +L  
Sbjct: 239 ERNGVALKVSADKVGAIATEAYPLPAPRPHNSRLALGKLETTFQLKMPPWQQGAQRMLDE 298

Query: 290 I 290
           I
Sbjct: 299 I 299


>gi|306842187|ref|ZP_07474856.1| dTDP-4-dehydrorhamnose reductase [Brucella sp. BO2]
 gi|306287774|gb|EFM59205.1| dTDP-4-dehydrorhamnose reductase [Brucella sp. BO2]
          Length = 249

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 113/240 (47%), Positives = 153/240 (63%), Gaps = 1/240 (0%)

Query: 48  SFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGL 107
           +  PD++++ AAYTAVD AEDE E+AF++NA GA A+A+A+ + G+P I++STDYVF G 
Sbjct: 7   AIKPDLVVSAAAYTAVDLAEDEQELAFAVNAIGAEAVAEASKNCGVPVIHLSTDYVFAGD 66

Query: 108 SRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAK 167
           +  P  E   T P ++YG+SKL GE  VA     ++ILRTAWVYS FG NF+ +ML+LA+
Sbjct: 67  ADEPYAETDVTGPRSVYGRSKLEGERLVAHANPRHIILRTAWVYSPFGKNFVKTMLKLAE 126

Query: 168 ERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAE 227
            R  +SVV DQ+G PTSAL IA AIIQ+A +L    + S  G++H+    G  +W+ FA 
Sbjct: 127 TRGALSVVSDQWGNPTSALDIADAIIQVADHLAATPEFSAYGVYHLVG-AGDTNWSGFAR 185

Query: 228 YIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            IF ESA  GGP + V  I T  YPTKA RP  S L   K         S W+  +  ++
Sbjct: 186 AIFDESARLGGPTATVTDIATADYPTKAARPMNSRLSTEKFQAAFGWSPSHWEASLAQVM 245


>gi|85707418|ref|ZP_01038499.1| hypothetical protein ROS217_12331 [Roseovarius sp. 217]
 gi|85668074|gb|EAQ22954.1| hypothetical protein ROS217_12331 [Roseovarius sp. 217]
          Length = 281

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 119/291 (40%), Positives = 165/291 (56%), Gaps = 14/291 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G  GQ+A  L  +     E++ +GR + DL +P   A+     +PD++IN AAY
Sbjct: 1   MKILVFGRTGQVATELQRL----AEVVALGRDEADLTQPDRCAAAIRDHAPDLVINAAAY 56

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+A++E  +A  IN    GA+A+A   +GIP  ++STDYVFDG    P     P  P
Sbjct: 57  TAVDRAQEEETLATVINGAAPGAMARACADLGIPFCHVSTDYVFDGSGTAPRQPSDPVAP 116

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N YG+SKLAGEE V +      ILRT+WV+S  G+NF+ +MLRL++ R  ++VV DQ G
Sbjct: 117 CNAYGRSKLAGEEAVRAAGGQSAILRTSWVFSAHGNNFVRTMLRLSETRDALNVVEDQIG 176

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A  IA A++ +   ++        G++H +  G P  SWA+FA  IF     R G 
Sbjct: 177 GPTPAADIAAALLTMGRAMVAGHAG---GLYHFS--GAPDASWAEFAREIF----ARAGR 227

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            + V  I T  YPT A RP  S LDC  L     I    W++GV  +L ++
Sbjct: 228 ATTVTGIPTSAYPTPAARPLNSRLDCGTLTAEFGIARPDWRDGVSRVLEHL 278


>gi|71735408|ref|YP_273240.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555961|gb|AAZ35172.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 301

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 172/301 (57%), Gaps = 13/301 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID-----LLKPKDFASFFLSFSPDVII 55
           MK L++G NGQ+   L        E+I + R   D     L   +   +     +PDVI+
Sbjct: 1   MKILLLGKNGQVGWELQRSLAALGEVIALDRQGADGLCGDLADLEGLTATIRKLAPDVIV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVDKAE EP++A  IN+E  G +A+ A ++G   I+ STDYVFDG   +   E 
Sbjct: 61  NAAAYTAVDKAESEPDLAVLINSEAPGVLAREAAALGAWLIHYSTDYVFDGSGDSQWQEN 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
           +PT PL++YG+SKL GE+ + +     ++LRT+WVY+  G+NF  +MLRLA ER  ++VV
Sbjct: 121 APTGPLSVYGRSKLMGEQAIQASGAKALVLRTSWVYAAKGNNFAKTMLRLASERDSLNVV 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDTS-LRGIFHMTADGGPVSWADFAEYIFWESA 234
            DQ+G PT A  IA     + H ++ +  ++ LRG++H+ A  G  SW  FA ++  E A
Sbjct: 181 ADQYGAPTGAELIADVTAHMLHRVLGDKHSAELRGVYHLAA-AGETSWHGFARFVL-EHA 238

Query: 235 ERGG-----PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           ER G        K+  I T+ YP  A RP  S L   KL  T  +++  W++G + +L  
Sbjct: 239 ERNGVQLKVSSDKIGAIPTEAYPLPAPRPHNSRLALGKLETTFQLKMPPWQQGAQRMLDE 298

Query: 290 I 290
           I
Sbjct: 299 I 299


>gi|16264651|ref|NP_437443.1| putative dTDP-4-dehydrorhamnose reductase protein [Sinorhizobium
           meliloti 1021]
 gi|15140789|emb|CAC49303.1| putative dTDP-4-dehydrorhamnose reductase protein WgaJ (formerly
           ExpA10) [Sinorhizobium meliloti 1021]
          Length = 300

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 125/289 (43%), Positives = 175/289 (60%), Gaps = 3/289 (1%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+  V G  GQ+A  L   S     +E++ +GRP +DL +P           PD++++ A
Sbjct: 1   MRIAVTGCEGQLALGLVERSHRRSGMEVVTIGRPHLDLTEPATILPAIERCRPDLVVSAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD+AE EPE AF++NA GAGA+A+AA  + +P ++ISTDYVFDG       E    
Sbjct: 61  AYTAVDQAESEPEAAFAVNAFGAGAVAEAAACLEVPIVHISTDYVFDGSKPRSYAEGDTP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            PL++YG SKLAGE  VA  T  ++ILRT WVYS FG NF+ ++LRLA+ER +I+VV DQ
Sbjct: 121 APLSVYGASKLAGESAVAEATPRHLILRTGWVYSPFGKNFVKTILRLAEEREDIAVVADQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            G P+SA+ +A AI+ I+  L ++   +  G++H+ A  G VS ADFA +    S   GG
Sbjct: 181 RGNPSSAIDLADAILDISARLTKSRQDAAFGLYHL-AGSGVVSRADFARHALAASRAAGG 239

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           P++ V  I T  +PT A RPA S L  +K   T    +  W+  V   +
Sbjct: 240 PWAHVRDIATGGFPTPASRPANSSLSSAKFNATFGQAMPAWQGSVERTV 288


>gi|327478700|gb|AEA82010.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas stutzeri DSM 4166]
          Length = 304

 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 113/280 (40%), Positives = 159/280 (56%), Gaps = 2/280 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G+ GQ+A+ L S      +++ +G   +DL  P+          PD+IIN AAY
Sbjct: 1   MKILITGSTGQLARELQSELAGTGKLLALGHNALDLAVPEQIREQVRLLRPDLIINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD AE   E AF++NA G   +A+ A  +G+P I+ STDYVFDG    P DE    NP
Sbjct: 61  TAVDPAETHREQAFAVNARGPQVLAEEAARLGVPLIHYSTDYVFDGRKAEPYDEHDTPNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG SKLAGE+ + +    ++ILRT+WVYS  G NFLL+M RL +ER  +SVV D+ G
Sbjct: 121 LGVYGASKLAGEQAIQAVGGEHLILRTSWVYSRHGKNFLLTMQRLLQERDALSVVSDEVG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT A  IAR   ++             G++H+TA  G  SW  FA  I     + G   
Sbjct: 181 APTWAATIARVTAELVRKR-NTGQAGPSGLYHLTAS-GETSWYGFACSIAERLRQEGRLR 238

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
           +++  I +K YPT A RP  S L+C++L     +++  W+
Sbjct: 239 AEITPILSKDYPTAAQRPLNSRLNCARLQQDWGVQLPDWE 278


>gi|259414812|ref|ZP_05738735.1| dTDP-4-dehydrorhamnose reductase [Silicibacter sp. TrichCH4B]
 gi|259349263|gb|EEW61010.1| dTDP-4-dehydrorhamnose reductase [Silicibacter sp. TrichCH4B]
          Length = 290

 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 128/288 (44%), Positives = 161/288 (55%), Gaps = 13/288 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M  LV G  GQ+A+ L+S       +I VGR   DL  P   A+     SP  +IN AAY
Sbjct: 10  MSILVFGATGQVARELASY----EGVISVGRARADLSDPGACATLIREISPQAVINAAAY 65

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE E E+A  IN    GA+  A    GIP ++ISTDYVF G          P  P
Sbjct: 66  TAVDKAESEEELATIINGAAPGAMVAACVQAGIPFVHISTDYVFAGSGTAAWQTDDPVAP 125

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N YG+SK AGEE V +    YVILRT+WV S  G+NF+ +MLRL  ER  +++V DQ G
Sbjct: 126 PNAYGRSKRAGEEAVIAAGGTYVILRTSWVVSAHGNNFVKTMLRLGAERDRLTIVGDQIG 185

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A  IARA +++A  L   ++ +  GI+H+   G P VSWA FA  IF +S    G 
Sbjct: 186 APTPARDIARACVEMAGQL--RAEPAKSGIYHL--QGAPYVSWAGFAAEIFAQS----GL 237

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             +V  I T  YPT A RP  S LDC+ L     I    W+ G+R+IL
Sbjct: 238 ACEVADIPTSDYPTPAVRPLNSRLDCTTLETVFGIPQPDWRSGLRDIL 285


>gi|217970540|ref|YP_002355774.1| dTDP-4-dehydrorhamnose reductase [Thauera sp. MZ1T]
 gi|217507867|gb|ACK54878.1| dTDP-4-dehydrorhamnose reductase [Thauera sp. MZ1T]
          Length = 296

 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 123/298 (41%), Positives = 172/298 (57%), Gaps = 12/298 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKP--KDFASF---FLSFSPDVII 55
           MK L++G NGQ+   L         ++ + R   D L    +D         S +PDVI+
Sbjct: 1   MKILLLGKNGQVGWELQRALAPVGTVVALDRGGADGLHGDLEDLDGIDRTVRSLAPDVIV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVDKAE + E A  INAE  G +A+AA ++G   ++ STDYVFDG   TP  E 
Sbjct: 61  NAAAYTAVDKAETDVERAQRINAEAPGVLARAAATVGALLVHYSTDYVFDGSGDTPWREN 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
           +PT PL++YG+SKLAGEE + +    ++ILRT+WVY+  G NF  +MLRLA ER  ++V+
Sbjct: 121 APTAPLSVYGRSKLAGEEAIRAAGCRHLILRTSWVYAARGGNFARTMLRLAAERERLTVI 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
            DQ G PT A  IA      AH L  E++D SL G +H+ A GG  SW  +A ++  ++ 
Sbjct: 181 ADQHGAPTGAELIADV---SAHALRAEHADRSLGGTYHLAA-GGETSWHGYASFVIEQAR 236

Query: 235 ERGGPY--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           + G      ++  I T+ YPT A RP  S LD S+L     + +  W++GV  +L  I
Sbjct: 237 KLGATLKAGEIAPIGTRDYPTAAARPLNSRLDTSRLRERFGLALPDWRDGVARMLREI 294


>gi|122934727|gb|ABM68332.1| RmlD [Geobacillus tepidamans]
          Length = 282

 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 162/288 (56%), Gaps = 13/288 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK +V G NGQ+ Q L     Q + E+    + D+D+              PD+IIN AA
Sbjct: 1   MKIVVTGANGQLGQELVRQLQQTNFELYSFTKSDLDITNESIVNEVITKIKPDIIINAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VD+AE E E A+ +NA G  ++A AA+ +G    YISTDYVFDG S  P  E+  TN
Sbjct: 61  YTKVDQAEIEEETAYLVNAFGQRSLAVAAEKVGAKICYISTDYVFDGNSAIPYREYDQTN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YGKSKL GEE   S  + Y I+RTAWVY  FG NF+ +MLRLAKE+ EI VV DQ 
Sbjct: 121 PLGVYGKSKLVGEELTKSLCSRYFIVRTAWVYGEFGQNFVKTMLRLAKEKEEIGVVNDQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT         + +AH +IE   T   GI+H T +    SW +FA+ IF ES  +   
Sbjct: 181 GSPTYT-------VDLAHFIIELVQTEKFGIYHAT-NSEACSWYEFAKAIFEESNIK--- 229

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             KV  I T+Q+P  A RP YS LD   +       +  W+E ++  L
Sbjct: 230 -VKVNPITTEQFPRPAARPKYSVLDNFAMKVNGFPMLRHWREALKEFL 276


>gi|146280478|ref|YP_001170631.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas stutzeri A1501]
 gi|14717006|emb|CAC44168.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas stutzeri]
 gi|145568683|gb|ABP77789.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas stutzeri A1501]
          Length = 304

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 113/280 (40%), Positives = 159/280 (56%), Gaps = 2/280 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G+ GQ+A+ L S      +++ +G   +DL  P+          PD+IIN AAY
Sbjct: 1   MKILITGSKGQLARELQSELAGTGKLLALGHNALDLAVPEQIREQVRLLRPDLIINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD AE   E AF++NA G   +A+ A  +G+P I+ STDYVFDG    P DE    NP
Sbjct: 61  TAVDPAETHREQAFAVNARGPQVLAEEAARLGVPLIHYSTDYVFDGRKTEPYDEHDTPNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG SKLAGE+ + +    ++ILRT+WVYS  G NFLL+M RL +ER  +SVV D+ G
Sbjct: 121 LGVYGASKLAGEQAIQAVGGEHLILRTSWVYSQHGKNFLLTMQRLLQERDALSVVSDEVG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT A  IAR   ++             G++H+TA  G  SW  FA  I     + G   
Sbjct: 181 APTWAATIARVTAELVRKR-NAGQAGPSGLYHLTAS-GETSWYGFACSIAERLRQEGRLR 238

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
           +++  I +K YPT A RP  S L+C++L     +++  W+
Sbjct: 239 AEITPILSKDYPTAAQRPLNSRLNCARLQQDWGVQLPDWE 278


>gi|329897710|ref|ZP_08272188.1| dTDP-4-dehydrorhamnose reductase [gamma proteobacterium IMCC3088]
 gi|328921057|gb|EGG28469.1| dTDP-4-dehydrorhamnose reductase [gamma proteobacterium IMCC3088]
          Length = 301

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 128/293 (43%), Positives = 171/293 (58%), Gaps = 9/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDV-EIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           +K LV G+NGQ+      +      + I   R  +D+   +  A       P V+IN AA
Sbjct: 8   VKILVTGSNGQVGHDFKCLAENSRHDWICFDRKGLDISDEQQVADVIARERPHVVINCAA 67

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE EP+ AF+INA GA  +AKA  + G   I+ISTDYVF G +  P +E  PT 
Sbjct: 68  YTAVDKAESEPDRAFAINAYGAANLAKACQAHGAALIHISTDYVFAGDTLAPYEESDPTG 127

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P  IYG+SKLAGE+ +A Y   ++ILRTAWV+   G+NF+ +MLRL  ER E+ VV DQ+
Sbjct: 128 PTGIYGESKLAGEQAIAEYLERHIILRTAWVFGAHGNNFVKTMLRLGAERDELGVVADQW 187

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSL--RGIFHMTADGGP-VSWADFAEYIFWESAER 236
           G PTSA  IA   + IA  +I+  D +    GI+H T  G P  SW  FAE IF ++   
Sbjct: 188 GAPTSAAGIAACCLAIA-EIIDAKDCAEIPWGIYHFT--GLPSTSWHGFAEKIFKDAVAI 244

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G      KV  I + Q+PT A RP+ S LDCSK+ N   I    W++ + ++L
Sbjct: 245 GLLDKAPKVNAISSDQFPTPAKRPSNSQLDCSKIFNCFQITPDNWEDRLLDVL 297


>gi|50982341|gb|AAT91794.1| putative dTDP-L-rhamnose processing protein [Yersinia
           enterocolitica]
          Length = 292

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 119/291 (40%), Positives = 179/291 (61%), Gaps = 8/291 (2%)

Query: 1   MKCLVIGNNGQIAQSL-SSMCVQD-VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ ++ G +GQ+  SL      QD VE++  GR ++D+            F PD IIN A
Sbjct: 1   MRVIITGAHGQVGCSLVEKFQDQDKVELLATGRDELDITNQSAVDEIIEQFKPDYIINSA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAE+E E++++IN +G   +AKAA+ +G   ++ISTDYVFDG +    +E SPT
Sbjct: 61  AYTAVDKAEEEIELSYAINHDGVAHLAKAANKMGAVLLHISTDYVFDGENEAAYEETSPT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P +IYGKSKLAGE  +A   + ++I+RT+WV+   G+NF+ +MLRL      +S+V DQ
Sbjct: 121 KPKSIYGKSKLAGELAIAEAMDKFLIVRTSWVFGTHGNNFVKTMLRLGTTHECLSIVGDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT +  IA A++++    I++ +T   G +H +  G P VSW +FA+ IF ++ ++ 
Sbjct: 181 FGGPTYSDDIANALVKMV-KFIDDGNTPEWGCYHFS--GEPHVSWYEFAKVIFNKARDKK 237

Query: 238 --GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
                  +  I T +YPT+A RPA S L+C+K+    NI  S W+  + NI
Sbjct: 238 IIDKLPTLSPINTSEYPTRASRPANSRLNCNKIKAQFNIEPSNWQVALNNI 288


>gi|320325877|gb|EFW81937.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320330328|gb|EFW86311.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 301

 Score =  215 bits (548), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 119/301 (39%), Positives = 170/301 (56%), Gaps = 13/301 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID-----LLKPKDFASFFLSFSPDVII 55
           MK L++G NGQ+   L        E+I + R   D     L   +   +     +PDVI+
Sbjct: 1   MKILLLGKNGQVGWELQRSLAALGEVIALDRQGADGLCGDLADLEGLTATIRKLAPDVIV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVDKAE EP++A  IN E  G +A+ A ++G   I+ STDYVFDG   +   E 
Sbjct: 61  NAAAYTAVDKAESEPDVAVLINGEAPGVLAREAAALGAWLIHYSTDYVFDGSGDSQWQEN 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
           +PT PL++YG+SKL GE+ + +     ++LRT+WVY+  G+NF  +MLRLA ER  ++VV
Sbjct: 121 APTGPLSVYGRSKLMGEQAIQASGAKALVLRTSWVYAAKGNNFAKTMLRLASERDSLNVV 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDT-SLRGIFHMTADGGPVSWADFAEYIFWESA 234
            DQ+G PT A  IA     I H +  + D+ +L G++H+ A  G  SW  FA ++  E A
Sbjct: 181 ADQYGAPTGAELIADVTAHILHRVSGDQDSATLAGVYHLAA-AGETSWHGFARFVL-EHA 238

Query: 235 ERGG-----PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           ER G        K+  I T+ YP  A RP  S L   KL  T  +++  W++G + +L  
Sbjct: 239 ERNGVQLKVSSDKIGAIPTEAYPLPAPRPHNSRLALGKLETTFQLKMPPWQQGAQRMLDE 298

Query: 290 I 290
           I
Sbjct: 299 I 299


>gi|303252479|ref|ZP_07338643.1| hypothetical protein APP2_1455 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307248514|ref|ZP_07530532.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|302648680|gb|EFL78872.1| hypothetical protein APP2_1455 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306854990|gb|EFM87175.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 291

 Score =  215 bits (547), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 122/290 (42%), Positives = 170/290 (58%), Gaps = 10/290 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L+ G  GQ+   L+       +++ V R ++D+            F PDVIIN AA+T
Sbjct: 3   RFLITGAKGQVGYCLTKQLQSKADVLAVDRDELDITNRDAVFKVVREFHPDVIINAAAHT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE E E++ +IN +G   +A+AA+ I    ++ISTDYVF+G       E    NP 
Sbjct: 63  AVDRAESEIELSEAINVKGPQYLAEAANEIDAIILHISTDYVFEGTGSGEYKENDEPNPQ 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
            +YGK+KLAGE  V      ++ILRTAWV+   G+NF+ +MLRLAKER  + +V DQFG 
Sbjct: 123 GVYGKTKLAGEIAVQQANKRHIILRTAWVFGEHGNNFVKTMLRLAKERESLGIVSDQFGG 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAER---- 236
           PT A  IA ++I IA N+I NS   + G++H T  G P VSWADFA+ IF E+  +    
Sbjct: 183 PTYAGDIASSLIHIA-NIILNSKIDVFGVYHFT--GKPYVSWADFAKKIFDEAVSQKVLE 239

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
             P   V  I T  YPT A RPA S LD +K+     I+ S W++ ++NI
Sbjct: 240 KAPL--VNFIATSNYPTSAKRPANSRLDLTKIDEVFGIKPSNWQQALKNI 287


>gi|167623419|ref|YP_001673713.1| dTDP-4-dehydrorhamnose reductase [Shewanella halifaxensis HAW-EB4]
 gi|167353441|gb|ABZ76054.1| dTDP-4-dehydrorhamnose reductase [Shewanella halifaxensis HAW-EB4]
          Length = 293

 Score =  215 bits (547), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 175/291 (60%), Gaps = 8/291 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVE--IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ L+ G NGQ+  SL+    +D    ++ + R  +D+       +  + F P +IIN A
Sbjct: 1   MRVLITGCNGQVGCSLTEQLAKDTNTTVLALDRDYLDITNLDAVHAAVVEFKPSIIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAE+E E++++IN +G   +A+AA  +G   ++ISTDYVF+G       E   T
Sbjct: 61  AHTAVDKAEEEVELSYAINRDGPKYLAQAAQDVGAAILHISTDYVFEGNKVGEYVESDTT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           NP  +YG+SKLAGE  VA   + ++ILRTAWV+   G+NF+ +MLRL   R  ++VV DQ
Sbjct: 121 NPQGVYGESKLAGEVAVAQACDKHIILRTAWVFGENGNNFVKTMLRLGTTRDALNVVGDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA A+IQIA N I   D    G++H +  G P VSW +FAE IF  + E+G
Sbjct: 181 FGGPTYAGDIANALIQIA-NRITQGDAIEYGVYHFS--GLPHVSWYEFAETIFDIAIEKG 237

Query: 238 GPYSK--VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
               +  +  I T+QYPT A RP+ SCL+  K+ +   I  S WK  + NI
Sbjct: 238 VLKKRPSLSNIKTEQYPTPAKRPSNSCLNTDKITSVFAIEASDWKVALNNI 288


>gi|150376858|ref|YP_001313454.1| dTDP-4-dehydrorhamnose reductase [Sinorhizobium medicae WSM419]
 gi|150031405|gb|ABR63521.1| dTDP-4-dehydrorhamnose reductase [Sinorhizobium medicae WSM419]
          Length = 300

 Score =  215 bits (547), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 122/285 (42%), Positives = 169/285 (59%), Gaps = 3/285 (1%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ +V G  GQ+A+SL   +  +   E+I +GRP +DL  P    +      PD++++ A
Sbjct: 1   MRIVVTGCKGQLARSLLEQARGLPGTEVILIGRPQLDLTDPPTILAAIEPHRPDLVVSAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVD+AE EPE AF++NA GA A+A AA S+G P +++STDYVFDG       E    
Sbjct: 61  AFTAVDQAEGEPETAFAVNAFGAEAVAGAAASLGAPVLHVSTDYVFDGSKHGSYAEDDMP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P+++YG SKLAGE  VA     +VILRT WVYS FG NF+ ++LRLA ER EI+VV DQ
Sbjct: 121 APVSVYGASKLAGELAVAEANPRHVILRTGWVYSPFGKNFIKTILRLAGEREEIAVVADQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
           +G PTSAL +A AI+ I+  L       + G++H+ A  G  S AD A +    S   GG
Sbjct: 181 WGNPTSALDLADAILGISAQLTRCGRDFVFGLYHL-AGAGTTSRADLARHALSASRAEGG 239

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
           P++ V  + T  +PT A RP  S L  +K        +  W+  V
Sbjct: 240 PWAHVRDVATSAFPTPARRPTNSSLSSAKFTAAFRWSMPPWQYSV 284


>gi|242240690|ref|YP_002988871.1| dTDP-4-dehydrorhamnose reductase [Dickeya dadantii Ech703]
 gi|242132747|gb|ACS87049.1| dTDP-4-dehydrorhamnose reductase [Dickeya dadantii Ech703]
          Length = 290

 Score =  215 bits (547), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 170/289 (58%), Gaps = 6/289 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+ GQ+ Q L S      E++  GR  +D+           +F+PD IIN AAY
Sbjct: 1   MRILITGSQGQLGQHLVSYLNGKAELLATGRDSLDITNKNQVIDKVKTFNPDYIINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD AED+ E  ++IN +G   +A+AA+      ++ISTDYVFDG +  P  E  PT+P
Sbjct: 61  TAVDNAEDDSERCYAINRDGPAHLAEAANIANAVLLHISTDYVFDGRAEQPYTEDMPTHP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           LN+YG SKLAGE+ VA     ++I+RT+WV+  +G+NF+ ++LRLA  R  +++V DQFG
Sbjct: 121 LNVYGASKLAGEQAVAEIARKFLIIRTSWVFGEYGNNFVKAILRLAATRNMLNIVNDQFG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG-- 237
            PT +  IA  +I++ H  IE  +T   GI+H +  G P VSW +FA  I  ++      
Sbjct: 181 GPTYSGDIANTLIELIH-YIEQGNTPAWGIYHYS--GTPAVSWFEFAGAILEQAKAHNLL 237

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
             Y K+  I +  YPTKA RPA S L+C ++     +  S W   + +I
Sbjct: 238 EAYPKLSGIPSVDYPTKAKRPANSVLNCDRITKQFGLAPSQWLSAINDI 286


>gi|84386938|ref|ZP_00989962.1| dTDP-4-dehydrorhamnose reductase [Vibrio splendidus 12B01]
 gi|84378228|gb|EAP95087.1| dTDP-4-dehydrorhamnose reductase [Vibrio splendidus 12B01]
          Length = 293

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 121/291 (41%), Positives = 175/291 (60%), Gaps = 8/291 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCV--QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ L+ G +GQ+  SL+      ++ E++ + R  +D+       +    F P +IIN A
Sbjct: 1   MRILITGCHGQVGSSLTEQLANYENTEVLALDREHLDITSQDAVNAAVAEFKPSIIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAE+E +++++IN +G   +A+AA S+G   ++ISTDYVF+G       E   T
Sbjct: 61  AHTAVDKAEEEADLSYAINRDGPKYLAQAAQSVGAAILHISTDYVFEGNKAGEYVETDAT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           NP  +YGKSKLAGE  VA   + ++ILRTAWV+   G+NF+ +MLRL + R  +S+V DQ
Sbjct: 121 NPQGVYGKSKLAGESAVAEACDKHIILRTAWVFGESGNNFVKTMLRLGENRNALSIVGDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA A+IQIA   I   D    G++H +  G P VSW DFA+ IF  + E+G
Sbjct: 181 FGGPTYAGDIANALIQIAKR-INQGDVVEYGVYHYS--GLPHVSWFDFADAIFDVAVEQG 237

Query: 238 GPYSK--VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
              +K  +  I T QYPT A RP+ S L   K+    +++ S WK  + NI
Sbjct: 238 VLANKPSLTSITTDQYPTPAKRPSNSRLSTEKITLGFSVKESDWKAELNNI 288


>gi|330899786|gb|EGH31205.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 301

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 118/300 (39%), Positives = 170/300 (56%), Gaps = 11/300 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID-----LLKPKDFASFFLSFSPDVII 55
           MK L++G NGQ+   L        E+I + R   D     L   +  A+   + +PDVI+
Sbjct: 1   MKILLLGKNGQVGWELQRALAPLGEVIALDRQGADGLCGDLADLERLAATVRALAPDVIV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVDKAE EP++A  IN E  G +A+ A ++G   I+ STDYVFDG       E 
Sbjct: 61  NAAAYTAVDKAESEPDLAMLINGEAPGVLAREAAALGAWLIHYSTDYVFDGSGEEQWQES 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
           +PT PL++YG+SKL GE+ + +     +ILRT+WVY+  G NF  +MLRLA ER  ++VV
Sbjct: 121 APTGPLSVYGRSKLMGEQAIQASGAKALILRTSWVYAARGHNFAKTMLRLATERDSLNVV 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
            DQ+G PT A  IA    QI H +  + +  +L GI+H+ A  G  SW  FA+++   +A
Sbjct: 181 ADQYGAPTGAELIADVTAQILHRVRADQNPAALAGIYHLAA-AGETSWHGFAQFVLEHAA 239

Query: 235 ERGGPYS----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             G        ++  I T+ YP  A RP  S L  SKL     +++ +W++G + +L  I
Sbjct: 240 LNGVALKVAPDQIGAIPTEAYPVPAPRPRNSRLALSKLETAFQLKMPSWQQGAQRMLDEI 299


>gi|330967439|gb|EGH67699.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 301

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 170/301 (56%), Gaps = 13/301 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLL--KPKDFASFFLS---FSPDVII 55
           MK L++G NGQ+   L        E+I + R   D L     D     ++    +PDVI+
Sbjct: 1   MKILLLGKNGQVGWELQRSLAALGEVIALDRQGADGLCGDLADLGGLTVTIRTLAPDVIV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVDKAE EP++A  IN E  G +A+ A ++G   I+ STDYVFDG   +   E 
Sbjct: 61  NAAAYTAVDKAESEPDVALLINGEAPGVLAREAAALGAWLIHYSTDYVFDGSGDSQWQED 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
           +PT PL++YG+SKL GE+ + +     ++LRT+WVY+  G+NF  +MLRLA ER  ++VV
Sbjct: 121 APTGPLSVYGRSKLMGEQAIQASGAKALVLRTSWVYAAKGNNFAKTMLRLAAERDSLNVV 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDT-SLRGIFHMTADGGPVSWADFAEYIFWESA 234
            DQ+G PT A  IA     I   ++ + D+ +L GI+H+ A  G  SW  FA  +  E A
Sbjct: 181 ADQYGAPTGAELIADVTAHILRRVLGDQDSAALAGIYHLAA-AGETSWHGFARLVL-EHA 238

Query: 235 ERGG-----PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           ER G        KV  I T+ YP  A RP  S L   KL  T  +++  W++G + +L  
Sbjct: 239 ERNGVALKVSADKVGAIATEAYPLPAPRPHNSRLALGKLETTFQLKMPPWQQGAQRMLDE 298

Query: 290 I 290
           I
Sbjct: 299 I 299


>gi|285019454|ref|YP_003377165.1| dtdp-4-dehydrorhamnose reductase [Xanthomonas albilineans GPE PC73]
 gi|283474672|emb|CBA17171.1| probable dtdp-4-dehydrorhamnose reductase protein [Xanthomonas
           albilineans]
          Length = 304

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 122/299 (40%), Positives = 168/299 (56%), Gaps = 17/299 (5%)

Query: 1   MKCLVIGNNGQIAQSL-SSMCVQD--VEIIRVGR-PD------IDLLKPKDFASFFLSFS 50
           M  LV G NGQ+ Q L  ++  Q   +   R GR PD       D  +P+D         
Sbjct: 1   MTVLVFGANGQVGQELLRALAAQGPVLATTRSGRLPDGRACERTDFDRPQDLGGLLDRLQ 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           P  ++N AAYTAVD+AE + + A   NA+  G IA    +  +P ++ STDYVFDG    
Sbjct: 61  PAAVVNAAAYTAVDRAEQDTDAAHRANAQSPGIIADWCAAHAVPLVHYSTDYVFDGQGTR 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P  E +PT PL +YG +KLAGEE + +   +++I RTAWVY+  G NFL +MLR+  ER 
Sbjct: 121 PYPEDAPTAPLGVYGATKLAGEEAIRASGAHHLIFRTAWVYAAHGHNFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
           E+ VV DQ GTPT A  IA+     AH L + + T   G +H+TA  G  +W  FAE IF
Sbjct: 181 ELRVVADQVGTPTPAALIAQV---TAHALAQRA-TLPSGTWHLTA-AGETTWHGFAEAIF 235

Query: 231 WESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            ++   G      +V  I T +YPT A RPAYS LD SKL    ++ +  W++G+R ++
Sbjct: 236 ADAVAAGLLPRTPRVLPIATTEYPTPAKRPAYSRLDVSKLQCDFSLELPQWRDGLRQVI 294


>gi|227113155|ref|ZP_03826811.1| dTDP-4-dehydrorhamnose reductase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 281

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 122/289 (42%), Positives = 174/289 (60%), Gaps = 10/289 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G NGQ+ +        + EI+     ++D+   +  A    SF PD I+N AAY
Sbjct: 1   MKILLTGANGQLGRCFQDRLPAEWEILATDSNELDITDLERVAEVVKSFQPDAIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPEIA SIN  G   +A  A    +  +++STDYVFDG +  P +E S TNP
Sbjct: 61  TAVDKAESEPEIAESINVHGPQNLAIVATKYNVRLVHVSTDYVFDGSATEPYNEDSATNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L++YG +KLAGE+ V   +   +I+RTAWV+S +G+NF+ +MLRLAKER  +S+V DQ G
Sbjct: 121 LSVYGNTKLAGEQAVTKISPEAIIVRTAWVFSEYGNNFVKTMLRLAKERDSLSIVNDQRG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  +A+AII    +L+E +  ++ GI+H   D   VSW +FAE IF  +A++    
Sbjct: 181 CPTYAGDLAQAII----SLLEKN--AVGGIYHYCGD-EEVSWYEFAESIFTIAADKSRLI 233

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               +  I T  YPT A+RPAYS L C ++     I +S W+  ++  +
Sbjct: 234 DIPSLKPIPTTDYPTPAYRPAYSTLACDRVKKL-GISLSRWENALQKTI 281


>gi|332561401|ref|ZP_08415716.1| dTDP-4-dehydrorhamnose reductase [Rhodobacter sphaeroides WS8N]
 gi|332274200|gb|EGJ19517.1| dTDP-4-dehydrorhamnose reductase [Rhodobacter sphaeroides WS8N]
          Length = 283

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 167/288 (57%), Gaps = 13/288 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G  GQ+A+ L+    Q  +   +GR + DL  P+  A       PD +IN AA+TAV
Sbjct: 3   LVFGRTGQVARELAR---QAPDARFLGRDEADLADPEACARAIREAKPDAVINAAAWTAV 59

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D+AE+E  +A  +N E  GA+A+A   +GIP + ISTDYVFDG    P     P  PL  
Sbjct: 60  DQAEEEEALATVVNGEAPGAMARACAELGIPFVQISTDYVFDGSGTRPWQPGDPVGPLGA 119

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKLAGEE V +    + ILRT+WV+S  G+NF+ +MLRL   R  ++VVCDQ G PT
Sbjct: 120 YGRSKLAGEEAVRAAGGPHAILRTSWVFSAHGANFVKTMLRLGATRDRLTVVCDQVGGPT 179

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGPYSK 242
            A  IA A + +A  L    D  L G +H++  GGP VSWADFA  IF ++         
Sbjct: 180 PAADIAAACLAMARGLAARPD--LSGTYHLS--GGPDVSWADFAREIFRQAEL----ACL 231

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           V  I +  YP KAHRPA S +DCS LA    +    W++G+  +L ++
Sbjct: 232 VADIASADYPQKAHRPANSRMDCSDLAR-FGLSRPDWRQGLARVLADL 278


>gi|325279645|ref|YP_004252187.1| dTDP-4-dehydrorhamnose reductase [Odoribacter splanchnicus DSM
           20712]
 gi|324311454|gb|ADY32007.1| dTDP-4-dehydrorhamnose reductase [Odoribacter splanchnicus DSM
           20712]
          Length = 293

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 122/288 (42%), Positives = 168/288 (58%), Gaps = 9/288 (3%)

Query: 4   LVIGNNGQIAQSLSSMCVQDV-EIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
           L+ G NGQ+   L  +    + E+      ++D+        F      D IIN AAYTA
Sbjct: 5   LITGANGQLGSELRKIGFSPLDEVFFTDVAELDITDYTAIEKFIQVHEVDTIINCAAYTA 64

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VD+AEDEP  A  IN +    +AKAA       I+ISTDYVFDG + TP  E   T P++
Sbjct: 65  VDRAEDEPGPAAEINTQAVANLAKAAQKGDCLLIHISTDYVFDGTATTPYTEKIKTCPVS 124

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YGK+KLAGEE +      Y+I+RTAW+YS FG NF+ ++LRLA+ER EI+VV DQ GTP
Sbjct: 125 VYGKTKLAGEEAIIRSGCFYIIIRTAWLYSAFGHNFVKTILRLAEERPEINVVNDQIGTP 184

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
           T A  +A+AI++I  N   +      GI+H + + G  SW DFA  I   S    G   +
Sbjct: 185 TYAEDLAKAIVKIMAN---DDRVEHEGIYHYS-NAGVCSWYDFAVEIVRLS----GLNCR 236

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           V  + T +YPTK HRPAYS LD +K+ +T  + +  W+E +R ++  I
Sbjct: 237 VNPVTTAEYPTKTHRPAYSVLDKTKIKHTFGVEVPEWQEALRRMMGEI 284


>gi|309274611|gb|ADO64235.1| RmlD [Vibrio vulnificus]
          Length = 294

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 120/290 (41%), Positives = 173/290 (59%), Gaps = 8/290 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G NGQ+   L+       E++ +    +D+   +   +    F P+ IIN AA+
Sbjct: 5   MKVLITGCNGQVGHCLTERLKTQAEVLALDYEGLDITNREAVFNTVAEFKPNYIINAAAH 64

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE E +++F+IN +G   +A+A++  G   ++ISTDYVFDG+   P  E   T P
Sbjct: 65  TAVDRAEQEVKLSFAINRDGPSYLAQASNECGAVMLHISTDYVFDGMGDKPYQESDSTRP 124

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
             +YG+SKLAGE+ VA     ++ILRTAWV+   G+NF+ +MLRLA+   E+S+V DQFG
Sbjct: 125 QGVYGQSKLAGEQAVAEACPKHLILRTAWVFGEHGNNFVKTMLRLAQSCDELSIVGDQFG 184

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A  IA  +I +  N IE  +    G++H +  G P VSW DFA  IF ++AE+   
Sbjct: 185 GPTYAGDIADTLITMVQN-IEQGNKLKWGVYHFS--GMPYVSWYDFASAIF-QAAEQHKM 240

Query: 240 YSK---VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
             K   +  I T  YPT A RPA S LDC+K+ N  +I+ S W+  + NI
Sbjct: 241 LDKQPLLSSIPTSAYPTPAKRPANSRLDCAKIENQFSIKPSDWQAALNNI 290


>gi|190150742|ref|YP_001969267.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307250738|ref|ZP_07532672.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307264144|ref|ZP_07545738.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189915873|gb|ACE62125.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306857242|gb|EFM89364.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306870518|gb|EFN02268.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 291

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 124/290 (42%), Positives = 170/290 (58%), Gaps = 10/290 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L+ G  GQ+   L+       +I+ V R ++D+ K     +    F PDVIIN AA+T
Sbjct: 3   RFLITGAKGQVGHCLTKQLQGKADILAVDREELDITKRDAVFNVVREFRPDVIINAAAHT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE E E++ +IN +G   +A+AA+ +    ++ISTDYVF+G       E    NP 
Sbjct: 63  AVDRAESEVELSEAINVKGPQYLAEAANEVDAIILHISTDYVFEGTGSGEYKENDEPNPQ 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
            +YGK+KLAGE  V      ++ILRTAWV+   G+NF+ +MLRL KER  + +V DQFG 
Sbjct: 123 GVYGKTKLAGEIAVQQANKKHIILRTAWVFGEHGNNFVKTMLRLGKERDVLGIVSDQFGG 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAER---- 236
           PT A  IA+A+IQIA N I    T + GI+H T  G P VSWADFA  IF E+  +    
Sbjct: 183 PTYAGDIAKALIQIA-NAIMGGRTDVFGIYHFT--GKPYVSWADFANAIFDEAVLQKVIE 239

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
             P   V  I T  YPT A RPA S LD +K+     I+ S W++ ++NI
Sbjct: 240 KAPL--VNFISTSDYPTPAKRPANSRLDLTKIDIVFGIKPSNWQQALKNI 287


>gi|118595026|ref|ZP_01552373.1| dTDP-4-dehydrorhamnose reductase [Methylophilales bacterium
           HTCC2181]
 gi|118440804|gb|EAV47431.1| dTDP-4-dehydrorhamnose reductase [Methylophilales bacterium
           HTCC2181]
          Length = 299

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 117/279 (41%), Positives = 158/279 (56%), Gaps = 7/279 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G NGQ+  +L    + D E++ + R D DL +P           PD+IINP AY
Sbjct: 1   MKILITGINGQVGHALMQQ-LNDHELVGLTRKDCDLTEPDQIRKAIDHHQPDLIINPGAY 59

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD+AEDEP++AF IN +    +A+ A    IP I+ STDYVFDG  +    E  PTNP
Sbjct: 60  TKVDQAEDEPKLAFLINRDAPKVMAEKAREYDIPFIHFSTDYVFDGEKKGAYKEDDPTNP 119

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG SK AGEE + +    + I RT+WVYS  G NF L+M RL+++  EI VV DQFG
Sbjct: 120 LGVYGASKWAGEEAIQNVGGKFYIFRTSWVYSDRGHNFYLTMKRLSEKPDEIRVVSDQFG 179

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PTS   IA+       N+++  ++   GI+H+  DG   SW +FA  I  ++       
Sbjct: 180 VPTSNFFIAKH----TQNIMKQLNSKNTGIYHLVPDGQS-SWCEFARQIITKTTPTFN-L 233

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTW 279
             +  I T QYPT+A RP  S LD SK+     I+  TW
Sbjct: 234 KNLLPINTDQYPTRAKRPRSSVLDNSKIKAVFMIKFDTW 272


>gi|153829572|ref|ZP_01982239.1| dTDP-4-dehydrorhamnose reductase [Vibrio cholerae 623-39]
 gi|148874968|gb|EDL73103.1| dTDP-4-dehydrorhamnose reductase [Vibrio cholerae 623-39]
          Length = 296

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 119/294 (40%), Positives = 179/294 (60%), Gaps = 12/294 (4%)

Query: 1   MKCLVIGNNGQI----AQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G+ GQ+    AQ LS+M  ++VE + + R  +D+  P    +    F P++IIN
Sbjct: 2   MRILVTGSRGQVGHFLAQQLSTM--KEVEFLAIDRDQLDITHPAQVDAVVNEFKPNIIIN 59

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA  +G   ++ISTDYVF G    P  E  
Sbjct: 60  AAAHTAVDRAEQEIELSYAINRDGPHYLAQAAQKVGAAILHISTDYVFSGDKPNPYLETD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT P  +YG+SKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV 
Sbjct: 120 PTAPQGVYGESKLAGEIAVAQACPRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVA 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQ+G PT A  IA A++ +A  ++E   T+  G++H +  G P VSW +FA  IF ++ +
Sbjct: 180 DQYGGPTYAGDIANALLMMAKAIVEGKSTAF-GVYHFS--GLPHVSWHEFACTIFDKARD 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +G      +V  I T++YPT A RPA S LD  K+     +  S W+  + +++
Sbjct: 237 QGILNKSLQVNAITTQEYPTPAKRPANSRLDTQKIHQHFGVVASDWQTALNHLI 290


>gi|116749692|ref|YP_846379.1| dTDP-4-dehydrorhamnose reductase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698756|gb|ABK17944.1| dTDP-4-dehydrorhamnose reductase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 294

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 113/284 (39%), Positives = 167/284 (58%), Gaps = 3/284 (1%)

Query: 2   KCLVIGNNGQIAQSLSS-MCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           K L+IG+ G +   L+  +  Q   +  V R ++D+  P++      +  P ++IN AAY
Sbjct: 3   KILIIGHRGMLGTDLTERLRSQGFAVEGVDRDELDIAVPEEVLRCLETIRPRLVINCAAY 62

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE EP  AF++N +G   IA A   +  P I+ISTDYVFDG +  P  E  P NP
Sbjct: 63  TAVDRAEGEPGAAFAVNRDGPAHIAAACGRLNSPLIHISTDYVFDGRASAPYKEDDPVNP 122

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +++YG+SK  GE  V S   N++I+RTAW++   G++F+ ++LRLA ER E+ +V DQ+G
Sbjct: 123 VSVYGRSKWEGEAAVRSRLQNHLIVRTAWLFGANGNSFVKTILRLAAERAELRIVSDQYG 182

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESA-ERGGP 239
            PT    +A A+  ++  +++ + T   G +H    G  VSW +FA  I   SA  RGG 
Sbjct: 183 CPTWTGDLASALTGLSKRVLDGARTVPWGTYHYCGKGA-VSWYEFARAIVEASAFARGGK 241

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
              V  I T  YP  A RPA+S LDC K+A+   I   +W+EG+
Sbjct: 242 MPAVVPIATADYPLPARRPAWSVLDCGKMASEFGIEPVSWREGL 285


>gi|7592817|dbj|BAA94404.1| dTDP-6-deoxy-L-lyxo-4-hexulose redactase [Actinobacillus
           actinomycetemcomitans]
          Length = 292

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 123/290 (42%), Positives = 165/290 (56%), Gaps = 10/290 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+ G NGQ+   L+       EI+ V   ++D+           +F PDV+IN AA+T
Sbjct: 3   KFLITGANGQVGYCLTQQLQGRHEILAVDHDELDITNQSAVKKTVENFRPDVVINAAAHT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE E E + +IN +G   +A+ A S+    ++ISTDYVFDG S     E    +P 
Sbjct: 63  AVDRAETEVERSEAINVKGPQYLAETAKSVDAAILHISTDYVFDGRSAGKYKETDAADPQ 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
            IYGK+KLAGE+ V    + +++LRTAWV+   G+NF+ +MLRLAK R  + VV DQ G 
Sbjct: 123 GIYGKTKLAGEQAVVEANDKFIVLRTAWVFCEHGNNFVKTMLRLAKTRDTLGVVADQIGG 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG--- 237
           PT A  IA A+IQIA  +I        GI+H T  G P VSW DFA  IF E+  +    
Sbjct: 183 PTYAGDIAAALIQIAEKIIAGESVEY-GIYHFT--GEPYVSWCDFARAIFDEAVSQNMLE 239

Query: 238 -GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
             P   V  I T  YPT A RPA SCLD +K+     I+ S W+  ++NI
Sbjct: 240 KAPL--VNAITTADYPTPAKRPANSCLDLTKIQQAFGIQPSDWQRALKNI 287


>gi|300866608|ref|ZP_07111296.1| dTDP-4-dehydrorhamnose reductase [Oscillatoria sp. PCC 6506]
 gi|300335380|emb|CBN56456.1| dTDP-4-dehydrorhamnose reductase [Oscillatoria sp. PCC 6506]
          Length = 290

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 168/291 (57%), Gaps = 10/291 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G+ GQ+AQ L  + +   E+I   R   DL +P           P++++N AAY
Sbjct: 1   MKILLTGSGGQLAQELEPILLSAGEVIAGDRTFFDLSQPDSIHQLMGEIKPNLVVNCAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE+A ++N    G +A+  + +G   I+ISTDYVF G    P  E   TNP
Sbjct: 61  TAVDKAESEPELANAVNGIAPGILAEECEKLGATLIHISTDYVFGGSQGYPYCETDTTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFG-SNFLLSMLRLAKERREISVVCDQF 179
           L +YGKSKLAGE  +    + ++I+RTAWVY   G  NF+ +MLRL K+R EI VV DQ 
Sbjct: 121 LGVYGKSKLAGELSIIKALDRHIIIRTAWVYGNGGKGNFVKTMLRLGKDREEIRVVADQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT    +A AI QI  ++       + G +H T + G  SW DFA  IF E A++ G 
Sbjct: 181 GSPTWTGDLAAAISQITSSI----RPEIFGTYHYT-NSGVASWYDFAVAIF-EEAKQLGF 234

Query: 240 YSKVYRIF---TKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             KV R+    T +YPT A RPAYS L  +K++         W+EG+R +L
Sbjct: 235 SLKVKRVIPITTPEYPTPAKRPAYSVLSSTKISAVLGSHPPHWREGLRQML 285


>gi|221634577|ref|YP_002523265.1| dTDP-4-dehydrorhamnose reductase [Rhodobacter sphaeroides KD131]
 gi|221163450|gb|ACM04412.1| dTDP-4-dehydrorhamnose reductase [Rhodobacter sphaeroides KD131]
          Length = 283

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 167/288 (57%), Gaps = 13/288 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G  GQ+A+ L+    Q  +   +GR + DL  P+  A       PD +IN AA+TAV
Sbjct: 3   LVFGRTGQVARELAR---QAPDARFLGRDEADLADPEACARAIREAKPDAVINAAAWTAV 59

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D+AE+E   A  +N E  GA+A+A  ++GIP + ISTDYVFDG    P     P  PL  
Sbjct: 60  DRAEEEEAPATVVNGEAPGAMARACAALGIPFVQISTDYVFDGSGTRPWQPGDPVGPLGA 119

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKLAGEE V +    + ILRT+WV+S  G+NF+ +MLRL   R  ++VVCDQ G PT
Sbjct: 120 YGRSKLAGEEAVRAAGGPHAILRTSWVFSAHGANFVKTMLRLGATRDRLTVVCDQVGGPT 179

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGPYSK 242
            A  IA A + +A  L    D  L G +H++  GGP VSWADFA  IF ++         
Sbjct: 180 PAADIAAACLAMARGLAARPD--LSGTYHLS--GGPDVSWADFAREIFRQAEL----ACL 231

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           V  I +  YP KAHRPA S +DCS LA    +    W++G+  +L ++
Sbjct: 232 VADIASADYPQKAHRPANSRMDCSDLAR-FGLSRPDWRQGLARVLADL 278


>gi|313201255|ref|YP_004039913.1| dTDP-4-dehydrorhamnose reductase [Methylovorus sp. MP688]
 gi|312440571|gb|ADQ84677.1| dTDP-4-dehydrorhamnose reductase [Methylovorus sp. MP688]
          Length = 301

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 118/295 (40%), Positives = 164/295 (55%), Gaps = 14/295 (4%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L+ G +GQ+  +L  M      +  + R  +DL           +  PDVI+NPAAYT
Sbjct: 5   RILLTGVHGQVGHALLPMLATWGTVTALDRAALDLSDEAAIRKTVRTLRPDVIVNPAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE EPE+A++INAE    +A+ A  +G   ++ STDYVFDG +  P  E   TNPL
Sbjct: 65  AVDKAETEPELAYAINAEAPRILAEEAAELGARMVHYSTDYVFDGRASKPYRETDMTNPL 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
            +YG SKLAGE+ V      ++ILRT+WVY  +G NFL ++LRLA+ER  + +V DQ G 
Sbjct: 125 GVYGASKLAGEQAVQQAGAQHLILRTSWVYGAYGKNFLHTILRLARERDSLGIVADQLGA 184

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWE----SAERG 237
           PTS+  IA A +     L+++      GI+H+T + G  SW  FA  I        AERG
Sbjct: 185 PTSSHDIASATL----TLLKSWQPERSGIYHLT-NSGYTSWHGFAVAILQAYEGLQAERG 239

Query: 238 GP-----YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            P        V  I T +YPT A RPA S LD   L     +R+  W++ +  ++
Sbjct: 240 WPPLRVSSEAVRAITTAEYPTPAARPANSRLDGDLLEQDWGLRLQDWRQALVQVM 294


>gi|28170139|gb|AAM34818.1| dTDP-4-keto-L-rhamnose reductase [Vibrio vulnificus]
          Length = 290

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 121/290 (41%), Positives = 171/290 (58%), Gaps = 8/290 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G NGQ+   L+       E++ +    +D+   +   +    F P+ IIN AAY
Sbjct: 1   MKVLITGCNGQVGHCLTERLKTQAEVLALDYEGLDITNREAVFNTVAEFKPNYIINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE E +++F+IN +G   +A+A++  G   ++ISTDYVFDG+   P  E   T P
Sbjct: 61  TAVDRAEQEVKLSFAINRDGPSYLAQASNECGAVMLHISTDYVFDGMGDKPYQEGDNTGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
             +YG+SKLAGE+ VA     ++ILRTAWV+   G+NF+ +MLRLA+ R E+S+V DQFG
Sbjct: 121 QGVYGQSKLAGEQAVAEACPEHLILRTAWVFGEHGNNFVKTMLRLAQSRDELSIVGDQFG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A  IA A+I +    IE       G++H +  G P  SW DFA  IF ++AE+   
Sbjct: 181 GPTYAGDIADALIAMVQ-YIELGSKPKWGVYHFS--GMPYASWYDFASAIF-QAAEQHKM 236

Query: 240 YSK---VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
             K   +  I T  YPT A RPA S LDC+K+ N   I+ S W+  + NI
Sbjct: 237 LDKQPLLSSIPTSAYPTPAKRPANSRLDCAKIENQFGIKPSDWQVALNNI 286


>gi|70733808|ref|YP_257448.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas fluorescens Pf-5]
 gi|68348107|gb|AAY95713.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas fluorescens Pf-5]
          Length = 293

 Score =  213 bits (542), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 119/292 (40%), Positives = 165/292 (56%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           +K L+ G +GQ+++ L        E++ +GR  +DL  P+       +  PD+IIN AA+
Sbjct: 5   LKILISGQHGQVSRELQQRLGDLGELVVLGREQLDLSHPEQIRQQVRAIRPDLIINAAAH 64

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+A+ EP++AF+INA   G  A+ A  +G+P I+ STDYVFDG   TP  E    NP
Sbjct: 65  TAVDQAQSEPDLAFAINATAPGIFAQEAFELGVPLIHYSTDYVFDGSKETPYVEDDEPNP 124

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L++YG+SKLAGE  +      ++ILRT+WVYS  G NFLL+M RL +E+ E+ VV DQ G
Sbjct: 125 LSVYGESKLAGERAIRLVQGQHLILRTSWVYSSHGKNFLLTMQRLLQEKPELRVVADQIG 184

Query: 181 TPTSALQIA---RAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
            PT A  IA   RA+I+              GI+H+TA  G  SW  FA+ I  +     
Sbjct: 185 APTWAGTIATSTRALIE----RWRAGQPGAWGIYHLTAH-GETSWFGFAQAIGEQLLAMD 239

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
            P + +  I +  YPT A RP  S LDCS+LA    +    W   +R  L  
Sbjct: 240 KPCAVLEAIPSSAYPTPAPRPLNSRLDCSRLAREWGVVQPDWHTALRECLAE 291


>gi|12232610|gb|AAG49405.1| dTDP-4-rhamnose reductase [Aggregatibacter actinomycetemcomitans]
          Length = 292

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 123/290 (42%), Positives = 165/290 (56%), Gaps = 10/290 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+ G NGQ+   L+       EI+ V   ++D+           +F PDV+IN AA+T
Sbjct: 3   KFLITGANGQVGYCLTQQLQGRHEILAVDHDELDITNQSAVKKTVENFCPDVVINAAAHT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE E E + +IN +G   +A+ A S+    ++ISTDYVFDG S     E    +P 
Sbjct: 63  AVDRAETEVERSEAINVKGPQYLAETAKSVDAAILHISTDYVFDGRSAGKYKETDAADPQ 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
            IYGK+KLAGE+ V    + +++LRTAWV+   G+NF+ +MLRLAK R  + VV DQ G 
Sbjct: 123 GIYGKTKLAGEQAVVEANDKFIVLRTAWVFCEHGNNFVKTMLRLAKTRDTLGVVADQIGG 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG--- 237
           PT A  IA A+IQIA  +I        GI+H T  G P VSW DFA  IF E+  +    
Sbjct: 183 PTYAGDIAAALIQIAEKIIAGESVEY-GIYHFT--GLPYVSWCDFARAIFDEAVSQNMLE 239

Query: 238 -GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
             P   V  I T  YPT A RPA SCLD +K+     I+ S W+  ++NI
Sbjct: 240 KAPL--VNAITTADYPTPAKRPANSCLDLTKIQQAFGIQPSDWQRALKNI 287


>gi|15836863|ref|NP_297551.1| dTDP-4-keto-L-rhamnose reductase [Xylella fastidiosa 9a5c]
 gi|9105073|gb|AAF83071.1|AE003879_6 dTDP-4-keto-L-rhamnose reductase [Xylella fastidiosa 9a5c]
          Length = 302

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 128/303 (42%), Positives = 164/303 (54%), Gaps = 19/303 (6%)

Query: 1   MKCLVIGNNGQIAQ----SLSSMCVQDVEIIRVGR-PD------IDLLKPKDFASFFLSF 49
           M  LV G  GQI Q    SLS   V    + R GR P+       D  +P+       + 
Sbjct: 1   MTVLVFGAGGQIGQELLRSLSGRVV--CAVTRSGRLPNGRECVQADFDRPETLRPLLDAQ 58

Query: 50  SPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSR 109
            P  ++N AAYTAVD+AE EP++ F INA+  G IA      G+P ++ STDYVFDG   
Sbjct: 59  RPAQVVNAAAYTAVDRAESEPDVVFRINAQAPGVIAHWCARHGVPLVHYSTDYVFDGQGT 118

Query: 110 TPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKER 169
           +P     P  PLNIYG SKLAGE  V +     +ILRT+WVY+  G NFL +MLRL    
Sbjct: 119 SPYGVDDPVAPLNIYGASKLAGERAVRAAGGCSLILRTSWVYAAHGHNFLRTMLRLGATS 178

Query: 170 REISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYI 229
             + VV DQ GTPT+A  IA    Q+   L     +   GI+H+TA  G  SW  FAE I
Sbjct: 179 ERLPVVADQIGTPTAAGLIADVTAQL---LAGGGQSRHAGIWHLTAT-GQTSWHGFAEEI 234

Query: 230 FWESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           F ++   G      +V  I +  YPT A RPAYSCLD + L  T  I +  W++GVR +L
Sbjct: 235 FAQAQACGLMMRVPQVQAIASVGYPTAARRPAYSCLDTTALVETFGIVLPDWRQGVRGVL 294

Query: 288 VNI 290
            +I
Sbjct: 295 DDI 297


>gi|29726016|gb|AAO88943.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Vibrio cholerae]
          Length = 295

 Score =  213 bits (541), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 177/294 (60%), Gaps = 13/294 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G+ GQ+     Q LS+M  ++VE + V R  +D+  P    +    F P++IIN
Sbjct: 2   MRVLVTGSRGQVGHCLVQQLSTM--KEVEFLAVDRDQLDITYPAQVDAVVNEFKPNIIIN 59

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA  +G   ++ISTDYVF G    P  E  
Sbjct: 60  AAAHTAVDRAEQEIELSYAINRDGPHYLAQAAQKVGAAILHISTDYVFSGDKPNPYLEAD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKER-REISVV 175
           PT PL +YG+SKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA +   E+S+V
Sbjct: 120 PTAPLGVYGESKLAGEIAVAQACPRHIILRTAWVFGEHGNNFVKTMLRLAADTCHELSIV 179

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESA 234
            DQFG PT A  IA A+  IA   I   D+   GI+H +  G P VSW  FA+ IF  + 
Sbjct: 180 GDQFGGPTYAGDIASALATIARK-ISKGDSIEYGIYHYS--GTPHVSWCQFADAIFDLAV 236

Query: 235 ERGGPYSK--VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
           E+G   SK  +  + T+QYPT A RPA S +   K+ N   I+ S W   +++I
Sbjct: 237 EQGVLSSKPIIKSVTTEQYPTLAKRPANSKMSNKKIENKLGIKGSDWHAALKDI 290


>gi|225873477|ref|YP_002754936.1| dTDP-4-dehydrorhamnose reductase [Acidobacterium capsulatum ATCC
           51196]
 gi|225792581|gb|ACO32671.1| dTDP-4-dehydrorhamnose reductase [Acidobacterium capsulatum ATCC
           51196]
          Length = 301

 Score =  212 bits (540), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 114/293 (38%), Positives = 164/293 (55%), Gaps = 8/293 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K +++G+ GQ+   L        E++   R   DL +P           P V++  AAYT
Sbjct: 5   KAMILGSTGQVGVELQRSFAGYGEVLAYDRSQADLTRPGAIIETIRQQKPSVVLLAAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE EPE+A ++NAE  G +A+A     I  +  STDYVFDG  R P  E     PL
Sbjct: 65  AVDKAESEPELAMAVNAEAPGLLAQACAESDILFVTYSTDYVFDGSKREPWVESDEPRPL 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           N+YG+SKL GE +V      ++I RT+WVY   G NF L+MLRL KER E+S+V DQ G+
Sbjct: 125 NMYGRSKLEGERRVQQAGGRHLIFRTSWVYGPHGKNFFLTMLRLGKEREELSIVADQTGS 184

Query: 182 PTSALQIA---RAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER-G 237
           PTS++ IA   R ++     L      +  GI+HMT   G  +W +FA +IF E A++  
Sbjct: 185 PTSSIAIAAATRTVVDRMEGLSSAEAAARSGIYHMTC-AGSTNWYEFARHIFSECADQLE 243

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEG---VRNIL 287
           G   ++  +  + YPT A RP+YS +    L+N  ++R+  W++    V+N L
Sbjct: 244 GRQPRLRPLKAEDYPTPAKRPSYSVMSNEMLSNAWDVRLPAWQDAFATVKNRL 296


>gi|149203264|ref|ZP_01880234.1| dTDP-4-dehydrorhamnose reductase [Roseovarius sp. TM1035]
 gi|149143097|gb|EDM31136.1| dTDP-4-dehydrorhamnose reductase [Roseovarius sp. TM1035]
          Length = 281

 Score =  212 bits (540), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 119/291 (40%), Positives = 162/291 (55%), Gaps = 14/291 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ LV G  GQ+A  +     +  E+  +GR   DL  P   A      +PD++IN AAY
Sbjct: 1   MRILVFGRTGQVATEMQ----RQAEVTALGREVADLSDPMACAEAIRDHAPDLVINAAAY 56

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE E ++A  IN    GA+A+A  ++GIP  ++STDYVFDG    P     P  P
Sbjct: 57  TAVDRAESEEDLATVINGVAPGAMARACANLGIPFCHVSTDYVFDGSGAAPRAPSDPVAP 116

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N YG+SKLAGEE V +      ILRT+WV+S  G NF+ +MLRL++ R  +SVV DQ G
Sbjct: 117 CNAYGRSKLAGEEAVRAAGGQAAILRTSWVFSAHGGNFVKTMLRLSETRDALSVVDDQIG 176

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A  IA A++ +   ++        G++H +  G P  SWADFA  IF ++    G 
Sbjct: 177 GPTPAADIAAALLSMGRAMVAGHAG---GLYHFS--GAPDASWADFAREIFAQA----GR 227

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            + V  I T+ YPT A RP  S LDC  LA    I    W+ G+  +L  +
Sbjct: 228 VTVVTGIPTRDYPTPAARPQNSRLDCGSLAAEFGIGRPDWRAGLARVLKEL 278


>gi|229175940|ref|ZP_04303437.1| hypothetical protein bcere0006_50100 [Bacillus cereus MM3]
 gi|228607534|gb|EEK64859.1| hypothetical protein bcere0006_50100 [Bacillus cereus MM3]
          Length = 280

 Score =  212 bits (540), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 169/289 (58%), Gaps = 13/289 (4%)

Query: 1   MKCLVIGNNGQIAQS-LSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK +V G  GQ+AQ  L  +   D+++  + R ++D+   +   ++     PD I++ AA
Sbjct: 1   MKVIVTGAKGQLAQDVLKQLEHTDLQVYGIDREELDITNNEAVQAYINKIKPDAIMHCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VD AE++ E A+ +N  G   +A+AA  IG   +YISTDYVFDG ++ P +   PT 
Sbjct: 61  YTNVDAAEEDAETAYKVNGLGTKYLAQAAGEIGAKMLYISTDYVFDGTAKNPYETSEPTK 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YG++KLAGE  V  Y + + I+RTAWV+ IFG+NF+ +MLRL KE  EISVV DQ 
Sbjct: 121 PLGVYGETKLAGETFVQQYVDKFFIVRTAWVFGIFGNNFVKTMLRLGKEHDEISVVHDQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT  + +AR +I++         +   GI+H T + G  SW +FA  IF     + G 
Sbjct: 181 GSPTYTVDLARFMIELIR-------SEKYGIYHAT-NTGVCSWYEFAVEIF----NQAGI 228

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             KV  + T+++P  A RP YS L   K+ +     +  WKE ++  L+
Sbjct: 229 EVKVNPVTTEEFPRPAARPHYSVLSKQKIEDEGFSSLQDWKEALKAYLL 277


>gi|125654614|ref|YP_001033808.1| dTDP-4-dehydrorhamnose reductase [Rhodobacter sphaeroides 2.4.1]
 gi|77386274|gb|ABA81703.1| dTDP-4-dehydrorhamnose reductase [Rhodobacter sphaeroides 2.4.1]
          Length = 283

 Score =  212 bits (539), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 166/288 (57%), Gaps = 13/288 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G  GQ+A+ L+    Q  +   +GR + DL  P+  A       PD +IN AA+TAV
Sbjct: 3   LVFGRTGQVARELAR---QAPDARFLGRDEADLADPEACARAIREAKPDAVINAAAWTAV 59

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D+AE+E   A  +N E  GA+A+A   +GIP + ISTDYVFDG    P     P  PL  
Sbjct: 60  DRAEEEEAPATVVNGEAPGAMARACAELGIPFVQISTDYVFDGSGTRPWQPGDPVGPLGA 119

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKLAGEE V +    + ILRT+WV+S  G+NF+ +MLRL   R  ++VVCDQ G PT
Sbjct: 120 YGRSKLAGEEAVRAAGGPHAILRTSWVFSAHGANFVKTMLRLGATRDRLTVVCDQVGGPT 179

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGPYSK 242
            A  IA A + +A  L    D  L G +H++  GGP VSWADFA  IF ++         
Sbjct: 180 PAADIAAACLAMARGLAARPD--LSGTYHLS--GGPDVSWADFAREIFRQAELD----CL 231

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           V  I +  YP KAHRPA S +DCS LA    +    W++G+  +L ++
Sbjct: 232 VADIASADYPQKAHRPANSRMDCSDLAR-FGLSRPDWRQGLARVLADL 278


>gi|50120379|ref|YP_049546.1| dTDP-4-dehydrorhamnose reductase [Pectobacterium atrosepticum
           SCRI1043]
 gi|49610905|emb|CAG74350.1| dTDP-4-dehydrorhamnose reductase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 283

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 121/289 (41%), Positives = 169/289 (58%), Gaps = 10/289 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G NGQ+ +          +I      ++D+       +    + PD I+N AAY
Sbjct: 1   MKILLTGANGQLGRCFQDRLPTHWQIWSTDANELDITDLTQIEAAIARYQPDAIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE E  +A  IN  G   +A  A   GI  +++STDYVFDG + TP  E S TNP
Sbjct: 61  TAVDKAESESVLAEKINVTGPHNLATVAHQKGIRLVHVSTDYVFDGNATTPYLESSTTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L++YGK+KLAGE+ V     + +I+RTAWV+S +G+NF+ +MLRLAKER  +S+V DQ G
Sbjct: 121 LSVYGKTKLAGEQAVTKAAPDAIIVRTAWVFSEYGNNFVKTMLRLAKERDALSIVADQKG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG--G 238
            PT A  +A+AII    +LIE +     GI+H   D   VSW +FA+ IF  + ++    
Sbjct: 181 CPTYAGDLAQAII----SLIEKNAEC--GIYHYCGD-KEVSWYEFAKTIFEMAKQQDIID 233

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              ++  I T+QYPT AHRP YS L C K+A    I+ S W + +  +L
Sbjct: 234 KQPQLTAITTEQYPTPAHRPQYSSLSCEKIARL-TIKPSDWTDALSQVL 281


>gi|319953123|ref|YP_004164390.1| dtdp-4-dehydrorhamnose reductase [Cellulophaga algicola DSM 14237]
 gi|319421783|gb|ADV48892.1| dTDP-4-dehydrorhamnose reductase [Cellulophaga algicola DSM 14237]
          Length = 295

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 120/289 (41%), Positives = 169/289 (58%), Gaps = 12/289 (4%)

Query: 4   LVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           LV G NGQ+A+ L  +S    +         ++D+   K+  + F   + D  IN AAYT
Sbjct: 8   LVTGANGQLARCLKDASRDYPNYNFFFKTSKELDITNEKEIQTLFTELNFDYCINCAAYT 67

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAED+ E AF +NAEG   +AKA  S     I+ISTD+VFDG   +P  E   TNP+
Sbjct: 68  AVDKAEDDKENAFLVNAEGVKFLAKACKSFETVLIHISTDFVFDGTKNSPYTENDITNPI 127

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           N+YG SKL GEE + +   NY I+RT+WVYS FG+NF+ +ML+L K+R  +SVV DQ G+
Sbjct: 128 NVYGASKLKGEEYIKNILENYFIIRTSWVYSEFGNNFVKTMLKLGKDRNNLSVVDDQIGS 187

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A  +AR I++I  +       SL    H  ++ G +SW +FA+ IF ES        
Sbjct: 188 PTFAEDLARLILEIIDS------NSLEYGIHNFSNDGEISWYEFAQEIFQESK----ISI 237

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           ++  + + +YPTKA RP YS L   K+ N  +  I  WK  ++  LV++
Sbjct: 238 ELKPLKSSEYPTKAKRPKYSVLSKLKIRNALSTEIPLWKNSLKKCLVSL 286


>gi|89073288|ref|ZP_01159818.1| dTDP-4-dehydrorhamnose reductase [Photobacterium sp. SKA34]
 gi|89050998|gb|EAR56462.1| dTDP-4-dehydrorhamnose reductase [Photobacterium sp. SKA34]
          Length = 296

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 123/294 (41%), Positives = 174/294 (59%), Gaps = 10/294 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK L+ G+NGQ+   L        + EI+ V R ++D+    D       F P++IIN A
Sbjct: 1   MKVLITGSNGQVGSCLVKQLQNCTNTEILAVDRTELDITSKSDVIKIVDEFKPNIIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAE E E++FSIN +G   +A+AA++IG   ++ISTDYVF G       E    
Sbjct: 61  AHTAVDKAETEIELSFSINRDGPLYLAQAAENIGAALLHISTDYVFAGDKEGTYSETDTV 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           +P  +YG SKLAGE  V    +  +ILRTAWV+   G+NF+ +MLRLA++R E+S+V DQ
Sbjct: 121 DPQGVYGTSKLAGEIAVLEACSRTIILRTAWVFGEKGNNFVKTMLRLAQQRNELSIVDDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLI---ENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESA 234
           FG PT A  IA A+I IA N++    + D+S  GI+H +  G P  SW  FA+ IF ++ 
Sbjct: 181 FGGPTYAGDIAGALIIIAKNIMIQGADFDSSKYGIYHFS--GFPHTSWCGFAQKIFNKAV 238

Query: 235 ERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
           E+G       V  I T  YPT A RPA S LD  K+    ++++S W+  +  +
Sbjct: 239 EQGVLNKAPLVKGINTADYPTPAKRPANSKLDTKKIIEIFSVQVSDWERALNKL 292


>gi|209696412|ref|YP_002264343.1| dTDP-6-deoxy-l-mannose-dehydrogenase [Aliivibrio salmonicida
           LFI1238]
 gi|208010366|emb|CAQ80704.1| dTDP-6-deoxy-l-mannose-dehydrogenase [Aliivibrio salmonicida
           LFI1238]
          Length = 293

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 117/291 (40%), Positives = 176/291 (60%), Gaps = 8/291 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ L+ G  GQ+   L++  V      ++ + R  +D+       +    F P +IIN A
Sbjct: 1   MRVLITGCYGQVGHCLTAQLVNKASTSVLALDRDQLDITNQDAVNAIADDFQPTIIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAEDE +++++IN +G   +A+AA  +G   ++ISTDYVF+G      DE   T
Sbjct: 61  AHTAVDKAEDEVDLSYAINRDGPNYLAQAAQRVGAAMLHISTDYVFEGNKVGEYDERDVT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           +P  +YG+SKLAGE  VA+  + ++ILRTAWV+   G+NF+ +MLRL   R E+S+V DQ
Sbjct: 121 HPQGVYGESKLAGESAVANACDKHIILRTAWVFGEHGNNFVKTMLRLGVTRDELSIVGDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA A+I IA  + + +     G++H +  G P VSW +FA+ IF  + E+G
Sbjct: 181 FGGPTYAGDIANALITIAERITQGNMVDY-GVYHYS--GLPHVSWYEFADAIFDTAKEQG 237

Query: 238 GPYSK--VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
              +K  +  I T QYPT A RP+ SCL+ +K+    +I  S W+  ++NI
Sbjct: 238 VIKTKPSLTGITTVQYPTPAKRPSNSCLNTNKITTAFSIEASDWQTALKNI 288


>gi|72132991|gb|AAZ66344.1| RmlD [Listonella anguillarum]
          Length = 294

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 177/294 (60%), Gaps = 12/294 (4%)

Query: 1   MKCLVIGNNGQI----AQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G++GQ+    A  L+SM   DVE + V R  +D+  P    S    F P++IIN
Sbjct: 1   MRVLVTGSHGQVGYCLAHQLNSMV--DVEFLAVDREQLDITNPCHVNSVVNEFKPNIIIN 58

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA  +G   ++ISTDYVF G   +   E  
Sbjct: 59  AAAHTAVDRAEQEAELSYAINRDGPKHLAQAAHKVGAAILHISTDYVFSGDKPSAYIEAD 118

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+P  +YGKSKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV 
Sbjct: 119 STSPQGVYGKSKLAGEIAVAQACPRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVS 178

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQ+G PT A  IA A++ +A  ++E   T+  G++H +  G P VSW DFA  IF ++ E
Sbjct: 179 DQYGGPTYAGDIANALLIMAKAIVEGKSTAF-GVYHFS--GTPHVSWYDFACAIFDKARE 235

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +G      +V  I TK YPT A RPA S L+  K+     +  S W+  + +++
Sbjct: 236 QGLLNKPLQVNAITTKDYPTPAKRPANSKLETQKIHQHFGVVASDWRAALNHLI 289


>gi|53804350|ref|YP_113747.1| dTDP-4-dehydrorhamnose reductase [Methylococcus capsulatus str.
           Bath]
 gi|53758111|gb|AAU92402.1| dTDP-4-dehydrorhamnose reductase [Methylococcus capsulatus str.
           Bath]
          Length = 301

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 119/299 (39%), Positives = 166/299 (55%), Gaps = 10/299 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGR---PDIDLLKPKDFASFFLSFSPDVIINP 57
           MK LV+G +GQ+A  L        E++ + R   P IDL +P   A+   +  PD+I+N 
Sbjct: 1   MKILVVGRSGQLAWELRRTLACFGEVVALDRQSEPAIDLAEPGAVAALVRAVRPDLIVNA 60

Query: 58  AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSP 117
           AAYTAVD+AE EP++A+ +NAE    +A  A  +GI  I+ STDYVF G    P  E  P
Sbjct: 61  AAYTAVDRAEQEPDLAWKVNAEAPAVLAAEATRLGIGLIHYSTDYVFPGDGAVPYREDDP 120

Query: 118 TNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD 177
             P N+YG+SKLAGE+ +A+    ++ILRTAWVY + G NFL +MLRL  ER  + V+ D
Sbjct: 121 VGPRNVYGRSKLAGEQAIAASGAAHLILRTAWVYGVRGQNFLRTMLRLMAEREVVRVIDD 180

Query: 178 QFGTPTSALQIARAIIQIAHNLIENSDTSL---RGIFHMTADGGPVSWADFAEYIFWESA 234
           QFG PT    IA A   +  + + +    L    G++H+T   G  SW  FA  I   + 
Sbjct: 181 QFGAPTWVRMIAEATAILVASSLRSGTADLAGASGVYHLTCS-GQTSWYGFACAIREHAV 239

Query: 235 ERG---GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             G      ++V  I T +YPT A RPA+S LD  KL     I +  W + +   L ++
Sbjct: 240 AAGLLPDTAARVEAIPTSEYPTPAKRPAHSVLDLGKLEARFGIVLPVWDQALELCLADL 298


>gi|33637044|gb|AAQ23682.1| dTDP-4-dehydrorhamnose reductase [Geobacillus stearothermophilus]
          Length = 281

 Score =  212 bits (539), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 118/291 (40%), Positives = 168/291 (57%), Gaps = 13/291 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK +V G  GQ+   L  +   +  E+   GR ++D+             +PDV+I+ AA
Sbjct: 1   MKVIVTGAKGQLGTDLVHLLADRGYEVYGYGREELDITNFDQVKQVISEVNPDVVIHAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VD AE EP+ AF INA G   +A A++++G   +YISTDYVFDG + TP +EF+ TN
Sbjct: 61  YTKVDLAESEPDQAFLINAYGTRNVAVASEAVGAKLVYISTDYVFDGTATTPYNEFALTN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL++YGKSKLAGE+ V    + + I+RT+WVY   G+NF+ +MLRLA+ER E+ VV DQ 
Sbjct: 121 PLSVYGKSKLAGEQFVRDLHSKFFIVRTSWVYGKHGNNFVKTMLRLAQERNELMVVNDQV 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PT  + +A  I++I         T   GI+H++ + G  SW +FA+ IF    E  G 
Sbjct: 181 GCPTYTVDLANCILEIIQ-------TEKYGIYHVS-NSGHCSWYEFAKAIF----EEAGI 228

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             KV    TK +P  A RPAYS  +   L       +  W+E ++  +V I
Sbjct: 229 EVKVNPCTTKDFPRPAPRPAYSVFEHMALRLNGFNEMRNWREALKEFIVQI 279


>gi|289624736|ref|ZP_06457690.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289648650|ref|ZP_06479993.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|330868865|gb|EGH03574.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 301

 Score =  211 bits (538), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 118/298 (39%), Positives = 170/298 (57%), Gaps = 13/298 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID-----LLKPKDFASFFLSFSPDVII 55
           MK L++G NGQ+   L        ++I + R   D     L   +  A+   + +P +++
Sbjct: 1   MKILLLGKNGQVGWELQRALAPLGDVIALDRQGTDGLCGDLTNLEGLAATVRALAPHIVV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVDKAE E E+A  IN +  G +A+ A ++G   I+ STDYVF+G    P  E 
Sbjct: 61  NAAAYTAVDKAETEQELAMLINGDAPGVLAREAATLGAWLIHYSTDYVFNGSGEKPWYEN 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
             T PL++YG+SKL GE+ + +     ++LRT+WVY+  G+NF  +MLRLA ER  ++VV
Sbjct: 121 GHTGPLSVYGRSKLMGEQAIQASGAKALVLRTSWVYAAKGNNFAKTMLRLATERDSLNVV 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDT-SLRGIFHMTADGGPVSWADFAEYIFWESA 234
            DQ+G PT A  IA    QI H ++ + D+ +L GI+H+ A  G  SW  FA +I  E A
Sbjct: 181 ADQYGAPTGAELIADVTAQILHRVLRDQDSAALAGIYHLAA-AGETSWHGFARFIL-EHA 238

Query: 235 ERGGPYSKVY-----RIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           ER G   KV       I TK YP  A RP  S L  +KL  T  +++  W++G + +L
Sbjct: 239 ERSGVQLKVLPDKIGAIPTKAYPLPAPRPNNSRLALNKLETTFQLKMPPWQQGAQRML 296


>gi|149913026|ref|ZP_01901560.1| hypothetical protein RAZWK3B_03520 [Roseobacter sp. AzwK-3b]
 gi|149813432|gb|EDM73258.1| hypothetical protein RAZWK3B_03520 [Roseobacter sp. AzwK-3b]
          Length = 285

 Score =  211 bits (538), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 168/291 (57%), Gaps = 12/291 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M  LV G  GQ+A  L++   +  + + +GR + DL +P+  A+   +  P  +IN AAY
Sbjct: 1   MSLLVFGKTGQVATELAA---RAPDAVFLGRTEADLSQPEACAAAITAHRPWAVINAAAY 57

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE+E  +A  +NA+   A+A+A  + GIP I+ISTDYVFDG    P     P  P
Sbjct: 58  TAVDRAEEEEALAHVVNADAPEAMARACAANGIPLIHISTDYVFDGAGTAPRATTDPVAP 117

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N YG+SKLAGEE +A     + +LRT+WV+S  G+NFL +MLRL++ R  +++V DQ G
Sbjct: 118 QNAYGRSKLAGEEAIAQAGGAFAVLRTSWVFSAHGANFLKTMLRLSESRDALNIVDDQIG 177

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A  IA A + IA  +   +D    GI+H +  G P VSW +FAE IF  +  R   
Sbjct: 178 GPTPAADIAAACLTIAEQM--RADPGKTGIYHFS--GAPDVSWKEFAETIFAMAGRR--- 230

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V  I T  YPT A RP  S LDC+       I    W+ GV ++L ++
Sbjct: 231 -VAVGGIPTADYPTPAARPLNSRLDCALTETVFGISRPDWRMGVGSVLKDL 280


>gi|262192434|ref|ZP_06050586.1| dTDP-4-dehydrorhamnose reductase [Vibrio cholerae CT 5369-93]
 gi|262031698|gb|EEY50284.1| dTDP-4-dehydrorhamnose reductase [Vibrio cholerae CT 5369-93]
          Length = 296

 Score =  211 bits (538), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 176/292 (60%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSM--CVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ LV G+ GQ+  SL      +++VE + V R  +D+  P    +    F P++IIN A
Sbjct: 2   MRVLVTGSRGQVGHSLVQQLSTMKEVEFLAVDRDQLDITHPAQVDAVVNEFKPNIIINAA 61

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVD+AE E E++++IN +G   +A+AA+ +G   ++ISTDYVF G    P  E  PT
Sbjct: 62  AHTAVDRAEQEIELSYAINRDGPHYLAQAANKVGAVILHISTDYVFSGDKPNPYLETDPT 121

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P  +YG+SKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV DQ
Sbjct: 122 APQGVYGESKLAGEIAVAQACLRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVADQ 181

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
            G PT A  IA A++ +A  ++E   T+  G++H +  G P VSW +FA  IF ++ ++G
Sbjct: 182 CGGPTYAGDIANALLMMAKAIVEGKSTAF-GVYHFS--GLPHVSWHEFACTIFDKARDQG 238

Query: 238 --GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
                 +V  I T++YPT A RPA S LD  K+     +  S W+  + +++
Sbjct: 239 ILNKSLQVNAITTQEYPTPAKRPANSRLDTQKIHQHFGVVASDWQTALNHLI 290


>gi|29726001|gb|AAO88931.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Vibrio cholerae]
          Length = 296

 Score =  211 bits (538), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 119/294 (40%), Positives = 178/294 (60%), Gaps = 12/294 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G+ GQ+     Q LS+M  ++VE + V R  +D+  P    +    F P++IIN
Sbjct: 2   MRVLVTGSRGQVGHCLVQQLSTM--KEVEFLAVDRDQLDITYPAQVDAVVNEFKPNIIIN 59

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA  +G   ++ISTDYVF G    P  E  
Sbjct: 60  AAAHTAVDRAEQEIELSYAINRDGPHYLAQAAQKVGAAILHISTDYVFSGDKPNPYLETD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT P  +YG+SKLAGE  VA   + ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV 
Sbjct: 120 PTAPQGVYGESKLAGEIAVAQACSRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVA 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQ G PT A  IA A++ +A  ++E   T+  G++H +  G P VSW +FA  IF ++ +
Sbjct: 180 DQCGGPTYAGDIANALLMMAKAIVEGKSTAF-GVYHFS--GLPHVSWHEFACTIFDKARD 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +G      +V  I T++YPT A RPA S LD  K+     +  S W+  + +++
Sbjct: 237 QGILNKSLQVNAITTQEYPTPAKRPANSRLDTQKIHQHFGVVASDWQTALNHLI 290


>gi|146309306|ref|YP_001189771.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas mendocina ymp]
 gi|145577507|gb|ABP87039.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas mendocina ymp]
          Length = 287

 Score =  211 bits (537), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 117/290 (40%), Positives = 163/290 (56%), Gaps = 4/290 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G+ GQ+A+ L  + ++  E++ +GR   DL +P       L   P ++IN AAY
Sbjct: 1   MKILISGHTGQVARELQ-LALRKHELVSLGRQAFDLSRPDSLRETILRERPALVINAAAY 59

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE E E+AFS+NAE  G +A A   + IP I+ STDYVFDG   TP  E    +P
Sbjct: 60  TAVDQAEQERELAFSVNAEAPGVMADACFELDIPLIHYSTDYVFDGSKATPYREADTPHP 119

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG SK AGE+ +     +++ILRT+WVYS  G NFLL+M RL +ER E+SVV DQ G
Sbjct: 120 LGVYGASKAAGEQALRISGCDHLILRTSWVYSQHGRNFLLTMQRLLQEREELSVVDDQIG 179

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT A  IA A  ++     +       G +H+T   G  SW  FA  I       G P 
Sbjct: 180 APTWAGSIASATTELIDKWQQGRHHW--GTYHLTCQ-GETSWFGFASAIAERLRAAGKPC 236

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           +++  I + +YPT A RP  S LD  +L     +R+  W+  +   L  +
Sbjct: 237 ARLRPIPSSEYPTPAQRPLNSRLDGERLEQEWQVRLPDWRAALDACLQRM 286


>gi|71898671|ref|ZP_00680841.1| dTDP-4-dehydrorhamnose reductase [Xylella fastidiosa Ann-1]
 gi|71731618|gb|EAO33679.1| dTDP-4-dehydrorhamnose reductase [Xylella fastidiosa Ann-1]
          Length = 302

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 127/303 (41%), Positives = 165/303 (54%), Gaps = 19/303 (6%)

Query: 1   MKCLVIGNNGQIAQ----SLSSMCVQDVEIIRVGR-PD------IDLLKPKDFASFFLSF 49
           M  LV G  GQI Q    SLS   V    + R GR P+       D  +P+   +   + 
Sbjct: 1   MTVLVFGAGGQIGQELLRSLSGRVV--CAVTRSGRLPNGAGCVQADFGQPETLRALLDAQ 58

Query: 50  SPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSR 109
            P  ++N AAYTAVD+AE EP++ F INA+  G IA      G+P ++ STDYVFDG + 
Sbjct: 59  RPAQVVNAAAYTAVDRAESEPDVVFRINAQAPGVIAHWCAEHGVPLVHYSTDYVFDGQAT 118

Query: 110 TPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKER 169
           +P     P  PLNIYG SKLAGE  V +     +ILRT+WVY+  G NFL +MLRL    
Sbjct: 119 SPYGVDDPVTPLNIYGASKLAGECAVRAAGGCSLILRTSWVYAAHGHNFLRTMLRLGATS 178

Query: 170 REISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYI 229
             + VV DQ GTPT+A  IA    Q+   L+E   +   GI+H+TA  G  SW  FAE I
Sbjct: 179 ECLRVVADQIGTPTAAGLIADVTAQL---LVEQVQSRHAGIWHLTA-AGQTSWHGFAEEI 234

Query: 230 FWESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           F ++   G      +V  I +  YPT A RP YSCLD + L     I +  W++GVR +L
Sbjct: 235 FVQAQACGLMMRVPQVQAIGSVVYPTAARRPGYSCLDTTALVEAFGIVLPDWRQGVRGVL 294

Query: 288 VNI 290
             I
Sbjct: 295 DEI 297


>gi|254286304|ref|ZP_04961263.1| dTDP-4-dehydrorhamnose reductase [Vibrio cholerae AM-19226]
 gi|150423719|gb|EDN15661.1| dTDP-4-dehydrorhamnose reductase [Vibrio cholerae AM-19226]
          Length = 296

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 119/294 (40%), Positives = 178/294 (60%), Gaps = 12/294 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G+ GQ+     Q LS+M  ++VE + V R  +D+  P    +    F P++IIN
Sbjct: 2   MRVLVTGSRGQVGHCLVQQLSTM--KEVEFLAVDRDQLDITYPAQVDAVVNEFKPNIIIN 59

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA  +G   ++ISTDYVF G    P  E  
Sbjct: 60  AAAHTAVDRAEQEIELSYAINRDGPHYLAQAAQKVGAAILHISTDYVFSGDKPNPYLETD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT P  +YG+SKLAGE  VA   + ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV 
Sbjct: 120 PTAPQGVYGESKLAGEIAVAQACSRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVA 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQ G PT A  IA A++ +A  ++E   T+  G++H +  G P VSW +FA  IF ++ +
Sbjct: 180 DQCGGPTYAGDIANALLMMAKAIVEGKSTAF-GVYHFS--GLPHVSWHEFACTIFDKARD 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +G      +V  I T++YPT A RPA S LD  K+     +  S W+  + +++
Sbjct: 237 QGILNKSLQVNAITTQEYPTPAKRPANSRLDTQKIHQYFGVVASDWQTALNHLI 290


>gi|307246378|ref|ZP_07528454.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307255364|ref|ZP_07537174.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259814|ref|ZP_07541532.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306852711|gb|EFM84940.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306861673|gb|EFM93657.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866112|gb|EFM97982.1| dTDP-4-dehydrorhamnose reductase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 291

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 122/290 (42%), Positives = 166/290 (57%), Gaps = 10/290 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L+ G  GQ+   L+       +++ V R ++D+            F+P+VIIN AA+T
Sbjct: 3   RFLITGAKGQVGYCLTKQLQSKADVLAVDRDELDITNRDAVFKIVREFNPNVIINAAAHT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE E E++ +IN +G   +A+AA+ I    ++ISTDYVF+G       E    NP 
Sbjct: 63  AVDRAESEIELSEAINVKGPQYLAEAANEIDAVILHISTDYVFEGTGSGEYKEDDKPNPQ 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
            +YGK+KLAGE  V      ++ILRTAWV+   G+NF+ +MLRL KER  + +V DQFG 
Sbjct: 123 GVYGKTKLAGERVVQQANKKHIILRTAWVFGEHGNNFVKTMLRLGKERESLGIVSDQFGG 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAER---- 236
           PT A  IA A+IQIA N I N      GI+H T  G P VSWADFA  IF E+  +    
Sbjct: 183 PTYAGDIANALIQIA-NTILNGKQDAFGIYHFT--GKPYVSWADFANTIFNEAVSQKVLE 239

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
             P   V  I T  YPT A RPA S LD +K+     I+ S W+  ++NI
Sbjct: 240 KAPL--VNFISTSDYPTPAKRPANSRLDLTKIDAVFGIKPSDWQRALKNI 287


>gi|319427034|gb|ADV55108.1| dTDP-4-dehydrorhamnose reductase [Shewanella putrefaciens 200]
          Length = 291

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 122/291 (41%), Positives = 175/291 (60%), Gaps = 9/291 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK L+ G+NGQ+ +SL     Q  D+E + + R  +D+   +        F P+VIIN A
Sbjct: 1   MKILITGSNGQVGRSLVKQLNQMPDIEFLAMDREQLDITDCEAVNKLVNEFKPNVIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAE E E++++IN +G   +AKAA+S+G   ++ISTDYVF G  +    E    
Sbjct: 61  AHTAVDKAEQEVELSYAINRDGPQFLAKAANSVGATILHISTDYVFAGDKQGEYSEDDTV 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG+SKLAGE  VA+    ++ILRTAWV+   G+NF+ +MLRLA+ R E  VV DQ
Sbjct: 121 APQSVYGQSKLAGELAVAAANPRHIILRTAWVFCETGNNFVKTMLRLAQSRDEFGVVADQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA A+I +A  L  ++  +  G++H    G P V+W  FA  IF ++  +G
Sbjct: 181 FGGPTYAGDIAYALIAMAKVL--HAGNNNYGVYHFA--GLPHVNWHQFAVDIFKQANAQG 236

Query: 238 GPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
             +   +V  I T QYPT A RPA S L+C K+  +  I  S W+  + N+
Sbjct: 237 ILHKELRVNAITTAQYPTTAKRPANSKLNCYKIGQSFGINPSDWQAALNNL 287


>gi|29725981|gb|AAO88915.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Vibrio cholerae]
          Length = 296

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 178/294 (60%), Gaps = 12/294 (4%)

Query: 1   MKCLVIGNNGQI----AQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G+ GQ+    AQ LS+M  ++VE + + R  +D+       +    F P++IIN
Sbjct: 2   MRVLVTGSRGQVGHCLAQQLSTM--KEVEFLAIDRDQLDITHSAQVDAVVNEFKPNIIIN 59

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA  +G   ++ISTDYVF G    P  E  
Sbjct: 60  AAAHTAVDRAEQEIELSYAINRDGPHYLAQAAQKVGAAILHISTDYVFSGDKPNPYLETD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT P  +YG+SKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV 
Sbjct: 120 PTAPQGVYGESKLAGEIAVAQACPRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVA 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQ+G PT A  IA A++ +A  ++E   T+  G++H +  G P VSW +FA  IF ++ +
Sbjct: 180 DQYGGPTYAGDIANALLMMAKAIVEGKSTAF-GVYHFS--GLPHVSWHEFACTIFDKARD 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +G      +V  I T++YPT A RPA S LD  K+     +  S W+  + +++
Sbjct: 237 QGILNKSLQVNAITTQEYPTPAKRPANSRLDTQKIHQHFGVVASDWQTALNHLI 290


>gi|114798649|ref|YP_759508.1| dTDP-4-dehydrorhamnose reductase [Hyphomonas neptunium ATCC 15444]
 gi|114738823|gb|ABI76948.1| dTDP-4-dehydrorhamnose reductase [Hyphomonas neptunium ATCC 15444]
          Length = 296

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 163/282 (57%), Gaps = 4/282 (1%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LVIG++GQ+AQSL +M  +DV  + VGRPD DL  P   A      +P +++N   YT V
Sbjct: 9   LVIGSSGQLAQSLRAMGREDV--VCVGRPDADLADPIKLADLVAKMTPRLVLNAGGYTKV 66

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D AE +   AF++N +G   +A+   S  IP I+ISTD VFDG    P        P+N 
Sbjct: 67  DPAETQTSEAFALNRDGPATLARLCASADIPLIHISTDCVFDGRKEAPYTPEDLAEPINA 126

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKLAGEE VA     ++I+R +WV+S    NF+ +ML++A++R EISVV DQ G PT
Sbjct: 127 YGRSKLAGEEAVALSCRKHLIVRVSWVFSEHADNFVRTMLKIARQRDEISVVRDQIGYPT 186

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKV 243
               +A  +++IA  +++       GI+H+ A G  V  A  AE IF ES   GGP ++V
Sbjct: 187 YCPDLAAGLLEIAGQVLQPGFEDW-GIYHL-AGGSEVDRASMAEAIFAESRTIGGPAARV 244

Query: 244 YRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRN 285
             + T+ YPT A RP  + LD  K      + +  W+ G++ 
Sbjct: 245 LPVLTQDYPTPAERPLNARLDAGKANRVFGVALPNWQIGLQK 286


>gi|295400931|ref|ZP_06810906.1| dTDP-4-dehydrorhamnose reductase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976933|gb|EFG52536.1| dTDP-4-dehydrorhamnose reductase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 282

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 123/288 (42%), Positives = 158/288 (54%), Gaps = 13/288 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK +V G NGQ+ Q L     Q + E+    + ++D+              PD+IIN AA
Sbjct: 1   MKVVVTGANGQLGQELVRQLQQTNFELYPFTKSELDITNESIVNEVITKIEPDIIINAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VD+AE E E A+ +NA G   +  AA+ +G    YISTDYVFDG S  P  E+  TN
Sbjct: 61  YTKVDQAEIEEETAYLVNAFGQRNLVVAAEKVGAKICYISTDYVFDGSSMIPYREYDRTN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YGKSKL GEE   S  + Y I+RTAWVY  FG NF+ +MLRLAKE+ EI VV DQ 
Sbjct: 121 PLGVYGKSKLVGEELTKSLCSRYFIVRTAWVYGEFGQNFVKTMLRLAKEKEEIHVVNDQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT  + +AR II +         T   GI+H T + G  SW +FA  IF ES      
Sbjct: 181 GSPTYTVDLARFIIDLVQ-------TDKFGIYHCT-NSGSCSWYEFATAIFEES----NI 228

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             KV  I T+Q P  A RP YS LD   +       +  W+E ++  L
Sbjct: 229 NVKVNPITTEQLPRPAARPKYSVLDNFAMKVNGFPMLRHWREALKEFL 276


>gi|253999153|ref|YP_003051216.1| dTDP-4-dehydrorhamnose reductase [Methylovorus sp. SIP3-4]
 gi|253985832|gb|ACT50689.1| dTDP-4-dehydrorhamnose reductase [Methylovorus sp. SIP3-4]
          Length = 301

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 117/295 (39%), Positives = 165/295 (55%), Gaps = 14/295 (4%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L+ G +GQ+  +L  M      +  + R  ++L           +  PDVI+NPAAYT
Sbjct: 5   RILLTGVHGQVGHALLPMLATWGTVTALDRAALNLSDAAAIRKTVRTLRPDVIVNPAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE EP++A++INAE    +A+ A  +G   ++ STDYVFDG +  P  E   TNPL
Sbjct: 65  AVDKAETEPDLAYAINAEAPRILAEEAAELGARMVHYSTDYVFDGRASKPYRETDMTNPL 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
            +YG SKLAGE+ V      ++ILRT+WVY  +G NFL ++LRLA+ER  + +V DQFG 
Sbjct: 125 GVYGASKLAGEKAVQQAGQQHLILRTSWVYGAYGKNFLHTILRLARERDSLGIVADQFGA 184

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWE----SAERG 237
           PTS+  IA A +     L+++    L GI+H+T + G  SW  FA  I        AER 
Sbjct: 185 PTSSHDIASATL----TLLKSWQPELSGIYHLT-NSGYTSWYGFAVAILQAYEGLQAERD 239

Query: 238 GP-----YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            P        V  I T +YPT A RPA S LD   L     +R+  W++ +  ++
Sbjct: 240 LPPLRVSSEAVRAITTAEYPTPAARPANSRLDGDLLEQDWGLRLQDWRQALVQVM 294


>gi|330975552|gb|EGH75618.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 301

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 117/300 (39%), Positives = 169/300 (56%), Gaps = 11/300 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID-----LLKPKDFASFFLSFSPDVII 55
           MK L++G NGQ+   L        E+I + R   D     L   +  A+   + +PDVI+
Sbjct: 1   MKILLLGKNGQVGWELQRALAPLGEVIALDRQGADGRCGDLADLERLAATVRALAPDVIV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVDKAE EP++A  IN E  G +A+ A ++G   I+ STDYVFDG       E 
Sbjct: 61  NAAAYTAVDKAESEPDLAMLINGEAPGVLAREAAALGAWLIHYSTDYVFDGSGEQQWRED 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
           + T PL++YG+SKL GE+ + +     +ILRT+WVY+  G NF  +MLRLA ER  ++VV
Sbjct: 121 AATGPLSVYGRSKLKGEQAIQASGAKALILRTSWVYAARGHNFAKTMLRLATERDSLNVV 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
            DQ+G PT A  IA    QI H +  + +  +L GI+H+ A  G  SW  FA+++   +A
Sbjct: 181 ADQYGAPTGAELIADVTAQILHRVRADQNPAALAGIYHLAA-AGETSWHGFAQFVLEHAA 239

Query: 235 ERGGPYS----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             G        ++  I T+ YP  A RP  S L  SKL     +++ +W++G + +L  I
Sbjct: 240 LNGVALKVAPDQIGAIPTEAYPVPAPRPRNSRLALSKLETAFQLKMPSWQQGAQRMLDEI 299


>gi|115279711|gb|ABI85327.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Vibrio cholerae]
 gi|115279743|gb|ABI85359.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Vibrio cholerae]
          Length = 296

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 119/294 (40%), Positives = 177/294 (60%), Gaps = 12/294 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G+ GQ+     Q LS+M  ++VE + V R  +D+  P    +    F P++IIN
Sbjct: 2   MRVLVTGSRGQVGHCLVQQLSTM--KEVEFLAVDRDQLDITYPAQVDAVVNEFKPNIIIN 59

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA  +G   ++ISTDYVF G    P  E  
Sbjct: 60  AAAHTAVDRAEQEIELSYAINRDGPHYLAQAAQKVGAAILHISTDYVFSGDKPNPYLETD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT P  +YG+SKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV 
Sbjct: 120 PTAPQGVYGESKLAGEIAVAQACPRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVA 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQ G PT A  IA A++ +A  ++E   T+  G++H +  G P VSW +FA  IF ++ +
Sbjct: 180 DQCGGPTYAGDIANALLMMAKAIVEGKSTAF-GVYHFS--GLPHVSWHEFACTIFDKARD 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +G      +V  I T++YPT A RPA S LD  K+     +  S W+  + +++
Sbjct: 237 QGILNKSLQVNAITTQEYPTPAKRPANSRLDTQKIHQHFGVVASDWQTALNHLI 290


>gi|29726006|gb|AAO88935.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Vibrio cholerae]
          Length = 296

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 177/294 (60%), Gaps = 12/294 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G+ GQ+     Q LS+M  ++VE + V R  +D+       +    F P++IIN
Sbjct: 2   MRVLVTGSRGQVGHCLVQQLSTM--KEVEFLAVDRDQLDITHSAQVDAVVNEFKPNIIIN 59

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA  +G   ++ISTDYVF G    P  E  
Sbjct: 60  AAAHTAVDRAEQEIELSYAINRDGPHYLAQAAQKVGAAILHISTDYVFSGDKPNPYLETD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT P  +YG+SKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV 
Sbjct: 120 PTAPQGVYGESKLAGEIAVAQACPRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVA 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQ+G PT A  IA A++ +A  ++E   T+  G++H +  G P VSW +FA  IF ++ +
Sbjct: 180 DQYGGPTYAGDIANALLMMAKAIVEGKSTAF-GVYHFS--GLPHVSWHEFACTIFDKARD 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +G      +V  I T++YPT A RPA S LD  K+     +  S W+  + +++
Sbjct: 237 QGILNKSLQVNAITTQEYPTPAKRPANSQLDTQKIHQHFGVVASDWQAALNHLI 290


>gi|294788795|ref|ZP_06754036.1| dTDP-4-dehydrorhamnose reductase [Simonsiella muelleri ATCC 29453]
 gi|294483277|gb|EFG30963.1| dTDP-4-dehydrorhamnose reductase [Simonsiella muelleri ATCC 29453]
          Length = 302

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 118/288 (40%), Positives = 169/288 (58%), Gaps = 7/288 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+ G NGQ+   L +      EI+   R  +D+            F PDVIIN AAYT
Sbjct: 14  KYLITGANGQVGSQLVAQLQGKAEILATDRNALDITDRASVLQIVNEFRPDVIINAAAYT 73

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE E  +A +IN  GA  +A AA+ +G   ++ISTDYVFDG    P  E  P  P 
Sbjct: 74  AVDKAESEANLAHAINCTGAENLAIAANEVGAIILHISTDYVFDGKGEKPYRETDPVAPQ 133

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YGK+KLAGE  V +    ++ILRTAWV++  G+NF+ +M+RL K+R  + +V DQFG+
Sbjct: 134 SVYGKTKLAGELAVQAACARHIILRTAWVFNEHGNNFIKTMIRLGKQRDTLGIVGDQFGS 193

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG--G 238
           PT A  IA A+I I+  L+ N+     G++H +  G P VSW +FA  IF ++ ++    
Sbjct: 194 PTYAGDIANALILISEQLMNNNQNF--GVYHFS--GSPYVSWFEFACEIFTQAQQQQILS 249

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
               + +I T+ YPT A RPA+S LDC K+     I+ S W+  + ++
Sbjct: 250 QLPVLNKIATEDYPTPAFRPAHSRLDCGKIQAVFGIQPSDWQRALTDL 297


>gi|29725991|gb|AAO88923.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Vibrio cholerae]
          Length = 296

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 119/294 (40%), Positives = 177/294 (60%), Gaps = 12/294 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G+ GQ+     Q LS+M  ++VE + V R  +D+  P    +    F P++IIN
Sbjct: 2   MRVLVTGSRGQVGHCLVQQLSTM--KEVEFLAVDRDQLDITYPAQVDAVVNEFKPNIIIN 59

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA  +G   ++ISTDYVF G    P  E  
Sbjct: 60  AAAHTAVDRAEQEIELSYAINRDGPHYLAQAAQKVGAAILHISTDYVFSGDKPNPYLETD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT P  +YG+SKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV 
Sbjct: 120 PTAPQGVYGESKLAGEIAVAQACPRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVA 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQ G PT A  IA A++ +A  ++E   T+  G++H +  G P VSW +FA  IF ++ +
Sbjct: 180 DQCGGPTYAGDIANALLMMAKAIVEGKSTAF-GVYHFS--GLPHVSWHEFACTIFDKARD 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +G      +V  I T++YPT A RPA S LD  K+     +  S W+  + +++
Sbjct: 237 QGILNKSLQVNAITTQEYPTPAKRPANSRLDTQKIHQHFGVVASDWQTALNHLI 290


>gi|56965450|ref|YP_177182.1| dTDP-4-dehydrorhamnose reductase [Bacillus clausii KSM-K16]
 gi|56911694|dbj|BAD66221.1| dTDP-4-dehydrorhamnose reductase [Bacillus clausii KSM-K16]
          Length = 281

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 168/289 (58%), Gaps = 13/289 (4%)

Query: 2   KCLVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + L+ G  GQ+   L S   +   ++  + R D+D+       S F    PD++++ AAY
Sbjct: 4   RVLITGAGGQLGHDLVSQFSLNGYQVFGLTRQDLDITDQDMVKSVFEKVKPDLVVHAAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE + + AF +NA G   +A  A+      +YISTDYVF+G +R PI+EFSP  P
Sbjct: 64  TAVDQAESDVDDAFRVNAIGTRNVAVEANRYNAKVVYISTDYVFNGQAREPINEFSPVAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           + IYG+SKLAGE  +    N + I+RT+WVY   G+NF+ +ML+L +E+ EI VV DQ G
Sbjct: 124 IGIYGQSKLAGENYIRDLCNQFFIVRTSWVYGSLGNNFVKTMLKLGQEKEEIGVVADQIG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT  + +A++I++I         T   GI+H++ + G  SW +FA+ IF    E  G  
Sbjct: 184 SPTYTVDLAKSIVEIGA-------TEKFGIYHVS-NSGSCSWYEFAKAIF----EISGID 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
            KV  + T+++P  A RPAYS  D   L      ++  W+E +R+ L N
Sbjct: 232 VKVKALSTEEFPRPAKRPAYSVFDHMGLRLNGFNKVRNWREALRDFLEN 280


>gi|66044180|ref|YP_234021.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254887|gb|AAY35983.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas syringae pv. syringae
           B728a]
          Length = 301

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 169/301 (56%), Gaps = 13/301 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID-----LLKPKDFASFFLSFSPDVII 55
           MK L++G NGQ+   L        E+I + R   D     L   +  A+   + +PDVI+
Sbjct: 1   MKILLLGKNGQVGWELQRALAPLGEVIALDRQGADGLCGDLADLERLAATVRALAPDVIV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVDKAE EP++A  IN E  G +AK A ++G   I+ STDYVFDG       E 
Sbjct: 61  NAAAYTAVDKAESEPDLAMLINGEAPGVLAKEAAALGAWLIHYSTDYVFDGSGEQQWRED 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
           + T PL++YG SKL GE+ + +     +ILRT+WVY+  G NF  +MLRLA ER  ++VV
Sbjct: 121 AATGPLSVYGGSKLMGEQAIQASGAKALILRTSWVYAARGHNFAKTMLRLATERDSLNVV 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
            DQ+G PT A  IA    QI + +  + +  +L GI+H+ A  G  SW  FA+++  E A
Sbjct: 181 ADQYGAPTGAELIADVTAQILYRVRADQNPAALAGIYHLAA-AGETSWHGFAQFVL-EHA 238

Query: 235 ERGGPYSKVY-----RIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
            R G   KV       I T+ YP  A RP  S L  SKL     +++ +W++G + +L  
Sbjct: 239 ARNGVALKVAPDQIGAIPTEAYPVPAPRPRNSRLALSKLETAFQLKMPSWQQGAQRMLDE 298

Query: 290 I 290
           I
Sbjct: 299 I 299


>gi|253996730|ref|YP_003048794.1| dTDP-4-dehydrorhamnose reductase [Methylotenera mobilis JLW8]
 gi|253983409|gb|ACT48267.1| dTDP-4-dehydrorhamnose reductase [Methylotenera mobilis JLW8]
          Length = 319

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 117/295 (39%), Positives = 170/295 (57%), Gaps = 18/295 (6%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQD----VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINP 57
           K L+ G NGQ+  +L            E++ + R  +DL  P+       +  PD+IINP
Sbjct: 20  KILLTGVNGQVGHALQLALANQSGLFAELVCLDRSQLDLSNPQAIRDVVQAIQPDLIINP 79

Query: 58  AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSP 117
           AAYTAVDKAE EP++A++INA   G +A+ A  +G   I+ STDYV+ G       E   
Sbjct: 80  AAYTAVDKAESEPDLAYAINATAPGVLAEEAAKLGAKFIHFSTDYVYAGNKIGVYVEDDA 139

Query: 118 TNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD 177
           T PL+IYGKSKLAGEE V +     +I RT+WVY  +G NFL ++LRLAKER ++ +V D
Sbjct: 140 TAPLSIYGKSKLAGEEAVRAVGLPSLIFRTSWVYGAYGKNFLHTILRLAKEREQLRIVAD 199

Query: 178 QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE-- 235
           Q G PTS+  IA+A++++    +   D    G++H+  + G  +W  FA  I    A+  
Sbjct: 200 QIGAPTSSHSIAQAVVEV----LARWDGEHSGVYHLV-NAGRTTWHGFATAIVDAYAQLQ 254

Query: 236 --RGGPYSK-----VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
             R  P  K     +  I T  YPT A RPA SCLDC+KL++  ++++  W++ +
Sbjct: 255 PARDWPMLKAKVANIGPITTADYPTPAARPANSCLDCTKLSSDFSVQLPDWRDAL 309


>gi|1890604|emb|CAB01952.1| ExpA10 [Sinorhizobium meliloti]
          Length = 275

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 165/264 (62%), Gaps = 1/264 (0%)

Query: 24  VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGA 83
           +E++ +GRP +DL +P           PD++++ AAYTAVD+AE EPE AF++NA GAGA
Sbjct: 1   MEVVTIGRPHLDLTEPATILPAIERCRPDLVVSAAAYTAVDQAESEPEAAFAVNAFGAGA 60

Query: 84  IAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYV 143
           +A+AA  + +P ++ISTDYVFDG       E     PL++YG SKLAGE  VA  T  ++
Sbjct: 61  VAEAAACLEVPIVHISTDYVFDGSKPRSYAEGDTPAPLSVYGASKLAGESAVAEATPRHL 120

Query: 144 ILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENS 203
           ILRT WVYS FG NF+ ++LRLA+ER +I+VV DQ G P+SA+ +A AI+ I+  L ++ 
Sbjct: 121 ILRTGWVYSPFGKNFVKTILRLAEEREDIAVVADQRGNPSSAIDLADAILDISARLTKSR 180

Query: 204 DTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCL 263
             +  G++H+ A  G VS ADFA +    S   GGP++ V  I T  +PT A RPA S L
Sbjct: 181 QDAAFGLYHL-AGSGVVSRADFARHALAASRAAGGPWAHVRDIATGGFPTPASRPANSSL 239

Query: 264 DCSKLANTHNIRISTWKEGVRNIL 287
             +K   T    +  W+  V   +
Sbjct: 240 SSAKFNATFGQAMPAWQGSVERTV 263


>gi|241761595|ref|ZP_04759682.1| dTDP-4-dehydrorhamnose reductase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241373903|gb|EER63436.1| dTDP-4-dehydrorhamnose reductase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 297

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 161/287 (56%), Gaps = 3/287 (1%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LVIG NGQ+A SLS +  + +  I  GRP +D               P +IIN AA+TAV
Sbjct: 10  LVIGRNGQLATSLSKLGKESITCI--GRPILDFNYLDSILEIIKRHKPRIIINTAAWTAV 67

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D AE + + A  IN  GA  +A   ++I IP I+ISTDYV+DG   +P  E  P  P  +
Sbjct: 68  DLAEKQKKAAMQINYLGAKELAHVCNNIQIPLIHISTDYVYDGKKGSPYIETDPIKPQTV 127

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SK AGE  V S   N +ILRT+WVYS  G NF+  ++  +K++  + VV DQ+G PT
Sbjct: 128 YGRSKAAGELAVLSENPNSIILRTSWVYSSCGENFVCKIINASKKQSSLKVVADQYGNPT 187

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKV 243
           ++  +A AII I   +   S    +GI++++  G   SW +FA+ I  ES   G    K+
Sbjct: 188 NSDDLANAIIHIIPQIFYKSPKKCQGIYNVSGTGS-ASWYEFAKIILEESKNYGLLLPKL 246

Query: 244 YRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             IFT  +PT A RP  SCLDC K  +   IR+  W+  ++  +  I
Sbjct: 247 TPIFTSDWPTLAKRPKNSCLDCKKFKDIFGIRLPYWRSSIKKTISEI 293


>gi|307318654|ref|ZP_07598087.1| dTDP-4-dehydrorhamnose reductase [Sinorhizobium meliloti AK83]
 gi|306895681|gb|EFN26434.1| dTDP-4-dehydrorhamnose reductase [Sinorhizobium meliloti AK83]
          Length = 275

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 165/264 (62%), Gaps = 1/264 (0%)

Query: 24  VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGA 83
           +E++ +GRP +DL +P           PD++++ AAYTAVD+AE EPE AF++NA GAGA
Sbjct: 1   MEVVTIGRPHLDLTEPATILPAIERCRPDLVVSAAAYTAVDQAESEPEAAFAVNAFGAGA 60

Query: 84  IAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYV 143
           +A+AA  + +P ++ISTDYVFDG       E     PL++YG SKLAGE  VA  T  ++
Sbjct: 61  VAEAAACLEVPIVHISTDYVFDGSKPGSYAEGDTPAPLSVYGASKLAGESAVAEATPRHL 120

Query: 144 ILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENS 203
           ILRT WVYS FG NF+ ++LRLA+ER +I+VV DQ G P+SA+ +A AI+ I+  L ++ 
Sbjct: 121 ILRTGWVYSPFGKNFVKTILRLAEEREDIAVVADQRGNPSSAIDLADAILDISARLTKSR 180

Query: 204 DTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCL 263
             +  G++H+ A  G VS ADFA +    S   GGP++ V  I T  +PT A RPA S L
Sbjct: 181 QDAAFGLYHL-AGSGVVSRADFARHALAASRAAGGPWAHVRDIATGGFPTPASRPANSSL 239

Query: 264 DCSKLANTHNIRISTWKEGVRNIL 287
             +K   T    +  W+  V   +
Sbjct: 240 SSAKFNATFGQAMPAWQGSVERTV 263


>gi|28198139|ref|NP_778453.1| dTDP-4-dehydrorhamnose reductase [Xylella fastidiosa Temecula1]
 gi|182680769|ref|YP_001828929.1| dTDP-4-dehydrorhamnose reductase [Xylella fastidiosa M23]
 gi|28056199|gb|AAO28102.1| dTDP-4-dehydrorhamnose reductase [Xylella fastidiosa Temecula1]
 gi|182630879|gb|ACB91655.1| dTDP-4-dehydrorhamnose reductase [Xylella fastidiosa M23]
 gi|307579235|gb|ADN63204.1| dTDP-4-dehydrorhamnose reductase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 302

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 127/303 (41%), Positives = 164/303 (54%), Gaps = 19/303 (6%)

Query: 1   MKCLVIGNNGQIAQ----SLSSMCVQDVEIIRVGR-PD------IDLLKPKDFASFFLSF 49
           M  LV G  GQI Q    SLS   V    + R GR P+       D  +P+   +   + 
Sbjct: 1   MTVLVFGAGGQIGQELLRSLSGRVV--CAVTRSGRLPNGVGCVQADFGQPETLRALLDAQ 58

Query: 50  SPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSR 109
            P  ++N AAYTAVD+AE EP++ F INA+  G IA      G+P ++ STDYVFDG   
Sbjct: 59  RPVQVVNAAAYTAVDRAESEPDVVFRINAQAPGVIAHWCAEHGVPLVHYSTDYVFDGQGT 118

Query: 110 TPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKER 169
           +P     P  PLNIYG SKLAGE  V +     +ILRT+WVY+  G NFL +MLRL    
Sbjct: 119 SPYGVDDPVAPLNIYGASKLAGECAVRAAGGCSLILRTSWVYAAHGHNFLRTMLRLGATS 178

Query: 170 REISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYI 229
             + VV DQ GTPT+A  IA    Q+   L+E   +   GI+H+TA  G  SW  FAE I
Sbjct: 179 ECLRVVADQIGTPTAAGLIADVTAQL---LVEQVQSRHAGIWHLTA-AGQTSWHGFAEEI 234

Query: 230 FWESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           F ++   G      +V  I +  YPT A RP YSCLD + L     I +  W++GVR +L
Sbjct: 235 FVQAQACGLMMRVPQVQAIGSVVYPTAARRPGYSCLDTTALVEAFGIVLPDWRQGVRGVL 294

Query: 288 VNI 290
             I
Sbjct: 295 DEI 297


>gi|307303495|ref|ZP_07583249.1| dTDP-4-dehydrorhamnose reductase [Sinorhizobium meliloti BL225C]
 gi|306902886|gb|EFN33478.1| dTDP-4-dehydrorhamnose reductase [Sinorhizobium meliloti BL225C]
          Length = 275

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 165/264 (62%), Gaps = 1/264 (0%)

Query: 24  VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGA 83
           +E++ +GRP +DL +P           PD++++ AAYTAVD+AE EPE AF++NA GAGA
Sbjct: 1   MEVVTIGRPHLDLTEPATILPAIERCRPDLVVSAAAYTAVDQAESEPEAAFAVNAFGAGA 60

Query: 84  IAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYV 143
           +A+AA  + +P ++ISTDYVFDG       E     PL++YG SKLAGE  VA  T  ++
Sbjct: 61  VAEAAACLEVPIVHISTDYVFDGSKPGSYAEGDTPAPLSVYGASKLAGESAVAEATPRHL 120

Query: 144 ILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENS 203
           ILRT WVYS FG NF+ ++LRLA+ER +I+VV DQ G P+SA+ +A AI+ I+  L ++ 
Sbjct: 121 ILRTGWVYSPFGKNFVKTVLRLAEEREDIAVVADQRGNPSSAIDLADAILDISARLTKSR 180

Query: 204 DTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCL 263
             +  G++H+ A  G VS ADFA +    S   GGP++ V  I T  +PT A RPA S L
Sbjct: 181 QDAAFGLYHL-AGSGVVSRADFARHALAASRAAGGPWAHVRDIATGGFPTPASRPANSSL 239

Query: 264 DCSKLANTHNIRISTWKEGVRNIL 287
             +K   T    +  W+  V   +
Sbjct: 240 SSAKFNATFGQAMPAWQGSVERTV 263


>gi|150026506|ref|YP_001297332.1| dTDP-4-dehydrorhamnose reductase [Flavobacterium psychrophilum
           JIP02/86]
 gi|149773047|emb|CAL44531.1| dTDP-4-dehydrorhamnose reductase [Flavobacterium psychrophilum
           JIP02/86]
          Length = 284

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 121/285 (42%), Positives = 166/285 (58%), Gaps = 7/285 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M  LV G +GQ+ QS+  +     + E I      +D+   +  + FF +   D  IN A
Sbjct: 1   MVILVTGASGQLGQSIQYIASNYANCEFIFASSTALDITNKEAVSHFFNTNKIDFCINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAE E E A +IN  G   +A       +  I+ISTD+VFDG S  P  E   T
Sbjct: 61  AYTAVDKAELETEKAEAINVAGPKNLAVLCKKHQVKLIHISTDFVFDGASNKPYLETDIT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           NPL IYGK+KL GE+ V + T+ Y I+RT+WVYS FG+NF+ +MLRLA ER  +S+V DQ
Sbjct: 121 NPLGIYGKTKLDGEQAVINNTDEYFIIRTSWVYSQFGNNFMKTMLRLASERDSLSIVSDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            G+PT+A+ +A+AI+QI       + ++  GI++ + + G  SW DFA  IF        
Sbjct: 181 IGSPTNAVDLAKAIMQIIAKTQHPTASTAYGIYNFSNE-GIASWYDFAVEIF----RINN 235

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
               V  I ++ +PT A RP YS LD SK+ NT  I I TW+E +
Sbjct: 236 VVIDVNPILSEAFPTPAKRPKYSLLDKSKIKNTFGIEIKTWQESL 280


>gi|29725986|gb|AAO88919.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Vibrio cholerae]
          Length = 296

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 178/294 (60%), Gaps = 12/294 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G+ GQ+     Q LS+M  ++VE + V R  +D+  P    +    F P++IIN
Sbjct: 2   MRVLVTGSRGQVGHCLVQQLSTM--KEVEFLAVDRDQLDITYPAQVDAVVNEFKPNIIIN 59

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA  +G   ++ISTDYVF G    P  E  
Sbjct: 60  AAAHTAVDRAEQEIELSYAINRDGPHYLAQAAQKVGAAILHISTDYVFSGDKPNPYLETD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT P  +YG+SKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV 
Sbjct: 120 PTAPQGVYGESKLAGEIAVAQACPRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVA 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQ G PT A  IA A++ +A  +++ + T+  G++H +  G P VSW +FA  IF ++ +
Sbjct: 180 DQCGGPTYAGDIANALLMMAKAIVDGNSTAF-GVYHFS--GLPHVSWHEFACTIFDKARD 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +G      +V  I T++YPT A RPA S LD  K+     +  S W+  + +++
Sbjct: 237 QGILNKSLQVNAITTQEYPTPAKRPANSRLDTQKIHQHFGVVASDWQAALNHLI 290


>gi|29725996|gb|AAO88927.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Vibrio cholerae]
          Length = 296

 Score =  209 bits (531), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 177/294 (60%), Gaps = 12/294 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G+ GQ+     Q LS+M  ++VE + V R  +D+  P    +    F P++IIN
Sbjct: 2   MRVLVTGSRGQVGHCLVQQLSTM--KEVEFLAVDRDQLDITYPAQVDAVVNKFKPNIIIN 59

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA  +G   ++ISTDYVF G    P  E  
Sbjct: 60  AAAHTAVDRAEQEIELSYAINRDGPHYLAQAAQKVGAAILHISTDYVFSGDKPNPYLETD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT P  +YG+SKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV 
Sbjct: 120 PTAPQGVYGESKLAGEIAVAQACPRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVA 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQ G PT A  IA A++ +A  +++   T+  G++H +  G P VSW +FA  IF ++ +
Sbjct: 180 DQCGGPTYAGDIANALLMMAKAIVDGKSTAF-GVYHFS--GLPHVSWHEFACTIFDKARD 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +G      +V  I T++YPT A RPA S LD  K+     +  S W+  + +++
Sbjct: 237 QGILNKSLQVNAITTQEYPTPAKRPANSRLDTQKIHQHFGVVASDWQTALNHLI 290


>gi|21244307|ref|NP_643889.1| dTDP-4-keto-L-rhamnose reductase [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|21109958|gb|AAM38425.1| dTDP-4-keto-L-rhamnose reductase [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 299

 Score =  209 bits (531), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 122/299 (40%), Positives = 161/299 (53%), Gaps = 18/299 (6%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEII---RVGR-PD------IDLLKPKDFASFFLSFS 50
           M  LV+G NGQ+   L      +  I+   R GR PD       D   P   +       
Sbjct: 1   MTTLVLGANGQVGTELLRALAANGPILGSTRSGRLPDGAACEVADFDAPHRLSELLDRLQ 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           P  ++N AAYTAVD+AE E + AF  NAE  G IA+      +P ++ STDYVFDG    
Sbjct: 61  PSCVVNAAAYTAVDRAEQERDAAFRANAEAPGVIAQWCARADVPLVHYSTDYVFDGQGTR 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P      T PL +YG+SKLAGE+ V +    ++I RTAWVY+  G NFL +MLR+  ER 
Sbjct: 121 PYRPDDATAPLGVYGQSKLAGEQAVQAAGGRHLIFRTAWVYAAHGHNFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
            + VV DQ GTPT A  IA      AH L +  + S  G++H+TA  G  +W  FAE IF
Sbjct: 181 VLRVVADQIGTPTPAALIADI---TAHALRQPGEPS--GLWHLTA-AGQTTWHGFAEAIF 234

Query: 231 WESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            ++  RG      +V  I T  YPT A RPAYS LD   L +T  +R+  W++G+  +L
Sbjct: 235 AQARARGLLARTPRVEAIGTADYPTPATRPAYSRLDTHSLQDTFGVRLPDWQDGLSQVL 293


>gi|170729451|ref|YP_001774884.1| dTDP-4-dehydrorhamnose reductase [Xylella fastidiosa M12]
 gi|167964244|gb|ACA11254.1| dTDP-4-dehydrorhamnose reductase [Xylella fastidiosa M12]
          Length = 302

 Score =  208 bits (530), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 127/303 (41%), Positives = 163/303 (53%), Gaps = 19/303 (6%)

Query: 1   MKCLVIGNNGQIAQ----SLSSMCVQDVEIIRVGR-PD------IDLLKPKDFASFFLSF 49
           M  LV G  GQI Q    SLS   V    + R GR P+       D  +P+       + 
Sbjct: 1   MTVLVFGAGGQIGQELLRSLSGRVV--CAVTRSGRLPNGRGCVQADFDRPETLRPLLDAQ 58

Query: 50  SPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSR 109
            P  ++N AAYTAVD+AE EP++ F INA+  G IA      G+P ++ STDYVFDG   
Sbjct: 59  RPVQVVNAAAYTAVDRAESEPDVVFRINAQAPGVIAHWCAEHGVPLVHYSTDYVFDGQGT 118

Query: 110 TPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKER 169
           +P     P  PLNIYG SKLAGE  V +     +ILRT+WVY+  G NFL +MLRL    
Sbjct: 119 SPYGVDDPVAPLNIYGASKLAGECAVRAAGGCSLILRTSWVYAAHGHNFLRTMLRLGATS 178

Query: 170 REISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYI 229
             + VV DQ GTPT+A  IA    Q+   L+E   +   GI+H+TA  G  SW  FAE I
Sbjct: 179 ECLRVVADQIGTPTAAGLIADVTAQL---LVEQVQSRHAGIWHLTA-AGQTSWHGFAEEI 234

Query: 230 FWESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           F ++   G      +V  I +  YPT A RP YSCLD + L     I +  W++GVR +L
Sbjct: 235 FAQAQACGLMMRVPQVQAIGSVVYPTAARRPGYSCLDTTALVEAFGIVLPDWRQGVRGVL 294

Query: 288 VNI 290
             I
Sbjct: 295 DEI 297


>gi|254468335|ref|ZP_05081741.1| dTDP-4-dehydrorhamnose reductase [beta proteobacterium KB13]
 gi|207087145|gb|EDZ64428.1| dTDP-4-dehydrorhamnose reductase [beta proteobacterium KB13]
          Length = 283

 Score =  208 bits (530), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 168/287 (58%), Gaps = 7/287 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G NGQ+  +L    + + E+I + R D DL           +  PD+IINPAAY
Sbjct: 1   MKILITGINGQVGHALMQE-LSEYELIGLTRQDCDLTNLDQIKQVIDNHQPDLIINPAAY 59

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD+AEDEPE+AF IN +    +A+ A    IP I+ STDYVFDG       E  PT+P
Sbjct: 60  TKVDQAEDEPELAFKINRDVPKVMAEKARECHIPFIHFSTDYVFDGEKEGSYVEDDPTHP 119

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG+SK AGEE +        I RT+WVYS  G+NF L+M +L++++ +  +V DQ G
Sbjct: 120 LGVYGESKCAGEEAIQEVGGLTYIFRTSWVYSNIGNNFFLTMQKLSQKQGDHKIVADQHG 179

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PTS+  IA+ +  I   L +NS     GI+H+ A+ G  SW +FA+ IF ++   G   
Sbjct: 180 IPTSSQFIAKHLKSIIPQLDKNS----IGIYHLVAN-GKCSWYEFAKQIFTQT-NPGFNL 233

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            K++ I + +Y TK  RPA S L   K+ NT N++++ W + +  ++
Sbjct: 234 EKIHPISSHEYDTKVKRPANSVLSNVKITNTFNLKLNNWDKELEEVI 280


>gi|71276344|ref|ZP_00652621.1| dTDP-4-dehydrorhamnose reductase [Xylella fastidiosa Dixon]
 gi|71162806|gb|EAO12531.1| dTDP-4-dehydrorhamnose reductase [Xylella fastidiosa Dixon]
          Length = 302

 Score =  208 bits (530), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 127/303 (41%), Positives = 163/303 (53%), Gaps = 19/303 (6%)

Query: 1   MKCLVIGNNGQIAQ----SLSSMCVQDVEIIRVGR-PD------IDLLKPKDFASFFLSF 49
           M  LV G  GQI Q    SLS   V    + R GR P+       D  +P+       + 
Sbjct: 1   MTVLVFGAGGQIGQELLRSLSGRVV--CAVTRSGRLPNGRGCVQADFGQPETLRPLLDAQ 58

Query: 50  SPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSR 109
            P  ++N AAYTAVD+AE EP++ F INA+  G IA      G+P ++ STDYVFDG   
Sbjct: 59  RPVQVVNAAAYTAVDRAESEPDVVFRINAQAPGVIAHWCAEHGVPLVHYSTDYVFDGQGT 118

Query: 110 TPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKER 169
           +P     P  PLNIYG SKLAGE  V +     +ILRT+WVY+  G NFL +MLRL    
Sbjct: 119 SPYGVDDPVAPLNIYGASKLAGECAVRAAGGCSLILRTSWVYAAHGHNFLRTMLRLGATS 178

Query: 170 REISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYI 229
             + VV DQ GTPT+A  IA    Q+   L+E   +   GI+H+TA  G  SW  FAE I
Sbjct: 179 ECLRVVADQIGTPTAAGLIADVTAQL---LVEQVQSRHAGIWHLTA-AGQTSWHGFAEEI 234

Query: 230 FWESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           F ++   G      +V  I +  YPT A RP YSCLD + L     I +  W++GVR +L
Sbjct: 235 FAQAQACGLMMRVPQVQAIGSVVYPTAARRPGYSCLDTTALVEAFGIVLPDWRQGVRGVL 294

Query: 288 VNI 290
             I
Sbjct: 295 DEI 297


>gi|298368476|ref|ZP_06979794.1| dTDP-4-dehydrorhamnose reductase [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298282479|gb|EFI23966.1| dTDP-4-dehydrorhamnose reductase [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 287

 Score =  208 bits (530), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 167/289 (57%), Gaps = 8/289 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+ GQ+AQ          E+I      +D+       +   +F PD I+N AAY
Sbjct: 1   MRILLTGSKGQLAQCFRDRLPDKWEVISTDSASLDITDATAVFNMVQNFQPDAIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE E   AF++NA     +A AA    +  I+ISTDYVF+G  + P  E    NP
Sbjct: 61  TAVDKAEREYRKAFAVNASAVHNLAAAAYEAKVRFIHISTDYVFEGDGKNPYSEHDVPNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            +IYGKSKL+GE    +     +++RTAW++S +G NF+ +MLRLAKER  +SVV DQ G
Sbjct: 121 QSIYGKSKLSGEFLALAANPESIVVRTAWLFSEYGENFVKTMLRLAKERDTLSVVNDQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE--RGG 238
            PT A  +A+A+I I       S    RG++H   D   VSW +FA+ IF  ++E  +G 
Sbjct: 181 NPTYAGDLAQALIDIL-----KSAGPARGVYHFCGDKS-VSWYEFAQAIFQTASENIKGF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              ++  I ++QYPT A RPAYS LDC K+     ++ S W++ + +I+
Sbjct: 235 KVPELKPIPSEQYPTPAPRPAYSVLDCGKINRDFGVKTSDWQKALGSII 283


>gi|261822265|ref|YP_003260371.1| dTDP-4-dehydrorhamnose reductase [Pectobacterium wasabiae WPP163]
 gi|261606278|gb|ACX88764.1| dTDP-4-dehydrorhamnose reductase [Pectobacterium wasabiae WPP163]
          Length = 281

 Score =  208 bits (529), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 121/289 (41%), Positives = 168/289 (58%), Gaps = 10/289 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G  GQ+ +          EI+     ++D+            F P+ I+N AAY
Sbjct: 1   MKILLTGAKGQLGRCFQDRLPIGWEILATDAAELDITDLACVEQVVQDFQPNAIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE+A  IN  G   +A AA+  G   I++STDYVFDG +  P +E S TNP
Sbjct: 61  TAVDKAESEPELAERINVIGPMNLAIAANKQGTRLIHVSTDYVFDGNATEPYNEDSATNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L++YGK+KLAGE+ VA    N +I+RTAWV+S +G+NF+ +MLRLAKER  +S+V DQ G
Sbjct: 121 LSVYGKTKLAGEQAVAQTVPNSIIVRTAWVFSEYGNNFVKTMLRLAKERDTLSIVNDQRG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  +A+AII +     E       GI+H   D   VSW +FAE IF  +A++    
Sbjct: 181 CPTYAGDLAQAIISLLEKNTEG------GIYHYCGD-REVSWYEFAESIFAIAADKSLLI 233

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               +  I T  YPT A+RPA+S L C K+     I +S W++ ++  +
Sbjct: 234 DIPSLKAISTTDYPTPAYRPAFSTLSCDKVKKL-GISLSGWEKALQKTI 281


>gi|163803298|ref|ZP_02197177.1| dTDP-4-dehydrorhamnose reductase [Vibrio sp. AND4]
 gi|159172935|gb|EDP57773.1| dTDP-4-dehydrorhamnose reductase [Vibrio sp. AND4]
          Length = 293

 Score =  208 bits (529), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 121/292 (41%), Positives = 171/292 (58%), Gaps = 10/292 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQD--VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ L+ G NGQ+   L+     D  +E++ + R  +D+       +    F P +IIN A
Sbjct: 1   MRVLITGCNGQVGSCLTKQLASDNNIEVLALDRQHLDITNRDAVHAVVTEFQPTIIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAE+E +++++IN +G   +A+ A S+G   ++ISTDYVF+G       E   T
Sbjct: 61  AHTAVDKAEEEVKLSYAINRDGPQYLAQTAQSMGAAILHISTDYVFEGNKNGEYAESDAT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           NP  +YG+SKLAGE  V    + ++ILRTAWV+   G+NF+ +MLRL + R  +S+V DQ
Sbjct: 121 NPQGVYGESKLAGEIAVTKACDKHIILRTAWVFGENGNNFVKTMLRLGENRDALSIVGDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA A+IQIA  + +   T   G++H +  G P VSW DFA+ IF + A   
Sbjct: 181 FGGPTYAGDIASALIQIAKRITQGK-TVEYGVYHYS--GLPHVSWFDFADTIF-DIAVGQ 236

Query: 238 GPYSKVYR---IFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
           G + K  R   I T QYPT A RP+ S L   KL    +I  S WK  + NI
Sbjct: 237 GIFEKKPRLTSIKTDQYPTPAKRPSNSRLSTHKLTQAFSIEASDWKAALSNI 288


>gi|127512334|ref|YP_001093531.1| dTDP-4-dehydrorhamnose reductase [Shewanella loihica PV-4]
 gi|126637629|gb|ABO23272.1| dTDP-4-dehydrorhamnose reductase [Shewanella loihica PV-4]
          Length = 288

 Score =  208 bits (529), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 119/289 (41%), Positives = 166/289 (57%), Gaps = 7/289 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G NGQ+   L        EI+ V   ++D+ + +        F PDVIIN AA+
Sbjct: 1   MKVLVTGCNGQVGHCLVEQLQGKAEILAVDAQELDITQQQAVNDVVNKFIPDVIINAAAH 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE E E ++ +N +G   +A+AA SIG   ++ISTDYVF+G      +E   TNP
Sbjct: 61  TAVDRAETEQEQSYKVNCDGPKYLAQAAQSIGASILHISTDYVFEGNKDGLYNEEDVTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
             +YG SKLAGE+ V      ++ILRTAWV+   G+NF+ +MLRL +ER  +S+V DQFG
Sbjct: 121 QGVYGASKLAGEQAVIQACEKHIILRTAWVFGQHGNNFVKTMLRLGQERDSLSIVGDQFG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG-- 237
            PT A  IA A+I IA     ++  +  G++H +  G P V+W  FA+ IF ++ E+   
Sbjct: 181 GPTYAADIAVALIHIAQQ--AHAGKNAWGVYHFS--GMPHVNWYQFADAIFTKAVEQNIL 236

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
                +  I T QYPT A RP  S LDC K+ +   I  S W + +  I
Sbjct: 237 EKAPTLTSISTLQYPTPAKRPTNSKLDCHKIKSIFGILPSDWVKALTEI 285


>gi|153826343|ref|ZP_01979010.1| dTDP-4-dehydrorhamnose reductase [Vibrio cholerae MZO-2]
 gi|149739912|gb|EDM54099.1| dTDP-4-dehydrorhamnose reductase [Vibrio cholerae MZO-2]
          Length = 296

 Score =  208 bits (529), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 176/294 (59%), Gaps = 12/294 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G+ GQ+     Q LS+M  ++VE + V R  +D+       +    F P++IIN
Sbjct: 2   MRVLVTGSRGQVGHCLVQQLSTM--KEVEFLAVDRDQLDITHSAQVDAVVNEFKPNIIIN 59

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA  +G   ++ISTDYVF G    P  E  
Sbjct: 60  AAAHTAVDRAEQEIELSYAINRDGPHYLAQAAQKVGAAILHISTDYVFSGDKPNPYLETD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT P  +YG+SKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV 
Sbjct: 120 PTAPQGVYGESKLAGEIAVAQACPRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVA 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQ G PT A  IA A++ +A  ++E   T+  G++H +  G P VSW +FA  IF ++ +
Sbjct: 180 DQCGGPTYAGDIANALLMMAKAIVEGKSTAF-GVYHFS--GLPHVSWHEFACTIFDKARD 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +G      +V  I T++YPT A RPA S LD  K+     +  S W+  + +++
Sbjct: 237 QGILNKSLQVNAITTQEYPTPAKRPANSRLDTQKIHQHFGVVASDWQTALNHLI 290


>gi|118588018|ref|ZP_01545428.1| dTDP-4-dehydrorhamnose reductase [Stappia aggregata IAM 12614]
 gi|118439640|gb|EAV46271.1| dTDP-4-dehydrorhamnose reductase [Stappia aggregata IAM 12614]
          Length = 296

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 169/291 (58%), Gaps = 3/291 (1%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + L+ G NGQ+   ++    +  +++  + R  +D+      A      +PD+IIN AAY
Sbjct: 3   RILLTGANGQLGYEVARKGREMGLDLAALDRSQLDITDRAAVADVVQQIAPDLIINTAAY 62

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE + + AF++N +G   +A+AA   G   I+ STDYVFDG       E     P
Sbjct: 63  TAVDRAETDSQAAFAVNRDGPRNLAEAAQKHGSVLIHFSTDYVFDGSQPHAYVEQDEVGP 122

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           + +YG+SK AGE  + + T  ++ILRT+WVY + G+NF+ +MLRLA+ER  I VV DQ G
Sbjct: 123 IGVYGESKEAGEAAIRAVTERHLILRTSWVYGVHGANFVRTMLRLAQERAHIRVVNDQSG 182

Query: 181 TPTSALQIARAIIQIAHNLIENS-DTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
            PT A  +A  ++++A  ++         G FH  A  G V+W  FA+ IF  + ER G 
Sbjct: 183 CPTYAADLAEVVLRLAERVLNGQLQQDGYGTFH-CAGQGQVTWHGFADKIFQLAGERFGK 241

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             ++  I   ++P++A RPA S LDCSKLA  H + +  W+E + ++L ++
Sbjct: 242 KPELIAIPGSEFPSRARRPANSALDCSKLARVHGLALRQWQEALSDMLDHL 292


>gi|153214737|ref|ZP_01949582.1| dTDP-4-dehydrorhamnose reductase [Vibrio cholerae 1587]
 gi|124115173|gb|EAY33993.1| dTDP-4-dehydrorhamnose reductase [Vibrio cholerae 1587]
          Length = 296

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 120/296 (40%), Positives = 179/296 (60%), Gaps = 13/296 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G+ GQ+     Q LS+M  ++VE + V R  +D+  P    +    F P++IIN
Sbjct: 2   MRVLVTGSRGQVGHCLVQQLSTM--KEVEFLAVDRDQLDITYPAQVDAVVNEFKPNIIIN 59

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA  +G   ++ISTDYVF G    P  E  
Sbjct: 60  AAAHTAVDRAEQEIELSYAINRDGPHYLAQAAQKVGAAILHISTDYVFSGDKPNPYLETD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT P  +YG+SKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV 
Sbjct: 120 PTAPQGVYGESKLAGEIAVAQACPRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVA 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQ G PT A  IA A++ +A  +++ + T+  G++H +  G P VSW +FA  IF ++ +
Sbjct: 180 DQCGGPTYAGDIANALLMMAKAIVDGNSTAF-GVYHFS--GLPHVSWHEFACTIFDKARD 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           +G      +V  I T++YPT A RPA S LD  K+     +  S W+  + N L++
Sbjct: 237 QGILNKSLQVNAITTQEYPTPAKRPANSRLDTQKIHQHFGVVASDWQAAL-NYLID 291


>gi|146293634|ref|YP_001184058.1| dTDP-4-dehydrorhamnose reductase [Shewanella putrefaciens CN-32]
 gi|145565324|gb|ABP76259.1| dTDP-4-dehydrorhamnose reductase [Shewanella putrefaciens CN-32]
          Length = 291

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 121/291 (41%), Positives = 169/291 (58%), Gaps = 9/291 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK LV G++GQ+   L     Q  DVE + V R  +D+      +     F PD IIN A
Sbjct: 1   MKILVTGSHGQVGSCLVKQLSQMPDVEFLAVDREQLDITNSAAVSKLVNQFKPDAIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAE E E++++IN +G   +A++A+ +G   ++ISTDYVF G       E    
Sbjct: 61  AHTAVDKAEQEVELSYAINRDGPQFLAQSANRVGATILHISTDYVFAGDKDGEYVETDAV 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P  +YG SKLAGE  VA+    ++ILRTAWV+   G+NF+ +MLRLA+ R E+ VV DQ
Sbjct: 121 APQGVYGHSKLAGELAVAAACPRHIILRTAWVFCETGNNFVKTMLRLAQNRDELGVVADQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA A+I +A  + E + +   GI+H    G P V+W  FA  IF ++ E+G
Sbjct: 181 FGGPTYAGDIANALIVMAKAVSEGNQSF--GIYHYA--GLPHVNWHQFAMEIFAKAKEQG 236

Query: 238 GPYSKVY--RIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
               +V    I + QYPT A RPA S LDC K+     ++ S W+  + N+
Sbjct: 237 VLNKEVLVNSITSDQYPTPAKRPANSKLDCRKIEQIFGVKPSDWQTALNNL 287


>gi|146283606|ref|YP_001173759.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas stutzeri A1501]
 gi|145571811|gb|ABP80917.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas stutzeri A1501]
          Length = 306

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 167/291 (57%), Gaps = 8/291 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+ LV G  GQ+ + L     +  ++++   R  +D+ KP+  A   +   P++IIN AA
Sbjct: 1   MRILVCGAGGQVGRELVERASRFGLDVLAPARAQLDIAKPEQVADA-MRQRPELIINAAA 59

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VD AE   E A+++N +G   +A+AA   G+P  +ISTDYVF G +  P  E   T 
Sbjct: 60  YTHVDNAESHGEQAYAVNRDGPRHLAEAAKHAGVPLFHISTDYVFSGEATRPYTESDETG 119

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P  +YG SKLAGEE + S    ++ILRT+WVY + G NF+ +MLRLA++R  + VV DQ 
Sbjct: 120 PTGVYGASKLAGEEAIRSCLPAHLILRTSWVYGVHGHNFVKTMLRLARQRDALGVVSDQV 179

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPV-SWADFAEYIFWESAERG- 237
           G PT A  IA  ++++A    + ++ +  G++H +  G P  SW DFA  IF +    G 
Sbjct: 180 GCPTQAGSIASVLLELARRYADGAELAW-GVYHYS--GAPACSWYDFAVEIFRQGEAAGL 236

Query: 238 -GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
                +V  I T QYPT A RPA+S LDCS+      +    W+E + ++L
Sbjct: 237 IARQPEVSPIMTAQYPTPARRPAWSVLDCSRFEAAFGLAPHRWQEDLADVL 287


>gi|327482001|gb|AEA85311.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas stutzeri DSM 4166]
          Length = 306

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 167/291 (57%), Gaps = 8/291 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+ LV G  GQ+ + L     +  ++++   R  +D+ KP+  A   +   P++IIN AA
Sbjct: 1   MRILVCGAGGQVGRELVERASRFGLDVLAPARAQLDIAKPEQVADA-MRQRPELIINAAA 59

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VD AE   E A+++N +G   +A+AA   G+P  +ISTDYVF G +  P  E   T 
Sbjct: 60  YTHVDNAESHGEQAYAVNRDGPRHLAEAAKHAGVPLFHISTDYVFSGEATRPYTESDETG 119

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P  +YG SKLAGEE + S    ++ILRT+WVY + G NF+ +MLRLA++R  + VV DQ 
Sbjct: 120 PTGVYGASKLAGEEAIRSCLPAHLILRTSWVYGVHGHNFVKTMLRLARQRDALGVVSDQV 179

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPV-SWADFAEYIFWESAERG- 237
           G PT A  IA  ++++A    + ++ +  G++H +  G P  SW DFA  IF +    G 
Sbjct: 180 GCPTQAGSIASVLLELARRYADGAELAW-GVYHYS--GAPACSWYDFAVEIFRQGEAAGL 236

Query: 238 -GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
                +V  I T QYPT A RPA+S LDCS+      +    W+E + ++L
Sbjct: 237 IARQPEVSPIMTAQYPTPARRPAWSVLDCSRFEAAFGLAPHRWQEDLADVL 287


>gi|86147259|ref|ZP_01065574.1| probable dTDP-4-rhamnose reductase [Vibrio sp. MED222]
 gi|85834974|gb|EAQ53117.1| probable dTDP-4-rhamnose reductase [Vibrio sp. MED222]
          Length = 293

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 118/284 (41%), Positives = 170/284 (59%), Gaps = 8/284 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCV--QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ L+ G +GQ+   L+      +++ ++ + R  +D+   +   +    F P +IIN A
Sbjct: 1   MRVLITGCHGQVGSCLTKQLANNENIAVLALDREHLDITSQEAVNAIVAEFEPSIIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAE+E +++++IN +G   +A+AA S+G   ++ISTDYVFDG       E   T
Sbjct: 61  AHTAVDKAEEELDLSYAINRDGPKYLAQAAQSVGAAMLHISTDYVFDGDKVGEYAETDAT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           NP  +YGKSKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA     +S+V DQ
Sbjct: 121 NPQGVYGKSKLAGEIAVAQECKKHIILRTAWVFGENGNNFVKTMLRLANSYESLSIVGDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA A++ IA   I N +T   GI+H +  G P VSW+ FA+ IF E+ E+G
Sbjct: 181 FGGPTYAGDIASALVTIA-KAICNGETDRFGIYHFS--GLPHVSWSQFAQAIFDEAVEQG 237

Query: 238 --GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTW 279
                  V  I T++YPT A RP  S L+ + + NT  I  S W
Sbjct: 238 VLKCSPAVNSITTEEYPTLAKRPENSKLNTTLIRNTFGINASDW 281


>gi|148549140|ref|YP_001269242.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas putida F1]
 gi|148513198|gb|ABQ80058.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas putida F1]
          Length = 301

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 116/301 (38%), Positives = 169/301 (56%), Gaps = 14/301 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI---------DLLKPKDFASFFLSFSP 51
           MK L++G +GQ+   L    V   EI+ +GR  +         DL           + +P
Sbjct: 1   MKVLLLGKDGQVGWELQRALVVMGEIVALGRNPVSTSYGTLSGDLSDLDGLRQTIRAVAP 60

Query: 52  DVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTP 111
           D+I+N AAYTAVDKAE E E+A  +NA  +G IA+ A  +    ++ STDYVFDG   +P
Sbjct: 61  DLIVNAAAYTAVDKAETEQELARKVNALASGVIAEEAKRLDALFVHYSTDYVFDGAGTSP 120

Query: 112 IDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERRE 171
             E    +P+N YG +KL GE+ + +   NY+I RT+WVY+  G+NF  +MLRLAKER+ 
Sbjct: 121 WKESDSVSPVNYYGATKLEGEQLIVASGCNYLIFRTSWVYAAKGNNFAKTMLRLAKERQT 180

Query: 172 ISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFW 231
           ++V+ DQ G PTSA  +A   +      + N   SL GI+H+ A  G  SW  +A Y+  
Sbjct: 181 LNVIADQIGVPTSAELLADVAVHAVQKTLNNP--SLCGIYHL-APAGETSWHAYATYVIA 237

Query: 232 ESAERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
            +   G P +   +  I T +YPT A+RP  S LD +KL +   +++  WK GV  +L+ 
Sbjct: 238 SARAHGEPLAVETINPIATTEYPTPANRPLNSRLDTTKLRDAFALQLPDWKVGVTRMLME 297

Query: 290 I 290
           I
Sbjct: 298 I 298


>gi|325276926|ref|ZP_08142613.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas sp. TJI-51]
 gi|324097941|gb|EGB96100.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas sp. TJI-51]
          Length = 300

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 116/301 (38%), Positives = 165/301 (54%), Gaps = 13/301 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI-----DLLKPKDFASFFLSFSPDVII 55
           MK L++G NGQ+   L        E+I + R        DL +    A+     +PD+I+
Sbjct: 1   MKILLLGKNGQVGWELQRALAPLGEVIALDRQGAEGLCGDLSQADGLAATVRQLAPDIIV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVDKAE +  +A  INA+    +A+ A ++G   ++ STDYVFDG    P +E 
Sbjct: 61  NAAAYTAVDKAESDQALAAMINAQAPAVLAREAAALGAWLVHYSTDYVFDGSGDQPWEET 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
           + T PL++YG++KL GE  + +     ++LRT+WVY+  G NF  +MLRLA ER  +SVV
Sbjct: 121 AATGPLSVYGRTKLDGERGILASGAKALVLRTSWVYAARGHNFAKTMLRLAAEREGLSVV 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDT-SLRGIFHMTADGGPVSWADFAEYIFWESA 234
            DQFG PT A  IA     I   +    D   L G++H+ A  G  SW  FA+++    A
Sbjct: 181 ADQFGAPTGAELIADVTAHILRQIFNGQDNRHLAGVYHLAA-AGETSWHGFAQFVL-AHA 238

Query: 235 ERGG-----PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           +R G        KV  I T+ YP  A RP  S L  +KL  T N ++  W++GV+ +L  
Sbjct: 239 QRNGVALKVTADKVAPISTEAYPVPAPRPRNSRLALAKLEKTFNFKMPLWEQGVQRMLDE 298

Query: 290 I 290
           I
Sbjct: 299 I 299


>gi|325928552|ref|ZP_08189740.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas perforans 91-118]
 gi|325541091|gb|EGD12645.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas perforans 91-118]
          Length = 299

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 121/299 (40%), Positives = 161/299 (53%), Gaps = 18/299 (6%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEII---RVGR-PD------IDLLKPKDFASFFLSFS 50
           M  LV+G NGQ+   L      +  I+   R GR PD       D   P+  +       
Sbjct: 1   MTTLVLGANGQVGTELLRALAANGPILSSTRSGRLPDGAACEVADFDAPQRLSELLDRLQ 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           P  ++N AAYTAVD+AE E + AF  NAE    IA+      +P ++ STDYVFDG    
Sbjct: 61  PSCVVNAAAYTAVDRAEQERDAAFRANAEAPSVIAQWCARASVPLVHYSTDYVFDGQGTR 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P      T PL +YG+SKLAGE+ V +    ++I RTAWVY+  G NFL +MLR+  ER 
Sbjct: 121 PYRPDDATAPLGVYGQSKLAGEQAVQAAGGRHLIFRTAWVYAAHGHNFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
            + VV DQ GTPT A  IA      AH L +  + S  G++H+TA  G  +W  FAE IF
Sbjct: 181 VLRVVADQIGTPTPAALIADI---TAHALRQPGEPS--GLWHLTA-AGQTTWHGFAEAIF 234

Query: 231 WESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            ++  RG      +V  I T  YPT A RPAYS LD   L +T  +R+  W++G+  +L
Sbjct: 235 AQARARGLLAHAPRVEAISTADYPTPATRPAYSRLDIHSLQDTFGVRLPDWQDGLSQVL 293


>gi|146343779|ref|YP_001208827.1| dTDP-4-dehydrorhamnose reductase [Bradyrhizobium sp. ORS278]
 gi|146196585|emb|CAL80612.1| dTDP-4-dehydrorhamnose reductase [Bradyrhizobium sp. ORS278]
          Length = 302

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 114/290 (39%), Positives = 165/290 (56%), Gaps = 8/290 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDV--EIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ L+ G +GQ+  +L  +       E+I   R   DL +P   A      +PD+I+NPA
Sbjct: 1   MRILITGTSGQVGGALRRLLPAGGTDELICPPRAAFDLTQPASLAGALDRLAPDLILNPA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD+AEDE E+A ++N +  G IA+ A    +P +++STDYVFDG    P  E    
Sbjct: 61  AYTAVDRAEDEAELAMTVNGQAPGVIAQWAAPRRVPLLHVSTDYVFDGAGEHPWRESDAV 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            PL+ YG+SKLAGE+ V S    ++I+RTAWV++  G+NF+ +++RLA+ER  + VV DQ
Sbjct: 121 GPLSAYGRSKLAGEDAVRSAGGPHLIVRTAWVFASAGANFMRTIVRLAREREALRVVADQ 180

Query: 179 FGTPTSALQIAR---AIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
            GTPTSA  IA    AI+      +  +     G+ H+T + G  SW  FA  I     +
Sbjct: 181 KGTPTSARTIAEVIAAILAQGAGDLPGAFARAEGLVHLT-NSGATSWHGFASAIVDGLRQ 239

Query: 236 RGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
           R  P     V  I T  +PTKA RPA S LD S+L   + +   +W++ +
Sbjct: 240 RNVPVKARAVEAITTADFPTKARRPANSQLDLSRLRGAYGLVPPSWQQAL 289


>gi|78186306|ref|YP_374349.1| dTDP-4-dehydrorhamnose reductase [Chlorobium luteolum DSM 273]
 gi|78166208|gb|ABB23306.1| dTDP-4-dehydrorhamnose reductase [Chlorobium luteolum DSM 273]
          Length = 288

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 113/292 (38%), Positives = 166/292 (56%), Gaps = 9/292 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSM--CVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M  LV G  GQ+   L ++         + + RPD+D+         F  F PDV++N A
Sbjct: 1   MNILVAGGRGQLGSELQALRKGAGAHRFLFLDRPDLDITDSGSVRGAFDRFQPDVVVNAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD+AE++ E AF +N +GAG +A  +   G   I++STDYVFDG +  P  E    
Sbjct: 61  AYTAVDRAEEDREAAFLVNRDGAGVLAGCSRDAGAFFIHVSTDYVFDGTASRPYREEDMP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P  +YG+SK  GE  VAS   ++ I+RT+W+YS +G NF+ +MLRL +ER  + VV DQ
Sbjct: 121 CPEGVYGRSKFEGERLVASVDPSHAIIRTSWLYSAYGQNFVKTMLRLGRERESLGVVFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +A A++ IA  L  +     RG++H + + G  SW DFA  +     E  G
Sbjct: 181 TGTPTHAADLASAVLHIA--LRHDPAFHYRGVWHYSNE-GVASWYDFAHAVM----EFAG 233

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              +V  I ++++P  A RPAYS LD S +    ++RI  W++ ++ +L  I
Sbjct: 234 LPCRVEPITSREFPQVAVRPAYSVLDKSAVKRDWDLRIPYWQDSLKTLLTTI 285


>gi|16329215|ref|NP_439943.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Synechocystis sp. PCC 6803]
 gi|1651695|dbj|BAA16623.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Synechocystis sp. PCC 6803]
          Length = 280

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 114/260 (43%), Positives = 153/260 (58%), Gaps = 11/260 (4%)

Query: 31  RPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADS 90
           R   DL +P        +F+PD+I+N AAYTAVD+AE EPE+A+++NA    AIAK A  
Sbjct: 20  RASFDLAQPDVLGEKIRAFAPDIIVNSAAYTAVDRAETEPELAYAVNALAPQAIAKVAKE 79

Query: 91  IGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWV 150
           IG   ++ISTDYVFDG   +P  E   TNPL +YG+SK  GE  +A    N++I+RTAWV
Sbjct: 80  IGAYVVHISTDYVFDGSQSSPYRETDATNPLGVYGQSKFQGEIAIADSGCNFLIVRTAWV 139

Query: 151 YSIFGS-NFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRG 209
           Y + GS NF+ +M+RL KER+++ VV DQ G PT A  +A AI  +       ++   +G
Sbjct: 140 YGVHGSGNFVKTMVRLGKERQKVRVVADQIGGPTWAKDLAEAIAAL-------TEQRAQG 192

Query: 210 IFHMTADGGPVSWADFAEYIFWESAERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSK 267
           I+H + + G  SW DFA  IF E    G P    +V  I T  YPT A RPAYS L   K
Sbjct: 193 IYHYS-NSGVASWYDFAVAIFEEVENLGIPLKVRQVVPIATAAYPTPARRPAYSVLSHQK 251

Query: 268 LANTHNIRISTWKEGVRNIL 287
           +  T       W+  +R +L
Sbjct: 252 IVETLGSAPPHWRASLRAML 271


>gi|254523254|ref|ZP_05135309.1| dTDP-4-dehydrorhamnose reductase [Stenotrophomonas sp. SKA14]
 gi|219720845|gb|EED39370.1| dTDP-4-dehydrorhamnose reductase [Stenotrophomonas sp. SKA14]
          Length = 297

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 120/303 (39%), Positives = 161/303 (53%), Gaps = 20/303 (6%)

Query: 1   MKCLVIGNNGQIAQ----SLSSMCVQDVEIIRVGR-PD------IDLLKPKDFASFFLSF 49
           M  LV G NGQ+ Q    SL+ + V  V   R G+ PD       D  +P    +     
Sbjct: 1   MTVLVFGGNGQVGQELLRSLAPLGVV-VATTRSGQLPDGSPCEVADFAQPDSLTALLDRL 59

Query: 50  SPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSR 109
            P V++N AAYTAVD+AE E E AF+ N +  G IA+   +  +P ++ STDYVFDG   
Sbjct: 60  QPTVVVNAAAYTAVDRAEQEVEAAFAANVQAPGVIARWCAAHDVPLVHYSTDYVFDGQGS 119

Query: 110 TPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKER 169
            P  E  PT PL +YG SK  GE+ V      ++I RTAWVY+  G+NFL +MLR+  ER
Sbjct: 120 APYREDEPTAPLGVYGTSKRDGEDAVREAGGRHLIFRTAWVYASHGANFLRTMLRVGAER 179

Query: 170 REISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYI 229
             + VV DQ GTPT A  IA   ++   +        L G +H+TA  G  SW  FAE I
Sbjct: 180 DALRVVADQIGTPTPAALIADVTVKALQH-----PGQLSGTWHLTAS-GQTSWHGFAEAI 233

Query: 230 FWESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           F E+   G       V  I + +YPT A RPA+S LD  KL     I +  W++G++ ++
Sbjct: 234 FAEALASGVLAKVPTVEAIASSEYPTPAKRPAWSVLDNRKLQRDFGIVLPVWQDGLKRVM 293

Query: 288 VNI 290
             I
Sbjct: 294 AEI 296


>gi|91782042|ref|YP_557248.1| dTDP-4-dehydrorhamnose reductase [Burkholderia xenovorans LB400]
 gi|91685996|gb|ABE29196.1| dTDP-4-dehydrorhamnose reductase [Burkholderia xenovorans LB400]
          Length = 305

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 116/293 (39%), Positives = 159/293 (54%), Gaps = 7/293 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G+ GQ+   L         ++ + R   DL  P    S      PDVI+NPAAYTAV
Sbjct: 12  LVTGSRGQVGFELRRSLASLGNVVALDRSVCDLRSPDSIRSVVREVQPDVIVNPAAYTAV 71

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D AE++ E+A++IN   AG +A+ A S+G   ++ STDYVFDG    P  E    NP ++
Sbjct: 72  DAAENDAELAYAINGVAAGVLAEEAKSLGGLLVHYSTDYVFDGRKDGPYVETDVVNPQSV 131

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YGKSKLAGE+ +A      ++LRT WV    GSNF  +MLRL +ER  + V+ DQ+G PT
Sbjct: 132 YGKSKLAGEQAIAERGATAIVLRTCWVAGAHGSNFAKTMLRLGRERDSLRVIADQYGAPT 191

Query: 184 SALQIARAIIQIA--HNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP-- 239
           +A  IA    QI   H L  +      G++H+ A  G  SW  +A  +   +A RG    
Sbjct: 192 TAALIADVTAQIVARHWLHGDRAAFASGVYHLAA-AGQTSWHGYATEVLQFAAARGVELK 250

Query: 240 --YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              +++  I T  YP  A RPA S LD  KL  T  I +  W++GV ++L  I
Sbjct: 251 VDLARIEPIATADYPLPAPRPANSRLDTHKLRQTFGINLPDWRDGVHHLLEQI 303


>gi|326799491|ref|YP_004317310.1| dTDP-4-dehydrorhamnose reductase [Sphingobacterium sp. 21]
 gi|326550255|gb|ADZ78640.1| dTDP-4-dehydrorhamnose reductase [Sphingobacterium sp. 21]
          Length = 287

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 167/286 (58%), Gaps = 9/286 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K +V+G  GQ+ Q L S+C +D  ++ +   + D+        +F+ ++P  IIN AAYT
Sbjct: 3   KIIVLGGQGQLGQCLQSVC-EDKAMVFLSSKEADISNEAQLEQWFIQYNPSHIINCAAYT 61

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAEDE E A  IN    G +A+         I+ISTD+VF+G     ++E S  NP 
Sbjct: 62  AVDKAEDEKEEASKINTIAPGILARLCKRFDAILIHISTDFVFEGNQTGLLEETSIANPT 121

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
            +YG++KL GE  +    N ++I+RT+W+YS + +NF+ +MLRLA++R E+ VV DQ GT
Sbjct: 122 GVYGQTKLDGETTIQQIWNKHIIIRTSWLYSEYANNFVKTMLRLAQDREELKVVADQVGT 181

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A  +A  + +I  N I   +    G++H + + G  SW DFA  +F    E      
Sbjct: 182 PTYARDLAEVLCKIIDNNITEDE---YGLYHYSNE-GVASWYDFAYAVF----ELSNTNI 233

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +++ I T  +PTKA RPAYS +D SK+    N+ I  W++ ++N L
Sbjct: 234 RLFPIKTADFPTKAKRPAYSVMDKSKIKKQFNLVIPNWRDSLKNCL 279


>gi|325954730|ref|YP_004238390.1| dTDP-4-dehydrorhamnose reductase [Weeksella virosa DSM 16922]
 gi|323437348|gb|ADX67812.1| dTDP-4-dehydrorhamnose reductase [Weeksella virosa DSM 16922]
          Length = 284

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 112/285 (39%), Positives = 173/285 (60%), Gaps = 12/285 (4%)

Query: 2   KCLVIGNNGQIAQSLSSM--CVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           K LV G NGQ+AQ++ S+    + ++ I     ++D+    +    F     + +IN AA
Sbjct: 3   KILVTGANGQLAQAIESIEKSTKKIQFIFKTANELDITNRTNLLHHFDKNIYNGVINTAA 62

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVD AE E + A+++NA G   +A+      IP +++STDYVF G    P  E  P +
Sbjct: 63  YTAVDLAESEEKKAYAVNALGVENLARVTKRQNIPLLHLSTDYVFSGNDNHPQKEDDPCD 122

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P NIYGK+KLAGE+         +I+RTAW+YS FG+NF+ +MLRL ++++EI+V+ DQ 
Sbjct: 123 PQNIYGKTKLAGEQLALQTNPKTIIIRTAWLYSRFGNNFVKTMLRLFEQKKEINVINDQI 182

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT+A+ +A+A++QI    IE SD    G+FH + + G  SW DFA+ I     +    
Sbjct: 183 GSPTNAIDLAKALVQI----IE-SDVPQYGVFHYSNE-GECSWYDFAQAI----KKYTNS 232

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
             +++ I TK YPT A RPA+S LD +K+   + ++I  W++ +R
Sbjct: 233 SIEIHPIATKDYPTAAKRPAFSLLDKTKIKQVYGLKIPKWEDSLR 277


>gi|121533498|ref|ZP_01665326.1| dTDP-4-dehydrorhamnose reductase [Thermosinus carboxydivorans Nor1]
 gi|121308057|gb|EAX48971.1| dTDP-4-dehydrorhamnose reductase [Thermosinus carboxydivorans Nor1]
          Length = 280

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 118/288 (40%), Positives = 167/288 (57%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K LV G NGQ+ ++L     +  E++    P++D+   K       ++ PD++IN AAYT
Sbjct: 3   KILVTGANGQLGRALQRQFCEKYELVLCDLPELDITNFKACRDAVRTYGPDIVINAAAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
            V++AEDEP+ A+++NA GA  +A       +  I+ISTDYVFDG   TP  E+   NPL
Sbjct: 63  NVERAEDEPDAAYAVNAIGAHNLALVCREANVKLIHISTDYVFDGARGTPYSEYDAPNPL 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YGKSKL GE+ +      Y I+RTAW+Y   G NF+ +MLRLA ER EI+VV DQ+GT
Sbjct: 123 SVYGKSKLLGEQLIRDTGGWYFIVRTAWLYGD-GHNFVRTMLRLAGERPEIAVVADQYGT 181

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT  + +A  + QI H       T   GI+H T + G  +W +FA  IF E A++     
Sbjct: 182 PTYTVDLAALLEQIMH-------TEYYGIYHAT-NAGNCTWYEFACKIF-EYADKK---V 229

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
            V  I T +YPTKA RP YS LD   L       +  W+E +++ + N
Sbjct: 230 AVRPITTDEYPTKAKRPRYSVLDNHMLRLRGFDIMRPWEEALKDYIAN 277


>gi|239813762|ref|YP_002942672.1| dTDP-4-dehydrorhamnose reductase [Variovorax paradoxus S110]
 gi|239800339|gb|ACS17406.1| dTDP-4-dehydrorhamnose reductase [Variovorax paradoxus S110]
          Length = 296

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 114/296 (38%), Positives = 165/296 (55%), Gaps = 13/296 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRP----DIDLLKPKDFASFFLSFSPDVIIN 56
           MK L++G  GQ+   L        E++ +       + D  +P+  A   L   PDVI+N
Sbjct: 1   MKLLLLGKGGQVGWELQRSLAPLGELVALDFDSTDFNADFSRPEQLAETVLKVRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA   G +A+AA  IG   ++ STDYVFDG   TP  E  
Sbjct: 61  AAAHTAVDKAESEPEFARKLNATSPGVVAEAAQQIGALMVHYSTDYVFDGSGSTPWKEDD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PL++YG++KL GE+ VA +   ++I RT+WVY+  G NF  +MLR+AKER  ++V+ 
Sbjct: 121 ATGPLSVYGRTKLEGEQLVARHCAKHLIFRTSWVYAARGGNFAKTMLRIAKERDRLTVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          ++  D +  G++H  A GG  +W  +A ++  ++   
Sbjct: 181 DQFGAPTGAELLADVTAHAIRATLQ--DPAKAGLYHAVA-GGETTWHSYARFVIEQAKAA 237

Query: 237 G-----GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G     GP + V  + T  +PT A RPA S LD  KL  T  + +  W++GV  +L
Sbjct: 238 GVELKAGPEA-VDPVPTSAFPTPATRPANSRLDTRKLQATFGLVLPHWQQGVARML 292


>gi|261210464|ref|ZP_05924758.1| dTDP-4-dehydrorhamnose reductase [Vibrio sp. RC341]
 gi|260840522|gb|EEX67088.1| dTDP-4-dehydrorhamnose reductase [Vibrio sp. RC341]
          Length = 296

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 173/292 (59%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSM--CVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ LV G+ GQ+   L      +++VE + V R  +D+       +    F P++IIN A
Sbjct: 2   MRVLVTGSRGQVGHCLVQQLRTMKEVEFLAVDRDQLDITHSAQVDAVVNEFKPNIIINAA 61

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVD+AE E E++++IN +G   +A+AA  IG   ++ISTDYVF G    P  E  PT
Sbjct: 62  AHTAVDRAEQEIELSYAINRDGPHYLAQAAQKIGAAILHISTDYVFSGDKPNPYLETDPT 121

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P  +YG+SKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV DQ
Sbjct: 122 APQGVYGESKLAGEIAVAQACTRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVADQ 181

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
            G PT +  IA A++ +A  ++E   T+  G++H +  G P VSW +FA  IF ++ ++G
Sbjct: 182 HGGPTYSGDIANALLTMAKAIVEWKSTAF-GVYHFS--GLPHVSWHEFACTIFDKARDQG 238

Query: 238 --GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
                 +V  I T++YPT A RPA S LD  K+     +  S W+  + +++
Sbjct: 239 ILNKSLQVNAITTQEYPTPAKRPANSRLDTQKIHQHFGVVASDWQAALNHLI 290


>gi|229512767|ref|ZP_04402235.1| dTDP-4-dehydrorhamnose reductase [Vibrio cholerae TMA 21]
 gi|229350277|gb|EEO15229.1| dTDP-4-dehydrorhamnose reductase [Vibrio cholerae TMA 21]
          Length = 296

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 176/294 (59%), Gaps = 12/294 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G+ GQ+     Q LS+M  ++VE + V R  +D+       +    F P++IIN
Sbjct: 2   MRVLVTGSRGQVGHCLVQQLSTM--KEVEFLAVDRDQLDITHSAQVDAVVNEFKPNIIIN 59

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA  +G   ++ISTDYVF G    P  E  
Sbjct: 60  AAAHTAVDRAEQEIELSYAINRDGPHYLAQAAQKVGAAILHISTDYVFSGDKPNPYLETD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT P  +YG+SKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV 
Sbjct: 120 PTAPQGVYGESKLAGEIAVAQACPRHIILRTAWVFGEHGNNFVKTMLRLAQTRDALGVVA 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQ G PT A  IA A++ +A  +++   T+  G++H +  G P VSW +FA  IF ++ +
Sbjct: 180 DQCGGPTYAGDIANALLMMAKAIVDGKSTAF-GVYHFS--GLPHVSWHEFACTIFDKARD 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +G      +V  I T++YPT A RPA S LD  K+     +  S W+  + +++
Sbjct: 237 QGILNKSLQVNAITTQEYPTPAKRPANSRLDTQKIHQHFGVVASDWQATLNHLI 290


>gi|77164294|ref|YP_342819.1| dTDP-4-dehydrorhamnose reductase [Nitrosococcus oceani ATCC 19707]
 gi|254434601|ref|ZP_05048109.1| dTDP-4-dehydrorhamnose reductase [Nitrosococcus oceani AFC27]
 gi|76882608|gb|ABA57289.1| dTDP-4-dehydrorhamnose reductase [Nitrosococcus oceani ATCC 19707]
 gi|207090934|gb|EDZ68205.1| dTDP-4-dehydrorhamnose reductase [Nitrosococcus oceani AFC27]
          Length = 295

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 112/284 (39%), Positives = 156/284 (54%), Gaps = 8/284 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L+IG  GQ+   L        E+   GR  +DL +            P +I+N AAYT
Sbjct: 7   RILLIGATGQVGWELQRTLAPLGEVFAPGRERLDLAQLDSIRPCLAETQPALIVNAAAYT 66

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE+EPE A +IN +  G +A+ A   G   I+ STDYVFDG    P  E     PL
Sbjct: 67  AVDKAEEEPEQALAINGKAPGVLAETARQQGAAFIHYSTDYVFDGKKAAPYRESDTPRPL 126

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           N+YG++KL GE+ + +    Y+ILRT+WVY + G NFLL+M RLA+ER  + VV DQ+G 
Sbjct: 127 NVYGQTKLTGEQAIVAVGGAYLILRTSWVYGLRGHNFLLTMQRLAREREVLRVVDDQWGA 186

Query: 182 PTSALQIARAIIQI-----AHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           PT +  IA    QI      H   +N      GI+H++  G   +W  FA+ I    A+ 
Sbjct: 187 PTWSRLIAEGTAQIIAQSWGHR--QNYIPLQTGIYHLSC-GEKTTWHGFAQTILTRLAQG 243

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
            G  +K+  I    YPT A RPA+SCLD +   +T  I++ +W+
Sbjct: 244 AGSVAKLKAISAADYPTAARRPAFSCLDNTLARDTFGIQLPSWR 287


>gi|148976930|ref|ZP_01813585.1| dTDP-4-dehydrorhamnose reductase [Vibrionales bacterium SWAT-3]
 gi|145963804|gb|EDK29064.1| dTDP-4-dehydrorhamnose reductase [Vibrionales bacterium SWAT-3]
          Length = 294

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 119/291 (40%), Positives = 172/291 (59%), Gaps = 8/291 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQD--VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ L+ G +GQ+   L+    QD    I+ + R  +D+       +    F P +IIN A
Sbjct: 1   MRVLITGCHGQVGTCLTEQLNQDENTTILALDREHLDITNQDSVNAVVSEFQPTIIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAE+E E++++IN +G   +A+AA +IG   ++ISTDYVF+G       E   T
Sbjct: 61  AHTAVDKAEEEVELSYAINRDGPKYLAQAAQTIGAAILHISTDYVFEGNKVGDYIETDTT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           NP  +YG+SKLAGE  V    + ++ILRTAWV+   G+NF+ +MLRL + R  +S+V DQ
Sbjct: 121 NPQGVYGESKLAGEIAVVQSCDKHIILRTAWVFGESGNNFVKTMLRLGQTRDALSIVGDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA  +IQIA  + + S+    G++H +  G P VSW DFA+ IF  + ++ 
Sbjct: 181 FGGPTYAGDIANTLIQIAKRITQGSEIEY-GVYHYS--GLPHVSWFDFADTIFDVAVQQK 237

Query: 238 GPYSK--VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
              SK  +  I T+QYPT A RP+ S L   K+    +I  S WK  + NI
Sbjct: 238 LLDSKPTLTSITTEQYPTPAKRPSNSRLSNEKVMANFSIEASDWKVALNNI 288


>gi|158333988|ref|YP_001515160.1| dTDP-4-dehydrorhamnose reductase [Acaryochloris marina MBIC11017]
 gi|158304229|gb|ABW25846.1| dTDP-4-dehydrorhamnose reductase [Acaryochloris marina MBIC11017]
          Length = 304

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 114/295 (38%), Positives = 163/295 (55%), Gaps = 7/295 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G  GQ+ Q L        E+I VG+  +DL  P+      L   PD+I+N AAYT
Sbjct: 5   RILLLGAQGQLGQELQKTLPTMGELIAVGKETVDLAVPEQLHEAILPVQPDIIVNAAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE E ++A ++N +    +A+ A ++G   I+ISTDYVFDG    P  E    +P 
Sbjct: 65  AVDRAESEVKLAHTVNQKAPTVLAELAQTLGALLIHISTDYVFDGTQSHPYTESDAPHPQ 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGS-NFLLSMLRLAKERREISVVCDQFG 180
           ++YG SK  GEE +    + ++ILRTAWVY   G  NF+ +MLRL +ER ++ VV DQ G
Sbjct: 125 SVYGHSKWQGEEGIRQTWDQHIILRTAWVYGTQGKGNFVKTMLRLGRERSDVRVVDDQVG 184

Query: 181 TPTSALQIARAIIQIAHNLIEN---SDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
           TPT A +I  AI  + H+   +   +   L G +H T + G  SW DFA  IF E+   G
Sbjct: 185 TPTWAKEIGDAIASLIHHWSTSDPVTQAELYGTYHFT-NRGVASWYDFAVAIFAEAQALG 243

Query: 238 GPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            P    +V  I T +YP  A RPAYS L   K+          W++ +R +L  +
Sbjct: 244 VPLQIERVIPITTPEYPLPAPRPAYSVLSNCKITPILGQPAPHWRQSLRQMLQEL 298


>gi|325915781|ref|ZP_08178083.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas vesicatoria ATCC
           35937]
 gi|325538045|gb|EGD09739.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas vesicatoria ATCC
           35937]
          Length = 299

 Score =  205 bits (521), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 121/299 (40%), Positives = 161/299 (53%), Gaps = 18/299 (6%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEII---RVGR-PD------IDLLKPKDFASFFLSFS 50
           M  LV+G +GQ+   L      D  I+   R GR PD       D   P+   +     +
Sbjct: 1   MTTLVLGASGQVGTELLRALAGDGPILASTRSGRLPDGATCEVADFDAPQSLVALLDRLA 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           P  ++N AAYTAVD+AE E + AF  NAE    IA+      +P ++ STDYVF+G    
Sbjct: 61  PTRVVNAAAYTAVDRAEQERDAAFRANAEAPAVIAQWCARADVPMVHYSTDYVFNGQGTR 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P      T PL +YG+SKLAGE+ V +    ++I RTAWVY+  G NFL +MLR+  ER 
Sbjct: 121 PYRPDDTTAPLGVYGQSKLAGEQAVQAAGGRHLIFRTAWVYAAHGHNFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
            + VV DQ GTPT A  IA      AH L +  + S  G++H+TA GG  SW  FAE IF
Sbjct: 181 VLRVVADQIGTPTPAALIADI---TAHALRQPGEPS--GLWHLTA-GGQTSWHGFAEAIF 234

Query: 231 WESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            ++  RG       V  I T  YPT A RPAYS LD   L +T  + +  W++G+  +L
Sbjct: 235 AQAHARGMLARVPHVEAISTADYPTPAMRPAYSRLDTHSLQDTFGVHLPAWQDGLSRVL 293


>gi|293407677|gb|ADE44331.1| putative dTDP-4-dehydrorhamnose reductase [Burkholderia
           pseudomallei]
 gi|312100407|gb|ADQ27803.1| dTDP-4-dehydrorhamnose reductase [Burkholderia pseudomallei]
 gi|312100441|gb|ADQ27835.1| dTDP-4-dehydrorhamnose reductase [Burkholderia pseudomallei]
 gi|312100471|gb|ADQ27857.1| putative dTDP-4-dehydrorhamnose reductase [Burkholderia
           pseudomallei]
          Length = 325

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 118/290 (40%), Positives = 158/290 (54%), Gaps = 10/290 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           ++ LV G NGQ+   L        +++  GR   DL +P+  A    S  PDVI+N AAY
Sbjct: 27  VRILVTGQNGQVGWELRRALAPLGDVVACGRETADLSRPETLAPLVASVKPDVIVNAAAY 86

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD AE++  +A  +NAE  G +A+AA       ++ STDYVFDG +RTP  E +PT+P
Sbjct: 87  TAVDLAEEQEALAHRVNAESVGVLAQAAREHDALLVHYSTDYVFDGTARTPYVETAPTSP 146

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +N YG++KLAGE  + + + +++ LRT WVY   G NFL +MLRL+ ER  + VV DQ G
Sbjct: 147 VNAYGRTKLAGERAIEAVSGDWLTLRTTWVYGARGRNFLRTMLRLSHERDALRVVADQIG 206

Query: 181 TPTSALQIARAIIQ-IAHNLIE-NSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            PTSA  IA      +AH   E  + T   G+FHMTA  G  SW  FA  I    A R  
Sbjct: 207 APTSARMIADLTAHVVAHAQRERRAGTFESGLFHMTA-AGETSWHGFASAII--DAARAV 263

Query: 239 -----PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
                    V  I +  YPT A RPA S LD  K      +    W++ +
Sbjct: 264 RAEAIKTKTVEPISSDAYPTPARRPANSILDNGKFDRRFMLNRLDWRQAL 313


>gi|29726030|gb|AAO88955.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Vibrio cholerae]
          Length = 291

 Score =  205 bits (521), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 124/292 (42%), Positives = 169/292 (57%), Gaps = 11/292 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK LV G+NGQ+   L     +  ++E + V R  +D+            F PD IIN A
Sbjct: 1   MKILVTGSNGQVGSCLVKQLTELSEIECLAVDRDQLDITDRDAVNKLVNEFKPDAIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAE E E++++IN  G   +++AA+S+G   ++ISTDYVF G       E    
Sbjct: 61  AHTAVDKAEQEVELSYAINRYGPEYLSQAANSVGASILHISTDYVFAGDKEGAYVETDAV 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P  +YG SKLAGE+ VA+    ++ILRTAWV+   G+NF+ +MLRLA+ R E+ VV DQ
Sbjct: 121 APQGVYGHSKLAGEQAVAAACPRHIILRTAWVFCETGNNFVKTMLRLAQSRDELRVVADQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA A+I ++  L  +S     GI+H    G P VSW  FA  IF + A+  
Sbjct: 181 FGGPTYAGDIANALIVMSVAL--HSGNGHYGIYHFA--GKPHVSWFQFACQIF-KQAKAQ 235

Query: 238 GPYSK---VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
             +SK   V  I + QYPT A RPA S LDC K+  T  I  S W+  ++N+
Sbjct: 236 KLFSKDIQVNAITSDQYPTPAKRPANSKLDCHKIEQTFCITPSDWQAALKNL 287


>gi|75674745|ref|YP_317166.1| dTDP-4-dehydrorhamnose reductase [Nitrobacter winogradskyi Nb-255]
 gi|74419615|gb|ABA03814.1| dTDP-4-dehydrorhamnose reductase [Nitrobacter winogradskyi Nb-255]
          Length = 308

 Score =  204 bits (520), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 119/294 (40%), Positives = 167/294 (56%), Gaps = 10/294 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G++GQ+  +L  +  +   +I   R   DL  P+  A     F PD+IINPAAY
Sbjct: 1   MRILLTGSSGQVGGALRPLLKEGGMVIAPSRSAFDLSNPETLAGALDRFKPDLIINPAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AEDE E+AF +NA+   AIA+ +    +P I+ STDYVFDG    P  E SPT P
Sbjct: 61  TAVDRAEDERELAFLVNAKAPAAIAEWSARHRVPLIHFSTDYVFDGSGDKPWREDSPTGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L++YG SKLAG+  + +    ++I RT+WVY+  G+NFL ++ RLA ER+E+ +V DQ G
Sbjct: 121 LSVYGASKLAGDLAIEAAGGPHLIARTSWVYAASGANFLRTIARLAGERKELRIVADQTG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSL-----RGIFHMTADGGPVSWADFAEYIFWESAE 235
            PT+A  IA A+ +I   L   SD S       G+ ++ A  G  SW  FA  I      
Sbjct: 181 APTTANTIADAVSRIV--LSNASDLSALFARSGGVVNL-ACAGETSWHGFATAIVGGLKS 237

Query: 236 RGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           RG   S   +  I T  +PT+A RP  S LD S+L     +   TW++ +   L
Sbjct: 238 RGAGLSVETIIPIATADFPTRARRPGNSRLDLSQLRERFGLTPPTWQDALSTEL 291


>gi|312797096|ref|YP_004030018.1| dTDP-4-dehydrorhamnose reductase [Burkholderia rhizoxinica HKI 454]
 gi|303399366|emb|CBK52866.1| dTDP-4-dehydrorhamnose reductase [Burkholderia rhizoxinica HKI 454]
 gi|312168871|emb|CBW75874.1| dTDP-4-dehydrorhamnose reductase [Burkholderia rhizoxinica HKI 454]
          Length = 312

 Score =  204 bits (520), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 156/286 (54%), Gaps = 8/286 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G  GQI   L        +++ V R   DL +P    +   +  P VI+NPAAYTAV
Sbjct: 15  LVTGVTGQIGSELVRTMQGLGKVVAVDRATFDLTEPNQMRAVIRAIKPTVIVNPAAYTAV 74

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D A+  P++A  +NA+  G +A+ A  +G   I+ STDYVF+G   +P  E    +P N+
Sbjct: 75  DAAQSNPDLAMQVNAKAPGVLAEEARRVGAAMIHYSTDYVFNGEKDSPYVEEDEADPKNV 134

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG SKLAGE  +AS   +++ILRT+WVY + G NFLL+MLRL  ER EI VV DQFG PT
Sbjct: 135 YGFSKLAGERAIASAGAHHLILRTSWVYGMRGRNFLLTMLRLGTERDEIKVVADQFGAPT 194

Query: 184 SALQIARAIIQIAHNLIENSDT-----SLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            +  IA     I    +   DT        G++H+TA  G  SW  FA+ IF   A    
Sbjct: 195 WSNTIATLTAHIVSQALAAHDTRQWWQERSGLYHLTA-AGSTSWHGFAKAIFDAIALERV 253

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           P   V  I +  +PT+A RPA SCL   KL     ++   W + ++
Sbjct: 254 P--TVMPIPSSDFPTQAERPANSCLSNGKLERVFGLQSPQWDQALK 297


>gi|148556921|ref|YP_001264503.1| dTDP-4-dehydrorhamnose reductase [Sphingomonas wittichii RW1]
 gi|148502111|gb|ABQ70365.1| dTDP-4-dehydrorhamnose reductase [Sphingomonas wittichii RW1]
          Length = 296

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 119/285 (41%), Positives = 160/285 (56%), Gaps = 7/285 (2%)

Query: 4   LVIGNNGQIAQSLSSM-CVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
           LV G  GQ+   L+      D+ I    R ++D+  P   A++ L    D I+N AAYTA
Sbjct: 6   LVTGGQGQVGLELARQDWPVDMSIYYPTRDELDIASPDSIAAYLLGRRFDAIVNCAAYTA 65

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VDKAE+E ++AF +N E  G +A    + GIP +++STDYVFDG       E  P  PL 
Sbjct: 66  VDKAEEERDLAFRVNGEAPGLLA----ATGIPLVHVSTDYVFDGSGDGYYREDDPVAPLG 121

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YG SKLAGE  V +     V+LRTAWV S   SNFL +MLR+A     + VV DQ G P
Sbjct: 122 VYGASKLAGERAVLAGGARAVVLRTAWVLSAHRSNFLRTMLRVAATNPTLRVVDDQRGCP 181

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
           T A  IA  +  IA  L+E+   +  G++H   + G  SW + A  IF  SA  GGP ++
Sbjct: 182 TGAADIAATLRTIALRLVEDP-AAPTGVYHFV-NAGEASWCELAREIFALSAAAGGPSAE 239

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           V  I T  YPT A RPA S L  +K+   + +R   W+E VR+I+
Sbjct: 240 VEAITTADYPTPAKRPANSRLSTAKIIADYAVRPRDWREAVRDIV 284


>gi|114332357|ref|YP_748579.1| dTDP-4-dehydrorhamnose reductase [Nitrosomonas eutropha C91]
 gi|114309371|gb|ABI60614.1| dTDP-4-dehydrorhamnose reductase [Nitrosomonas eutropha C91]
          Length = 295

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 170/296 (57%), Gaps = 13/296 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI----DLLKPKDFASFFLSFSPDVIINPAA 59
           ++ G NGQ+   L        ++I + R D+    DL           +  PDVI+N AA
Sbjct: 1   MLFGKNGQVGWELQRSLAPLGKLIALDRRDLHYCGDLTNLAGMTHTLQAIRPDVIVNAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVD+AE+EPE+AF IN E    +A+ A+ +G   I+ STDYVFDG    P  E  PT 
Sbjct: 61  YTAVDQAENEPELAFRINTEAPELLAQLAEQMGAWLIHYSTDYVFDGSGERPWLETDPTL 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+NIYG+SKL GEE +      ++ILRT+WVY+  G NF+ ++LRLA+E+ +++++ DQ 
Sbjct: 121 PVNIYGQSKLRGEESIRKSNCKHLILRTSWVYAARGKNFIRTILRLAQEKEQLTIIDDQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG-- 237
           G PT A  +A    Q    L+ + + S  GI+H+TA+ G VSW ++A+++   + E    
Sbjct: 181 GAPTGAELLADVTAQAIPQLLRHPEKS--GIYHVTAN-GEVSWCNYAQFLLNFACEHNLL 237

Query: 238 ---GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
               P S V  I +K + T A RP  S L+  KL NT N+ +  W+ GV  +L  I
Sbjct: 238 VKVRP-SAVTPIHSKAFVTSAKRPLNSRLNTDKLRNTFNLYLPHWQTGVTRMLSEI 292


>gi|312888931|ref|ZP_07748491.1| dTDP-4-dehydrorhamnose reductase [Mucilaginibacter paludis DSM
           18603]
 gi|311298449|gb|EFQ75558.1| dTDP-4-dehydrorhamnose reductase [Mucilaginibacter paludis DSM
           18603]
          Length = 286

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 173/291 (59%), Gaps = 11/291 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDV--EIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           + +V+G +GQ+ QSL  +  ++   E   +   + ++L        F +++P+  IN AA
Sbjct: 3   RIIVLGASGQLGQSLKFVTGENATGEFFFLAEEESNILDVNALTKAFATYNPNYCINCAA 62

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE + + A  +N +G   IAK         I++STD+VFDG S  P+ E    N
Sbjct: 63  YTAVDKAEGDLDTARKVNRDGVENIAKLCKEFDTTLIHVSTDFVFDGNSPYPLSEMDTPN 122

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+N YG +KL GE  ++ Y +NY ILRT+W+YS FG+NF+ +ML+LAKE+ E++++ DQ 
Sbjct: 123 PINAYGITKLEGEVVISEYIDNYYILRTSWLYSEFGANFVKTMLKLAKEKSELNIISDQV 182

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           GTPT A+ +A+AI+ I    I + + +  GI+H + + G  SW DFA+ IF    +  G 
Sbjct: 183 GTPTYAIDLAQAIVAI----INSDNKAAYGIYHYSNE-GVASWYDFAKAIF----DIAGI 233

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V+ I T QYPT A RP +S +D  K+ +T  + I  W+  ++  +  +
Sbjct: 234 AISVFPIRTSQYPTPAKRPVFSVMDKGKIKDTFKLDIPYWRYSLQGCIAKL 284


>gi|227538985|ref|ZP_03969034.1| dTDP-4-dehydrorhamnose reductase [Sphingobacterium spiritivorum
           ATCC 33300]
 gi|227241188|gb|EEI91203.1| dTDP-4-dehydrorhamnose reductase [Sphingobacterium spiritivorum
           ATCC 33300]
          Length = 287

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 162/286 (56%), Gaps = 12/286 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVE--IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ ++ G NGQ+   L  +   D E     + R  + L +          + PDVII+ A
Sbjct: 1   MRIVITGANGQLGSELKDILRNDTEKEYHFLDRKHLPLDQTLIIQDLLAQYQPDVIIHAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD+AE E E+A  IN      IA+     G   I ISTDYVFDG S  P+ E +P 
Sbjct: 61  AYTAVDRAESEQELADQINHLATSEIAQYCRIHGTKLIAISTDYVFDGNSNIPLKEDAPV 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           +P+NIYG +KL GE  +  +  + +I+RT+WVYS++G+NF+ +M+RL  ER EISV+ DQ
Sbjct: 121 DPINIYGLTKLKGEHAIQKWLPDGIIIRTSWVYSVYGNNFVKTMVRLMSEREEISVINDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            G+PT A  +A AI+ I       SD  + GI+H + + G +SW DFA  I     E  G
Sbjct: 181 IGSPTYAHDLALAIVDII-----ESDKWIGGIYHYSNE-GEISWYDFAVAI----REIKG 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
              K+  I T QYPT A RP YS LD SK+ +   +    WK+ ++
Sbjct: 231 LDCKINPIPTTQYPTPAKRPRYSLLDKSKIKHAFKVDTPNWKDSLK 276


>gi|300313656|ref|YP_003777748.1| dTDP-4-dehydrorhamnose reductase [Herbaspirillum seropedicae SmR1]
 gi|300076441|gb|ADJ65840.1| dTDP-4-dehydrorhamnose reductase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 312

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 116/295 (39%), Positives = 168/295 (56%), Gaps = 11/295 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G +GQ+ Q L  M  +  E++     ++DL   +   SF     P +I+N AAY
Sbjct: 1   MRILLTGASGQLGQVLQPMLARHGELLAPSSRELDLADRQALQSFLQQARPGLIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   A ++NA     +A+ A  +G P ++ STDYVFDG S  P  E  PT P
Sbjct: 61  TAVDKAESDVARAEAVNALAPMILAQQAQMLGAPLVHFSTDYVFDGKSARPYVETDPTGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           LN+YG++KLAGE+ +A++ + Y ILRT+WVY  +GSNFL +M RLA ER  ++VV DQ G
Sbjct: 121 LNVYGRTKLAGEQGIAAHCDAYWILRTSWVYGCYGSNFLKTMWRLAGEREYLTVVDDQIG 180

Query: 181 TPTSALQIARAIIQ-IAHNLIENSDTSLR---GIFHMTADGGPVSWADFAEYIFWESAER 236
            PT    IA  + + +AH    ++  S+R   G++H++A GG  SW  FA+ I      +
Sbjct: 181 APTWTHTIADTLARMLAHG--ADAQQSVRDTTGLYHLSA-GGATSWHGFAQRILQLLRAQ 237

Query: 237 GGPY----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G       + V  I +  YP  A RP  S LD   L  T ++ + TW+E +   L
Sbjct: 238 GETALLDPALVRPIASDAYPAIAQRPRNSRLDTGLLRRTFSLSLPTWEEALERCL 292


>gi|226726329|gb|ACO81753.1| RfbD [Herbaspirillum seropedicae SmR1]
          Length = 471

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 116/295 (39%), Positives = 168/295 (56%), Gaps = 11/295 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G +GQ+ Q L  M  +  E++     ++DL   +   SF     P +I+N AAY
Sbjct: 1   MRILLTGASGQLGQVLQPMLARHGELLAPSSRELDLADRQALQSFLQQARPGLIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   A ++NA     +A+ A  +G P ++ STDYVFDG S  P  E  PT P
Sbjct: 61  TAVDKAESDVARAEAVNALAPMILAQQAQMLGAPLVHFSTDYVFDGKSARPYVETDPTGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           LN+YG++KLAGE+ +A++ + Y ILRT+WVY  +GSNFL +M RLA ER  ++VV DQ G
Sbjct: 121 LNVYGRTKLAGEQGIAAHCDAYWILRTSWVYGCYGSNFLKTMWRLAGEREYLTVVDDQIG 180

Query: 181 TPTSALQIARAIIQ-IAHNLIENSDTSLR---GIFHMTADGGPVSWADFAEYIFWESAER 236
            PT    IA  + + +AH    ++  S+R   G++H++A GG  SW  FA+ I      +
Sbjct: 181 APTWTHTIADTLARMLAHG--ADAQQSVRDTTGLYHLSA-GGATSWHGFAQRILQLLRAQ 237

Query: 237 GGPY----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G       + V  I +  YP  A RP  S LD   L  T ++ + TW+E +   L
Sbjct: 238 GETALLDPALVRPIASDAYPAIAQRPRNSRLDTGLLRRTFSLSLPTWEEALERCL 292


>gi|117919829|ref|YP_869021.1| dTDP-4-dehydrorhamnose reductase [Shewanella sp. ANA-3]
 gi|117612161|gb|ABK47615.1| dTDP-4-dehydrorhamnose reductase [Shewanella sp. ANA-3]
          Length = 291

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/293 (41%), Positives = 171/293 (58%), Gaps = 11/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK LV G+NGQ+   L  +  Q  ++E + V R  +D+   +        F PD IIN A
Sbjct: 1   MKILVTGSNGQVGSCLVKLLNQIPEIEFLAVDREQLDITDYEAVNKLVSEFKPDAIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAE E E++++IN +G   +A+AA+S+G   ++ISTDYVF G       E    
Sbjct: 61  AHTAVDKAEQEVELSYAINRDGPQFLAQAANSVGATILHISTDYVFAGDKVGEYVETDEV 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P  IYGKSKLAGE  VA+    ++I+RTAWV+   G+NF+ +MLRLA+ R E+ VV DQ
Sbjct: 121 APQGIYGKSKLAGELAVAAACPRHIIMRTAWVFCETGNNFIKTMLRLAQSRDELGVVADQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA  +I+IA  L   +  +  GI+H +  G P VSW  F+  IF + A+  
Sbjct: 181 FGGPTYAGDIANTLIEIAQALY--AGNTHYGIYHFS--GLPHVSWYQFSCQIF-KQAKAQ 235

Query: 238 GPYSK---VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              SK   +  I ++QYPT   RPA S L C K+  T  ++   W+  + N++
Sbjct: 236 KLVSKDMLINGISSEQYPTPVKRPANSKLSCRKIEQTFGVKPCDWQSALNNLM 288


>gi|126175091|ref|YP_001051240.1| dTDP-4-dehydrorhamnose reductase [Shewanella baltica OS155]
 gi|125998296|gb|ABN62371.1| dTDP-4-dehydrorhamnose reductase [Shewanella baltica OS155]
          Length = 291

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 122/291 (41%), Positives = 169/291 (58%), Gaps = 9/291 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK LV G+NGQ+   L     Q  ++E   V R  +D+      A     F P  IIN A
Sbjct: 1   MKILVTGSNGQVGSCLVKQLSQMPEIEFWAVDRTQLDITDAAAVAKLVNDFKPHAIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAEDE  ++++IN +G   +A+AA+S G   ++ISTDYVF G  +    E    
Sbjct: 61  AHTAVDKAEDEVALSYAINRDGPQWLAEAANSAGAVMLHISTDYVFAGDKQGEYRETDAI 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           +P  +YGKSKLAGE  VA+    ++ILRTAWV+   G+NF+ +MLRL++ R E+ VV DQ
Sbjct: 121 DPQGVYGKSKLAGELAVAAACPRHIILRTAWVFCETGNNFVKTMLRLSQSRDELGVVADQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA A+I +A   I N + S  GI+H +  G P V+W  FA  IF ++  +G
Sbjct: 181 FGGPTYAGDIANALITMA-KAISNGNQSF-GIYHYS--GLPHVNWHLFACEIFKQAKSQG 236

Query: 238 --GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
                  V  I ++QYPT A RP  S LDC+K+     I+ S W+  +  +
Sbjct: 237 LLDKEMNVKAITSEQYPTPAKRPKNSKLDCNKILQHFGIQASDWRAALNKL 287


>gi|194364284|ref|YP_002026894.1| dTDP-4-dehydrorhamnose reductase [Stenotrophomonas maltophilia
           R551-3]
 gi|194347088|gb|ACF50211.1| dTDP-4-dehydrorhamnose reductase [Stenotrophomonas maltophilia
           R551-3]
          Length = 312

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 157/302 (51%), Gaps = 18/302 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI----------DLLKPKDFASFFLSFS 50
           M  LV+G NGQ+ Q L    V   +++   R  I          D  +P    +      
Sbjct: 1   MTVLVLGGNGQVGQELLRALVPLGKVVTTTRSGILPDGSVCETADFDQPDSLPALLDRLQ 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           P V++N AAYTAVD+AE E + AF++NAE  G IA+   +  +P ++ STDYVFDG    
Sbjct: 61  PSVVVNAAAYTAVDRAEREVDAAFAVNAEAPGVIARWCAAHDVPFVHYSTDYVFDGQGTA 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P  E  PT PL +YG SK  GE+ V +    ++I RTAWVY+  G+NFL +MLR+  ER 
Sbjct: 121 PYREDEPTAPLGVYGISKRDGEDAVRAAGGRHLIFRTAWVYASHGANFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
            + VV DQ GTPT A  IA    Q   +        L G +H+TA  G  SW  FAE IF
Sbjct: 181 ALRVVADQIGTPTPAALIADVTAQALQH-----PGQLSGTWHLTAS-GQTSWYGFAEAIF 234

Query: 231 WESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
            E+   G       V  I + +YPT A RPA+S LD  KL       +  W EG+  ++ 
Sbjct: 235 AEALATGVLAKVPAVEAIPSSEYPTPAKRPAWSVLDNRKLQQDLGTALPDWHEGLAIVMN 294

Query: 289 NI 290
            I
Sbjct: 295 EI 296


>gi|254482659|ref|ZP_05095897.1| dTDP-4-dehydrorhamnose reductase [marine gamma proteobacterium
           HTCC2148]
 gi|214037018|gb|EEB77687.1| dTDP-4-dehydrorhamnose reductase [marine gamma proteobacterium
           HTCC2148]
          Length = 293

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 165/291 (56%), Gaps = 9/291 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+ G  GQ+ + L     + VE I   R  +D+       +F     P +IIN AAYT
Sbjct: 4   KVLITGAAGQLGRELLRSVPEGVECIAATREILDIADAAQVRAFVRRERPGLIINAAAYT 63

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE E E+A +IN  GA  +A A    G   I++STD+VFDG S TP    +PT+PL
Sbjct: 64  AVDKAESEQELAAAINVNGAANLATACAENGSRLIHVSTDFVFDGTSSTPYLPDAPTSPL 123

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
             YG+SKLAGE+ V +   + +I+RTAWVYS FG NF+ +MLRL  ER E+SVV DQ GT
Sbjct: 124 GEYGRSKLAGEQAVVAGLPSALIMRTAWVYSAFGGNFVKTMLRLMAEREELSVVADQVGT 183

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG--GP 239
           PT A  +A A+   A    + SD  L+G++H T D G  SW DFA  I  E+ E G    
Sbjct: 184 PTWARGLADALWLAA----DQSD--LQGLYHWT-DAGVCSWYDFAVAIAEEALEIGLLQR 236

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             +++ I    YPT A RPA+S LD +            W+  +R++L  +
Sbjct: 237 MPRIHPIPGSAYPTPAARPAFSVLDKNSTWAVLKTEGLHWRSQLRSMLKEL 287


>gi|37678486|ref|NP_933095.1| dTDP-4-dehydrorhamnose reductase [Vibrio vulnificus YJ016]
 gi|37197226|dbj|BAC93066.1| dTDP-4-dehydrorhamnose reductase [Vibrio vulnificus YJ016]
          Length = 293

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 165/289 (57%), Gaps = 6/289 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L++G++GQ+   L      + +I+ + R  +D+ + +     F +F P  +IN AAY
Sbjct: 1   MRVLIVGSSGQLGHCLVRSLQTEHDILALDRQQLDICEEQAVEKVFATFQPQFVINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE+A+ +N EG   +A+     G P ++ISTDYVFDG       E     P
Sbjct: 61  TAVDKAESEPEMAYRVNEEGPKLLAQECHHHGCPLVHISTDYVFDGDKNGLYCEDDRPAP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            NIYG SKLAGE  V    + Y ILRT+WV+S FG+NF+ +MLR   ER ++ +V DQ G
Sbjct: 121 GNIYGMSKLAGEHAVQHACSQYYILRTSWVFSEFGNNFVKTMLRQGAERTQLGIVSDQVG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A  IAR I ++     +  +    G++H +  G P VSW +FA+ IF  + E+G  
Sbjct: 181 GPTYAGDIARVIGRLLERF-QFGEPVEYGLYHFS--GMPHVSWFEFAQAIFGLAHEQGVL 237

Query: 240 YSKVYR--IFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
             KV    + T++YPT A RP  S LD +KL +   +  S WK  +  +
Sbjct: 238 KRKVELKPLSTREYPTAAIRPMNSRLDSTKLKSQLQLEASDWKAALNQL 286


>gi|84386902|ref|ZP_00989926.1| dTDP-4-dehydrorhamnose reductase [Vibrio splendidus 12B01]
 gi|84378192|gb|EAP95051.1| dTDP-4-dehydrorhamnose reductase [Vibrio splendidus 12B01]
          Length = 293

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 120/293 (40%), Positives = 174/293 (59%), Gaps = 12/293 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ L+ G  GQ+     Q LS+   +++ +  + R  +D+       +    F P +IIN
Sbjct: 1   MRILITGCYGQVGSCLIQQLSNN--ENITVRALDREHLDITNHDAVNAAVAEFEPSIIIN 58

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE+E +++++IN +G   +A+AA ++G   ++ISTDYVF+G       E  
Sbjct: 59  AAAHTAVDKAEEEVDLSYAINRDGPKYLAQAAQNVGAAILHISTDYVFEGNKAGEYVETD 118

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            TNP  +YG+SKLAGE +VA     ++ILRTAWV+   G+NF+ +MLRL + R  +S+V 
Sbjct: 119 ATNPQGVYGESKLAGEIEVAEACEKHIILRTAWVFGESGNNFVKTMLRLGENRDALSIVG 178

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQFG PT A  IA A+IQIA   I   D    G++H +  G P VSW DFA  IF  + E
Sbjct: 179 DQFGGPTYAGDIANALIQIAKR-INQGDAVEYGVYHYS--GLPHVSWFDFANAIFDVAVE 235

Query: 236 RGGPYSK--VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
           +G   +K  +  I T QYPT A RP+ S L   K+    +++ S WK G+ NI
Sbjct: 236 QGVLANKPSLTSITTDQYPTPAKRPSNSRLSTEKITLGFSVKASDWKAGLNNI 288


>gi|262163807|ref|ZP_06031547.1| dTDP-4-dehydrorhamnose reductase [Vibrio mimicus VM223]
 gi|262027787|gb|EEY46452.1| dTDP-4-dehydrorhamnose reductase [Vibrio mimicus VM223]
          Length = 295

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 120/294 (40%), Positives = 173/294 (58%), Gaps = 12/294 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M+ LV G +GQ+     Q LS+M   DVE + V R  +D+            F P+VIIN
Sbjct: 2   MRILVTGCHGQVGYCLTQQLSAMA--DVEFLAVDREQLDITNLTQVDLVVNEFKPNVIIN 59

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E++++IN +G   +A+AA+ +G   ++ISTDYVF G       E  
Sbjct: 60  AAAHTAVDRAEQEIELSYAINRDGPQYLAQAANRVGALILHISTDYVFAGDKLCAYVETD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT+P  +YG+SKLAGE  VA   + ++ILRTAWV+   G+NF+ +MLRLA+ R  + VV 
Sbjct: 120 PTSPQGVYGQSKLAGEIAVAQACSRHIILRTAWVFGEHGNNFVKTMLRLAEIRDTLGVVA 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE 235
           DQFG PT A  IA+A+I +A  ++E    +  G++H +  G P +SW  FA  IF  + E
Sbjct: 180 DQFGGPTYAGDIAKALITMAKAIVEGKSVAF-GVYHFS--GVPHLSWHKFACTIFDNARE 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +       +V  I TK YPT A RP+ S LD  K+     I  S W+  + +++
Sbjct: 237 QALLSKTLQVNAITTKDYPTPAKRPSNSRLDSRKIHQNFGIAASDWQAALLHLV 290


>gi|93005457|ref|YP_579894.1| dTDP-4-dehydrorhamnose reductase [Psychrobacter cryohalolentis K5]
 gi|92393135|gb|ABE74410.1| dTDP-4-dehydrorhamnose reductase [Psychrobacter cryohalolentis K5]
          Length = 287

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 118/288 (40%), Positives = 168/288 (58%), Gaps = 4/288 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
            + LV G  GQ+   L ++      +I +    +D+              P++IIN AAY
Sbjct: 2   FRVLVTGAKGQVGSELVNLVPAGFTVIGLSSAQLDITDQDQVNVAVALHQPNLIINAAAY 61

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE + + A++IN +    +A+AA    IP  +ISTDYVFDG S TP  E    NP
Sbjct: 62  TAVDKAESDSDNAYAINEKAVAWLAQAAAHADIPLFHISTDYVFDGESTTPYKETDSINP 121

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YG SKLAGE+ +A+  N ++ILRT+WV+S  G+NF+ +MLRLAKER E+S+V DQ G
Sbjct: 122 QSVYGASKLAGEQMLAATHNKHIILRTSWVFSARGNNFVKTMLRLAKERDELSIVGDQHG 181

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG--G 238
            PTSA  IA  + ++A  L + +D+   GI++ + +    SW +FA  IF ++ E G   
Sbjct: 182 CPTSATSIADILWKLAE-LYQQTDSLPWGIYNFS-NSSACSWYEFAVEIFKQARESGFIP 239

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
               + +I T  YPT A RPA+S LDCSKL      +I  WK  +  I
Sbjct: 240 QTPTIKKITTADYPTPAVRPAFSVLDCSKLEKLLGQKIPEWKSELSTI 287


>gi|120598287|ref|YP_962861.1| dTDP-4-dehydrorhamnose reductase [Shewanella sp. W3-18-1]
 gi|120558380|gb|ABM24307.1| dTDP-4-dehydrorhamnose reductase [Shewanella sp. W3-18-1]
          Length = 308

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 118/291 (40%), Positives = 168/291 (57%), Gaps = 9/291 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK L+ G+NGQ+  SL     Q  ++E + V R  +D+   +          P+ IIN A
Sbjct: 18  MKILITGSNGQVGSSLVKQLNQMPEIEFLAVDRQQLDITDCEAVNKLVNELKPNAIINAA 77

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVD+AE E E++++IN +G   +A+AA+S+G   ++ISTDYVF G       E    
Sbjct: 78  AHTAVDRAEQEVELSYAINRDGPQFLAQAANSVGATILHISTDYVFAGDKDGEYIETDTV 137

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P  +YG+SKLAGE  V +    ++ILRTAWV+   G+NF+ +MLRLA  R E+ VV DQ
Sbjct: 138 APQGVYGQSKLAGELAVTAACPRHIILRTAWVFYGTGNNFVKTMLRLAHNRDELGVVADQ 197

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA A+I +A  L   +  +  G++H    G P VSW  FA  IF ++ E+ 
Sbjct: 198 FGGPTYAGDIANALIVMAKAL--QAGNTHYGVYHFA--GKPHVSWHQFAREIFKKANEQN 253

Query: 238 --GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
                 KV  I ++QY T A RPA S LDC K+  +  I+ S W+  + N+
Sbjct: 254 ILNKQMKVNAITSEQYLTPAKRPANSKLDCLKIEQSFGIKPSNWQAALNNL 304


>gi|85713611|ref|ZP_01044601.1| dTDP-4-dehydrorhamnose reductase [Nitrobacter sp. Nb-311A]
 gi|85699515|gb|EAQ37382.1| dTDP-4-dehydrorhamnose reductase [Nitrobacter sp. Nb-311A]
          Length = 308

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 114/288 (39%), Positives = 162/288 (56%), Gaps = 6/288 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G  GQ+  +L  +  +   +I   R   DL  P   A    +F PD+I+NPAAY
Sbjct: 1   MRILLTGTGGQVGGALRLLLGKSGTVIAPSRSAFDLSNPDTLAGALDAFRPDLIVNPAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AEDE ++AF +NA+   AIA+ +    +P I+ STDYVFDG    P  E SPT P
Sbjct: 61  TAVDRAEDERDLAFLVNAKAPAAIAEWSARHRVPLIHFSTDYVFDGSGDKPWREDSPTGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L+ YG SKLAG+  + +    ++I RT+WVY+  G+NFL +++RLA ER E+ +V DQ G
Sbjct: 121 LSAYGASKLAGDLAIHAAGGPHLIARTSWVYAATGANFLRTIVRLAGEREELRIVADQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLR---GIFHMTADGGPVSWADFAEYIFWESAERG 237
            PT+A  IA A+ +I +    N         G+ ++ A  G  SW  FA  I      RG
Sbjct: 181 APTTANAIANAVTRIVYPNTSNLSALFARHGGVINL-ACVGETSWHGFASAIVTGLKSRG 239

Query: 238 GPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
              S   +  I T  +PT+A RP  S LD S+L +   +   TW+E +
Sbjct: 240 MKLSVKTIIPIATTDFPTRARRPGNSRLDLSQLQDRFGLTPPTWQEAL 287


>gi|99077993|ref|YP_611252.1| dTDP-4-dehydrorhamnose reductase [Ruegeria sp. TM1040]
 gi|99034936|gb|ABF61990.1| dTDP-4-dehydrorhamnose reductase [Ruegeria sp. TM1040]
          Length = 299

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 126/288 (43%), Positives = 159/288 (55%), Gaps = 13/288 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M  LV G  GQ+A+ L+    +   +I VGR   DL  P   A+     +P+ +IN AAY
Sbjct: 19  MSILVFGATGQVARELA----RHEGVISVGREQADLSDPGACAALIRETAPEAVINAAAY 74

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE E E+A  IN    GA+A A   +GIP ++ISTDYVF G    P     P  P
Sbjct: 75  TAVDKAETEEELATVINGAAPGAMAAACVQMGIPFVHISTDYVFAGTGEAPWQTDDPVAP 134

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N YG+SK AGEE V +    Y ILRT+WV S  G+NF+ +MLRL   R ++SVV DQ G
Sbjct: 135 PNAYGRSKRAGEEAVIAAGGTYAILRTSWVVSAHGNNFVKTMLRLGAARAQVSVVADQIG 194

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A  IA A +++A  L+     S  GI+H    G P VSWA FA  IF  S      
Sbjct: 195 APTPARDIAEACLKMARQLVLEPKKS--GIYHF--QGAPYVSWAGFAAEIFAIS----NL 246

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             +V  I T  YPT A RP  S LDC+ L     I    W+ G+++IL
Sbjct: 247 ACEVVEIPTTDYPTPAVRPLNSRLDCTTLETVFGIPQPDWRRGLQDIL 294


>gi|84515470|ref|ZP_01002832.1| hypothetical protein SKA53_02391 [Loktanella vestfoldensis SKA53]
 gi|84510753|gb|EAQ07208.1| hypothetical protein SKA53_02391 [Loktanella vestfoldensis SKA53]
          Length = 289

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 127/291 (43%), Positives = 170/291 (58%), Gaps = 9/291 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M  LV G  GQ+A +L+     D+ I  +GR   DL  P   A+       DV+IN AAY
Sbjct: 2   MHVLVFGQTGQVATALAQQTCADITITCLGRDRADLTDPAACAAIIAQTHADVVINAAAY 61

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE EP++A +INA    A+A+A  +  IP ++ISTDYVF G    P     PT P
Sbjct: 62  TAVDRAESEPDLARAINATAPAAMARACAARKIPFLHISTDYVFGGSGSRPWQVDDPTGP 121

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L IYG++KLAGE+ V +    +VILRT+WV+S  G+NF+ +MLRL   R +I+VV DQ G
Sbjct: 122 LGIYGQTKLAGEDAVRAAAGAHVILRTSWVFSAHGANFVKTMLRLGAMRPDINVVADQHG 181

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT+A  IA A+I IA     ++   + G +H +  G P VSWA FA  IF  +    G 
Sbjct: 182 GPTAADDIAAALISIARAF--HTGRGISGTYHFS--GSPNVSWAGFARTIFASA----GI 233

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V  I T  YPT A RPA S LDCS LA  + I    W+  +R++L ++
Sbjct: 234 DCAVQDIPTSAYPTPAARPANSRLDCSALARDYAIAQPDWQGSLRHVLQSL 284


>gi|237808787|ref|YP_002893227.1| dTDP-4-dehydrorhamnose reductase [Tolumonas auensis DSM 9187]
 gi|237501048|gb|ACQ93641.1| dTDP-4-dehydrorhamnose reductase [Tolumonas auensis DSM 9187]
          Length = 299

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 112/290 (38%), Positives = 165/290 (56%), Gaps = 6/290 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           K ++ G  GQ+   L+        +++ + R  +D+  P+   S    + PDV+IN AA+
Sbjct: 7   KIMITGAYGQVGFCLTQQAQANGWDVLAIDRDKLDITDPQAVNSLVKEYQPDVVINAAAH 66

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE E + +F+IN +G   +A+AA S+    ++ISTDYVF G       E  P  P
Sbjct: 67  TAVDKAETEIDASFAINRDGPKYLAEAATSVDAAMLHISTDYVFSGDKDGTYSEADPVAP 126

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
             +YG SKLAGEE V +  + ++ILRTAWV+   G+NF+ +MLRL  +R ++ +V DQFG
Sbjct: 127 QGVYGASKLAGEEAVITANSKHIILRTAWVFGEHGNNFVKTMLRLGSQRDQLGIVADQFG 186

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG-- 237
            PT A  IA A++ +A   +    T   GI+H    G P V+W  FA+ IF ++ E    
Sbjct: 187 GPTYAGDIAAALLVMAEKAVAAPATVSWGIYHFA--GEPHVNWHQFAQAIFDKAVEHKLL 244

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               ++  + T  YPT A RPA S LDC K+ N   I+ S W + + NI+
Sbjct: 245 AKAPQLNALTTADYPTPAKRPANSRLDCRKIFNEFGIQPSDWHKALENIV 294


>gi|260576536|ref|ZP_05844525.1| dTDP-4-dehydrorhamnose reductase [Rhodobacter sp. SW2]
 gi|259021259|gb|EEW24566.1| dTDP-4-dehydrorhamnose reductase [Rhodobacter sp. SW2]
          Length = 284

 Score =  202 bits (513), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 163/291 (56%), Gaps = 12/291 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ LV G  GQ+A+ L  +  Q   +   GR   DL  P+   +   + +P+ +IN AAY
Sbjct: 1   MRLLVFGQTGQVARELQRLAPQARYL---GRDAADLAHPETLGAILRAAAPEAVINAAAY 57

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE E   A  IN +   A+A+A  ++G+P ++ISTDYVFDG    P     PT P
Sbjct: 58  TAVDRAETERSEALLINGQSPAAMAEACAALGVPFVHISTDYVFDGSGVQPFRPTDPTGP 117

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +N YG SKL GE  V +    + +LRT+WV+S  G+NF+ +MLRLA+ R  ++VV DQ G
Sbjct: 118 VNHYGHSKLVGEAGVRASGAVHAVLRTSWVFSAHGTNFVKTMLRLAQTRDRLTVVADQHG 177

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A  IARA + +A  L    D +  G++H    G P  +WA FA  +F ++      
Sbjct: 178 GPTPAAAIARACLTLAQTL--RDDPAKTGVYHFA--GAPDTTWAGFAREVFAQARL---- 229

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V  I T  +PT A RP  S LDC+    T  +    W+EG+R++L  +
Sbjct: 230 AVAVEDISTSAFPTPAARPLNSRLDCTSTETTFGLPRPDWREGLRDVLKEL 280


>gi|251798953|ref|YP_003013684.1| dTDP-4-dehydrorhamnose reductase [Paenibacillus sp. JDR-2]
 gi|247546579|gb|ACT03598.1| dTDP-4-dehydrorhamnose reductase [Paenibacillus sp. JDR-2]
          Length = 283

 Score =  202 bits (513), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 111/290 (38%), Positives = 165/290 (56%), Gaps = 13/290 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQD-VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+  V G NGQ+ + L+ +      EII + R ++D+   +   +      PD +I+ AA
Sbjct: 1   MRVAVTGANGQLGRELAMLDDNGRFEIIGLSRAELDITNLEQCRNVLAKLRPDAVIHCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE EP+ AF INA G   IA AA  IG     +STDYVFDG    P  E   TN
Sbjct: 61  YTAVDKAESEPDEAFRINAAGTRNIAVAAREIGAKLCAVSTDYVFDGTGTVPYKEHDRTN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P  +YG+SKLAGE+ V+S  + Y I+RT+WV+  +G+NF+ +ML+LA +R ++ VV DQ+
Sbjct: 121 PRTVYGQSKLAGEQAVSSLHDRYFIVRTSWVFGAYGNNFVKTMLKLASQREQLKVVADQW 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT    +A  ++++         T   GI+H +   G  SW +FA+ I  ES    G 
Sbjct: 181 GSPTYTRDLAIFLLELV-------STECYGIYHASGS-GVCSWFEFAQAIMEES----GS 228

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
            +++    T++YP  A RP YS +D   + +     +  W+E +R+ L N
Sbjct: 229 STRIDPCTTEEYPRPAPRPHYSVMDHGAIRSNGFTPLRHWREALRHYLSN 278


>gi|114563992|ref|YP_751506.1| dTDP-4-dehydrorhamnose reductase [Shewanella frigidimarina NCIMB
           400]
 gi|114335285|gb|ABI72667.1| dTDP-4-dehydrorhamnose reductase [Shewanella frigidimarina NCIMB
           400]
          Length = 291

 Score =  202 bits (513), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 164/291 (56%), Gaps = 9/291 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSM--CVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK L+ G NGQ+ + L  +      +  + + R ++D+            F P++IIN A
Sbjct: 1   MKILITGKNGQVGRCLVDLLEAQTGLTFLALDREELDITDSIQVDKIVTEFQPNIIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAE E E+AF+IN  G   +A AA+ I    ++ISTDYVFDG S     E   T
Sbjct: 61  AYTAVDKAEQESELAFAINRYGPQNLAYAANKINAAILHISTDYVFDGNSAESYTESDVT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P   YG+SKLAGE  VA     ++ILRTAWV+   G+NF+ +MLRLAK R  + VV DQ
Sbjct: 121 APQGEYGRSKLAGEHAVAQACPKHIILRTAWVFGERGNNFVKTMLRLAKTRESLGVVGDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA+AI+ I+  ++  S     GI+H +  G P VSW  FA+ IF  + E+ 
Sbjct: 181 FGGPTYAGDIAKAILTISKQVVRESKA--YGIYHFS--GFPHVSWYIFAKKIFEIALEQD 236

Query: 238 GPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
                 +V  I T  YPT A RPA S L+C K+ N   I  S W+  +  I
Sbjct: 237 LHVQPIQVNPITTLDYPTPAKRPANSRLNCDKIHNAFGIEQSDWQAALVRI 287


>gi|237748595|ref|ZP_04579075.1| dTDP-4-dehydrorhamnose reductase [Oxalobacter formigenes OXCC13]
 gi|229379957|gb|EEO30048.1| dTDP-4-dehydrorhamnose reductase [Oxalobacter formigenes OXCC13]
          Length = 278

 Score =  201 bits (512), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 121/284 (42%), Positives = 163/284 (57%), Gaps = 15/284 (5%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G  GQ+   L  +       I V R ++D+    D   F    S D IIN AAYTAV
Sbjct: 3   LVTGAGGQLGMELRVLLKDSA--IYVDRNELDISSETDVRRFLQQNSFDCIINCAAYTAV 60

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAEDEP +A ++N  GA  +AK   +I    I+ISTDYVFDG    P  E  PT P+++
Sbjct: 61  DKAEDEPVLADAVNHLGAKWLAKYGRTI----IHISTDYVFDGAHSKPYLEDDPTYPVSV 116

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKL GE+ V +     VI+RTAW+YS  GSNFL +MLRL +ER  ++VV DQ GTPT
Sbjct: 117 YGQSKLRGEQAVLNNAETAVIIRTAWLYSAHGSNFLKTMLRLGRERDHLNVVSDQVGTPT 176

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKV 243
            A  +A+AI++I    +       + I+H T + G  SW DFA  I     +  G   KV
Sbjct: 177 FAGDLAKAIVRI----LPKVKAGKKNIYHFTNE-GVCSWYDFAHAIM----KIAGLSCKV 227

Query: 244 YRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           + I +K YPTKA RP YS L+  K+ +   + I  W++ +  +L
Sbjct: 228 HPIESKNYPTKATRPFYSVLNKEKIKSDFKLEIPHWRDALIEVL 271


>gi|241662192|ref|YP_002980552.1| dTDP-4-dehydrorhamnose reductase [Ralstonia pickettii 12D]
 gi|240864219|gb|ACS61880.1| dTDP-4-dehydrorhamnose reductase [Ralstonia pickettii 12D]
          Length = 305

 Score =  201 bits (512), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 107/293 (36%), Positives = 161/293 (54%), Gaps = 7/293 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L+IG NGQ+   L         ++ +GR D DL +P        +F PDV+IN AAYTAV
Sbjct: 12  LLIGKNGQVGFELRRSLAPLGRVVALGRADCDLTQPDQLRQAVRAFQPDVVINAAAYTAV 71

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D AE EP+ A ++N    G +A+   + G   ++ S+DYVFDG    P  E    NP ++
Sbjct: 72  DNAETEPDAALAVNGVAPGVLAEMVRTNGGLLVHYSSDYVFDGAKDCPYLETDVPNPQSV 131

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG++KL GE  +A+   N ++LRT+WV    G NF+ ++LR A+ER+ + V+ DQ G PT
Sbjct: 132 YGRTKLEGERAIAASGANALVLRTSWVAGAHGDNFVKAILRQARERKHLRVIADQLGAPT 191

Query: 184 SALQIARAIIQIA--HNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER----G 237
           SA  IA    QI   H +    D  + G++H+ A  G  +W  +A  +   +A R     
Sbjct: 192 SASLIADVTAQIVARHWVYGERDALMPGVYHLAA-AGQTTWHGYASEVLRYAAGRCVDLK 250

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              + +  I   ++ ++A RPA SCLD SKL  T  + +  W+EG++ +L  I
Sbjct: 251 AAVAGIEAIPAVKWHSRASRPANSCLDTSKLRETFGVHLPNWQEGIQCLLEQI 303


>gi|251790436|ref|YP_003005157.1| dTDP-4-dehydrorhamnose reductase [Dickeya zeae Ech1591]
 gi|247539057|gb|ACT07678.1| dTDP-4-dehydrorhamnose reductase [Dickeya zeae Ech1591]
          Length = 285

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 119/290 (41%), Positives = 161/290 (55%), Gaps = 12/290 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G NGQ+ +       Q   ++      +D+       +   S+ PD I+N AAY
Sbjct: 1   MKVLLTGANGQLGRCFQDRLPQGWSVLATDTDSLDITDEAQVQATVASWQPDAIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE+A  IN  G   +A+AA   G   I++STDYVFDG +  P  E   T+P
Sbjct: 61  TAVDKAESEPELAARINVAGPEYLARAARQQGARFIHVSTDYVFDGTATRPYIETDATHP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG++KL GE  V        I+RTAWV+S +G+NF+ +MLRL +ER  + VV DQ G
Sbjct: 121 LGVYGQTKLDGERAVLKVNPAAQIVRTAWVFSEYGNNFVKTMLRLGRERDSLGVVADQRG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT A  IA AII +     E       G++H   D   VSW  FA+ IF   A++    
Sbjct: 181 CPTYAGDIADAIIGVLQQQAEG------GLYHFCGD-EEVSWHAFADAIF-AVADKQQLL 232

Query: 241 SK---VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           S+   V  I T+QYPT A RPAYS L+C+K+A    I  S W+  +  I+
Sbjct: 233 SRVPTVNAITTEQYPTPAARPAYSTLNCTKIARL-GISPSAWRAALSVII 281


>gi|296163283|ref|ZP_06846045.1| dTDP-4-dehydrorhamnose reductase [Burkholderia sp. Ch1-1]
 gi|295886465|gb|EFG66321.1| dTDP-4-dehydrorhamnose reductase [Burkholderia sp. Ch1-1]
          Length = 299

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 113/283 (39%), Positives = 157/283 (55%), Gaps = 6/283 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L+ G NGQ+   L+        ++ V R  +D+  P    +   +  P +I+NPAAYTAV
Sbjct: 11  LLTGVNGQVGFELARTLQGLGTVVAVDRAAMDMSDPDRVRAVVRNIRPALIVNPAAYTAV 70

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE+E ++A  IN E  G +A+ A  +G   ++ STDYVF+G    P  E  PT+P N+
Sbjct: 71  DKAEEELDLAMRINGEMPGVLAEEAKKLGAALVHYSTDYVFNGEKDCPYVEDDPTDPQNV 130

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG++KLAGE+ +A+    ++I RT+WVY   G NFLL+MLRL  ER E+SVV DQ G PT
Sbjct: 131 YGRTKLAGEQAIAASGCAHLIFRTSWVYGTRGKNFLLTMLRLGAEREELSVVADQIGAPT 190

Query: 184 SALQIARAIIQIAHNLIENSDTSLR---GIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            +  IA     +    +  SD   +   G++H+TA G   SW  FA+ IF  S     P 
Sbjct: 191 WSNTIATLTSNVLAQAVGGSDDWWKQSSGVYHLTASGA-TSWHGFAQAIFDNSKLPKKP- 248

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
             V  I    YPT A RPA S +   KL +T  +R   W E +
Sbjct: 249 -TVKPIPAASYPTPAARPANSRMSSDKLFSTFGVRAPKWDEAL 290


>gi|229106719|ref|ZP_04236950.1| hypothetical protein bcere0019_54990 [Bacillus cereus Rock3-28]
 gi|228676717|gb|EEL31332.1| hypothetical protein bcere0019_54990 [Bacillus cereus Rock3-28]
          Length = 279

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 115/290 (39%), Positives = 165/290 (56%), Gaps = 17/290 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCV---QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINP 57
           MK LV G  GQ+ Q +  +C+   Q  E+   GR ++D+   +      LS +PD+II+ 
Sbjct: 1   MKVLVTGAKGQLGQDV--LCLLENQQWEVFGFGREELDITNEEKVREKVLSINPDIIIHT 58

Query: 58  AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSP 117
           AAYT VD+AE + E AF +NAEG   +A+AA+++     Y+STDYVFDG    P      
Sbjct: 59  AAYTQVDQAESDEETAFKVNAEGTKYLAQAAEAVKAKFCYVSTDYVFDGTKNEPYKVDDQ 118

Query: 118 TNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD 177
           TNP  +YG SKLAGE     Y +   I+RT+WV+ ++G+NF+ +MLRLA+E+ E+ VV D
Sbjct: 119 TNPQTVYGSSKLAGEHYTQKYCSKSYIVRTSWVFGLYGNNFVKTMLRLAEEKTELGVVHD 178

Query: 178 QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
           Q G+PT    +AR II    NL++   T   GI+H  ++ G  SW DFA+ IF +S    
Sbjct: 179 QVGSPTYTPDLARFII----NLVK---TDKYGIYH-GSNSGVCSWYDFAKEIFKQSNIE- 229

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
                V  + T+ +P  A RP YS LD   +          WKE +++ L
Sbjct: 230 ---IVVNPLTTENFPRPAARPKYSVLDKGMIEENGFELFQDWKEALKDFL 276


>gi|91794012|ref|YP_563663.1| dTDP-4-dehydrorhamnose reductase [Shewanella denitrificans OS217]
 gi|91716014|gb|ABE55940.1| dTDP-4-dehydrorhamnose reductase [Shewanella denitrificans OS217]
          Length = 291

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/291 (40%), Positives = 171/291 (58%), Gaps = 9/291 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSM--CVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ L+ G NGQ+   L  +     D+  + + R  +D+    + +     F PD+IIN A
Sbjct: 1   MRILITGKNGQVGSCLVELLDAETDLTFLALDREQLDITDANEVSKVVAEFKPDIIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD+AE E E+A++IN +G   +A AA+ +    I++STDYVF G S     E   T
Sbjct: 61  AYTAVDRAEKECELAYAINRDGPYNLALAANDVNALIIHLSTDYVFSGNSSESYVESDKT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P + YG+SKLAGE+ V    + ++ILRTAWV+   G+NF+ +MLRLAK R  + VV DQ
Sbjct: 121 GPQSEYGRSKLAGEQAVVLACSRHIILRTAWVFGEHGNNFVKTMLRLAKTRDTLDVVADQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA+AI+ I++ +++ +     G++H +  G P VSW DFA+ IF  + ++G
Sbjct: 181 FGGPTYAGDIAKAILAISNQVMKGNQA--YGVYHYS--GFPHVSWYDFAKTIFSTALQQG 236

Query: 238 GPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
              +  +V  I T  Y T A RPA S LDC K+     I  S W+  ++ I
Sbjct: 237 FLKNTIQVRPITTLDYLTPAKRPANSRLDCHKINIAFVIEQSDWQSALKQI 287


>gi|294624436|ref|ZP_06703124.1| dTDP-4-keto-L-rhamnose reductase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294665242|ref|ZP_06730539.1| dTDP-4-keto-L-rhamnose reductase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292601259|gb|EFF45308.1| dTDP-4-keto-L-rhamnose reductase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292604993|gb|EFF48347.1| dTDP-4-keto-L-rhamnose reductase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 299

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 162/301 (53%), Gaps = 22/301 (7%)

Query: 1   MKCLVIGNNGQIAQSL------------SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLS 48
           M  LVIG +GQ+   L            +S   Q  + +   R D++ L   D A     
Sbjct: 1   MTTLVIGASGQVGTELLRVLAPLGTVVAASRSGQLADGLSCERIDLNELASLDLA--LNR 58

Query: 49  FSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLS 108
             P +++N AAYTAVD+AE E + AF  NAE  G IA+      +P ++ STDYVFDG  
Sbjct: 59  VRPALVVNAAAYTAVDRAEQERDAAFRANAEAPGVIAQWCARADVPLVHYSTDYVFDGQG 118

Query: 109 RTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKE 168
             P      T PL +YG+SKLAGE  V +    ++I RTAWVY+  G NFL +MLR+  E
Sbjct: 119 TRPYLPDDATAPLGVYGQSKLAGERAVQAAGGRHLIFRTAWVYAAHGHNFLRTMLRVGAE 178

Query: 169 RREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEY 228
           R  + VV DQ GTPT A  IA      AH L +  + S  G++H+TA  G  +W  FAE 
Sbjct: 179 RDVLRVVADQIGTPTPAALIADI---TAHALRQPGEPS--GLWHLTA-AGQTTWHGFAEA 232

Query: 229 IFWESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
           IF ++  RG      +V  I T  YPT A RPAYS LD   L +T  +R+  W++G+  +
Sbjct: 233 IFAQARARGLLARTPRVEAIGTADYPTPAKRPAYSRLDTHSLQDTFGVRLPDWQDGLSQV 292

Query: 287 L 287
           L
Sbjct: 293 L 293


>gi|332306500|ref|YP_004434351.1| dTDP-4-dehydrorhamnose reductase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173829|gb|AEE23083.1| dTDP-4-dehydrorhamnose reductase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 287

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 112/290 (38%), Positives = 163/290 (56%), Gaps = 10/290 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK L+ G NGQ+   L     +  VE+   G  ++D+ +  D A  F    PDV+IN AA
Sbjct: 1   MKVLITGKNGQLGWELCHRAPKAGVEVFAFGSSELDITQSGDVAQVFSCVKPDVVINCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE + E A+ +N  GA  IA A   IG   +++STD+VFDG    P       N
Sbjct: 61  YTAVDKAESDQENAYLVNETGAVNIANACKDIGARLLHVSTDFVFDGTKHCPYTITDTPN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YG SKLAGE  + + +   VI+RTAWVYS  G+NF+ +MLRL +E+ ++ +V DQ 
Sbjct: 121 PLGVYGASKLAGELGIQNVSPEAVIVRTAWVYSTHGNNFVKTMLRLMQEKPQLGIVSDQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG-- 237
           GTPT A  +A+ +  +           ++G++H T D G  SW DFA  I   + E+G  
Sbjct: 181 GTPTYAAGLAQWLWAVV------GQGDIKGMYHWT-DAGVASWYDFAVAIQELALEKGLL 233

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
                +  I+ +QYPT A RPA+S +D +   N   +    W++ + ++L
Sbjct: 234 KQAIPILPIYAQQYPTPAKRPAFSVIDKTSAENDTGLHTVHWRKQLASML 283


>gi|319791461|ref|YP_004153101.1| dtdp-4-dehydrorhamnose reductase [Variovorax paradoxus EPS]
 gi|315593924|gb|ADU34990.1| dTDP-4-dehydrorhamnose reductase [Variovorax paradoxus EPS]
          Length = 296

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 164/296 (55%), Gaps = 13/296 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRP----DIDLLKPKDFASFFLSFSPDVIIN 56
           MK L++G  GQ+   L        E++ +       + D  +P+  A   L   PDVI+N
Sbjct: 1   MKLLLLGKGGQVGWELQRSLAPLGELVALDFDSTDFNADFSRPEQLAETVLKVRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EP+ A  +NA   G +A+AA  IG   ++ STDYVFDG    P  E  
Sbjct: 61  AAAHTAVDKAESEPDFARKLNATSPGVVAEAAQQIGALMVHYSTDYVFDGSGSKPWKEDD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PL+IYG +KL GE+ VA +   ++I RT+WVY+  G NF  +MLR+AKER +++V+ 
Sbjct: 121 ATGPLSIYGSTKLEGEQLVAKHCARHLIFRTSWVYAARGGNFAKTMLRIAKERDKLTVID 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          ++  D S  G++H  A GG  +W  +A ++  ++   
Sbjct: 181 DQFGAPTGAELLADITAHAIRATLQ--DPSKAGLYHAVA-GGVTTWHGYARFVIEQAKAA 237

Query: 237 G-----GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G     GP + V  + T  +PT A RP  S LD +KL +T  + +  W+ GV  +L
Sbjct: 238 GVELKAGPEA-VEPVPTTAFPTPAKRPHNSRLDTTKLQSTFGLVLPEWQSGVARML 292


>gi|148252645|ref|YP_001237230.1| TDP-rhamnose synthetase, NAD(P)-binding [Bradyrhizobium sp. BTAi1]
 gi|146404818|gb|ABQ33324.1| dTDP-4-dehydrorhamnose reductase [Bradyrhizobium sp. BTAi1]
          Length = 300

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 121/272 (44%), Positives = 164/272 (60%), Gaps = 8/272 (2%)

Query: 2   KCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           +  V+G +GQ+A++L  +S    D+ +   GR   D+            F PD++INPAA
Sbjct: 5   RLYVLGRHGQVARALQEASEAQPDLVVGFGGRDAFDIADTDAVLQALHGFQPDIVINPAA 64

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVD+AE++   A+ +N +GA A+A+A+  + IP I++STDYVFDG    P  E     
Sbjct: 65  YTAVDRAEEDAAAAYHVNRDGARAVAEASARLEIPTIHLSTDYVFDGAKPAPYVEDDAPA 124

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+N+YG SKLAGE  VA+    +VILRTAWVYS FG NF+ +MLRLA  R  + VV DQ 
Sbjct: 125 PINVYGASKLAGELAVAAANRRHVILRTAWVYSPFGQNFVRTMLRLASSRDTLRVVNDQV 184

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTS-LRGIFHMTADGGP--VSWADFAEYIFWESAER 236
           G PTSAL IARAI+ IA  +     T+   G+ H+    GP  V+W DFA  I   +A  
Sbjct: 185 GCPTSALDIARAILAIARRIDRAGWTNEFGGVTHI---AGPDVVTWYDFACSIMRVAAAH 241

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKL 268
           G   +++  I T+ YPT A RPA S L C +L
Sbjct: 242 GARTARIEPIPTRDYPTPARRPANSRLSCDRL 273


>gi|146294972|ref|YP_001185396.1| dTDP-4-dehydrorhamnose reductase [Shewanella putrefaciens CN-32]
 gi|145566662|gb|ABP77597.1| dTDP-4-dehydrorhamnose reductase [Shewanella putrefaciens CN-32]
          Length = 294

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 118/291 (40%), Positives = 169/291 (58%), Gaps = 8/291 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSM--CVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           +K LV G NGQ+ + L +    +  + +  + R  +D+   +   +    F PDVIIN A
Sbjct: 4   IKVLVTGCNGQVGRCLVTQMQTMSSITLCALERERLDITNREQVDTVVNQFHPDVIINAA 63

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAE E E+ ++IN +G   +A+AA+ +G   ++IS+DYVF G       E    
Sbjct: 64  AYTAVDKAEQEIELCYAINRDGPKYLAEAANQVGALILHISSDYVFSGRKHGLYTEDDIP 123

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           +PL +YG+SKLAGE +VA+    ++ILRTAWV+   G NF+ +ML L +   E+ VV DQ
Sbjct: 124 DPLGVYGQSKLAGEIEVANLCPRHIILRTAWVFGEHGKNFVNTMLGLTQTHDELGVVADQ 183

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA ++I I    I   + +  GI+H +  G P VSW  FAEYIF ++ + G
Sbjct: 184 FGGPTYAADIAASLITIT-KAIRLKNGANFGIYHYS--GEPHVSWHQFAEYIFEQAFDVG 240

Query: 238 --GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
                 +V  I T  YPT+A RPA S LDC K+     I  S W+  ++N+
Sbjct: 241 LINKEIRVNAITTTDYPTQATRPANSKLDCRKIMKQFGIAPSDWQAALKNL 291


>gi|58580418|ref|YP_199434.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58425012|gb|AAW74049.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 302

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 119/302 (39%), Positives = 160/302 (52%), Gaps = 17/302 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEI---IRVGR-PD------IDLLKPKDFASFFLSFS 50
           M  LV G NGQ+   L      D  +    R G+ PD       D   P+   +      
Sbjct: 1   MTTLVFGANGQVGTELLRALAVDGAVQATTRSGQLPDGSACETADFDAPETLTALLDRIK 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           P  ++N AAYTAVD+AE + E A   NA   G +A    S  +P ++ STDYVFDG  + 
Sbjct: 61  PSRVVNAAAYTAVDRAEQDREGATRANATAPGVVAAWCASNRVPLVHYSTDYVFDGQGKA 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P  E + T+PL +YG++KLAGE+ + +    ++ILRTAWVY+  G+NFL +MLR+  ER 
Sbjct: 121 PYREDAQTSPLGVYGETKLAGEQAIRASGAQHLILRTAWVYASHGANFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
           E+ VV DQ GTPTSA  IA    Q+        DTS  G +H+TA  G  SW  FAE IF
Sbjct: 181 ELRVVADQIGTPTSAALIADVTAQLLRQ--RTPDTS--GTWHLTA-AGQTSWHGFAEAIF 235

Query: 231 WESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
            E+   G      +V  I T  YPT A RPAYS L    L     I +  W+ G++ ++ 
Sbjct: 236 EEAVSAGLLERAPRVVPITTADYPTPARRPAYSRLSIDTLQGDFGIELPEWRVGLQRVIA 295

Query: 289 NI 290
            +
Sbjct: 296 EL 297


>gi|261378780|ref|ZP_05983353.1| dTDP-4-dehydrorhamnose reductase [Neisseria cinerea ATCC 14685]
 gi|269144758|gb|EEZ71176.1| dTDP-4-dehydrorhamnose reductase [Neisseria cinerea ATCC 14685]
          Length = 287

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 113/292 (38%), Positives = 168/292 (57%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+       +   +F PD I+N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVFNMVKNFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T+VDKAE+    AF++NA     +A AA       I+ISTDYVFDG +  P  E   TNP
Sbjct: 61  TSVDKAEENVTTAFAVNASAVYNLASAAHRTHARFIHISTDYVFDGQANKPYLESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           LNIYGKSK AGE    S  +  +ILRT+W++S +G NF+ +ML LA ER  + VV +Q G
Sbjct: 121 LNIYGKSKAAGELLALSANSESLILRTSWLFSEYGDNFVRTMLNLANERSSLPVVSNQTG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  +A AII+    L++ S + +RGI+H  A G   SW +FA +IF  + ++    
Sbjct: 181 CPTYAGDLAAAIIR----LLQQS-SPVRGIYHF-AGGKSASWYEFARHIFQTALQQDTSF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  +  ++YP  A RP YS LDC K+ +   I+ S W++ +  +++ +
Sbjct: 235 PVPELNAVSDEEYPDAASRPPYSILDCRKIESDFGIKPSDWQKALSQVVLKL 286


>gi|163793775|ref|ZP_02187749.1| dTDP-4-dehydrorhamnose reductase [alpha proteobacterium BAL199]
 gi|159180886|gb|EDP65403.1| dTDP-4-dehydrorhamnose reductase [alpha proteobacterium BAL199]
          Length = 302

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 151/269 (56%), Gaps = 4/269 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQD-VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+ LV G  GQ+  +L +    D +  I  GR  +DL  P+  A+   + +PD ++NPAA
Sbjct: 1   MQVLVTGITGQVGGALVARSTPDGMNWIPAGRDRVDLSAPRSIAAAIDALAPDAVVNPAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVD AE + E AF +N +G  A+A A  + GIP + +STDYVFDG    P     P  
Sbjct: 61  YTAVDVAETDQETAFRVNRDGPAALAAACAARGIPLLQVSTDYVFDGTGSRPYRPSDPVA 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL  YG SK  GEE V S   ++VILRTAWVY+  G NF+ +MLR+  ER E+ VV DQ 
Sbjct: 121 PLGAYGTSKQEGEEAVRSTLADHVILRTAWVYAATGKNFVNTMLRVGAERDELRVVADQR 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           GTPT A  IA  ++ +       +  ++RG  H T   G  +W   A+ +F  +    G 
Sbjct: 181 GTPTPAEDIATVLLTVLKAW--QAGVAVRGTHHFTCS-GETTWHGLADAVFRRAERHWGR 237

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKL 268
              V+ I T  YPT A RPAYS LD S L
Sbjct: 238 RPIVHPIGTADYPTPAARPAYSVLDNSTL 266


>gi|170692119|ref|ZP_02883283.1| dTDP-4-dehydrorhamnose reductase [Burkholderia graminis C4D1M]
 gi|170143403|gb|EDT11567.1| dTDP-4-dehydrorhamnose reductase [Burkholderia graminis C4D1M]
          Length = 308

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 115/291 (39%), Positives = 154/291 (52%), Gaps = 8/291 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G NGQ+   L+        ++ V R  +DL       +      P +I+NPAAYTAV
Sbjct: 11  LVTGVNGQVGYELARTLQGLGHVVAVDRSTLDLSNLDQIRAVVRDVKPALIVNPAAYTAV 70

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE EPE+A  IN E  G +A+ A  +G   I+ STDYVFDG  +    E  P NP N+
Sbjct: 71  DKAEQEPELAMRINGEAPGVLAEEARKLGAALIHYSTDYVFDGEKQGAYVESDPANPQNV 130

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKLAGE+ +A+   N+++LRT+WVY   G NFLL+MLRL  +R E+ VV DQFG PT
Sbjct: 131 YGRSKLAGEQAIAATGENHLVLRTSWVYGTRGKNFLLTMLRLGADRPELKVVADQFGAPT 190

Query: 184 SALQIARAIIQIAHNLIENSDTS-----LRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
               IA     IA       D++       GI+H+ A G   SW  FA  IF  +     
Sbjct: 191 WCNTIATLTAHIAAQSFATPDSASWWRERSGIYHLCA-GDATSWHGFASAIFDLADLPQR 249

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           P      I    YPT A RP+ S +   KLA    +    W++ ++  L +
Sbjct: 250 P--NTLPIPAADYPTPARRPSNSRMSNDKLARVFGLAAPHWRDALKLCLTD 298


>gi|83955936|ref|ZP_00964447.1| hypothetical protein NAS141_03933 [Sulfitobacter sp. NAS-14.1]
 gi|83839700|gb|EAP78878.1| hypothetical protein NAS141_03933 [Sulfitobacter sp. NAS-14.1]
          Length = 288

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 119/291 (40%), Positives = 164/291 (56%), Gaps = 9/291 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G++GQ+A  L ++   DV+I  + R D+DL  P   A+      PD +IN AAY
Sbjct: 1   MKILVFGHSGQVATELRALDGDDVQITALARADVDLTDPATCAAAIDDHEPDAVINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE + E A  INA+   A+A+A  +  IP + ISTDYVF G+  TP +   PT+P
Sbjct: 61  TAVDKAESDAETAQIINADAPAAMARACAARDIPFVSISTDYVFSGVGNTPWEPADPTDP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
             +YG++K  GE  +      Y +LRT+WV S  G+NF+ +MLRL  ER  +++V +Q G
Sbjct: 121 QGVYGRTKRDGEVAIVKAGGRYAVLRTSWVVSAHGNNFVKTMLRLGAEREALTIVANQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A +IA+A   IA  L+  S+ S  GI+H +  G P  SWADFA  IF    +    
Sbjct: 181 GPTGAAEIAQACEIIAKALVSGSEKS--GIYHFS--GAPDTSWADFARAIF----DAAKI 232

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V  I +  YPT A RP  S LDC+       I    W + + +IL  +
Sbjct: 233 PCAVTDIPSSDYPTPAKRPLNSRLDCTTTEAAFGISRPDWHQSLTHILTQL 283


>gi|271499810|ref|YP_003332835.1| dTDP-4-dehydrorhamnose reductase [Dickeya dadantii Ech586]
 gi|270343365|gb|ACZ76130.1| dTDP-4-dehydrorhamnose reductase [Dickeya dadantii Ech586]
          Length = 285

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 119/289 (41%), Positives = 160/289 (55%), Gaps = 10/289 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G NGQ+ +           ++      +D+       +   S+ PD I+N AAY
Sbjct: 1   MKVLLTGANGQLGRCFQDRLPHGWSVLATDADSLDIADEAQVQATVKSWQPDAIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE+A  IN  G   +A+AA   G   I++STDYVFDG +  P  E   T+P
Sbjct: 61  TAVDKAESEPELAARINVAGPEYLARAARQQGARFIHVSTDYVFDGTATRPYIETDTTHP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG++KL GE  V        I+RTAWV+S +G+NF+ +MLRL +ER  + VV DQ G
Sbjct: 121 LGVYGQTKLDGERVVLKVNPAAQIVRTAWVFSEYGNNFVKTMLRLGRERESLGVVADQRG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG--G 238
            PT A  IA AII +   L + +D    G++H   D   VSW  FA  IF  + E+    
Sbjct: 181 CPTYAGDIADAIISL---LQQQADG---GLYHFCGD-EEVSWHKFASTIFTLAHEQQVLA 233

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               V  I T+QYPT A RPAYS LDC+K+A    I  S W+  +  I+
Sbjct: 234 RVPVVNAITTEQYPTPAARPAYSTLDCAKIARL-GIPPSAWRAALSTII 281


>gi|331647691|ref|ZP_08348783.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli M605]
 gi|331043415|gb|EGI15553.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli M605]
          Length = 299

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 167/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA G  AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATGVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|92116640|ref|YP_576369.1| dTDP-4-dehydrorhamnose reductase [Nitrobacter hamburgensis X14]
 gi|91799534|gb|ABE61909.1| dTDP-4-dehydrorhamnose reductase [Nitrobacter hamburgensis X14]
          Length = 304

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 117/295 (39%), Positives = 168/295 (56%), Gaps = 12/295 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ ++ G NGQ+  +L  +  +   +I   R   DL KP+  A     F PD+IINPAAY
Sbjct: 1   MRIVLTGTNGQVGGALRPLLEKGGTVIAPSRIAFDLSKPETLAEALDGFKPDLIINPAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AEDE E+AF +NA+G  AIA  +    +P I+ STDYVFDG +  P  E SPT P
Sbjct: 61  TAVDRAEDERELAFLVNAKGPAAIAAWSARHRVPLIHFSTDYVFDGSNDRPWREDSPTGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L++YG SKLAG+  +      ++I+RT+WVY+  G+NFL ++ RLA ER+E+ +V DQ G
Sbjct: 121 LSVYGASKLAGDLAIRVAGGPHLIVRTSWVYAASGANFLRTIARLAGERKELRIVADQVG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMT------ADGGPVSWADFAEYIFWESA 234
            PT+A  IA         ++ ++ ++L G+F         A  G  SW  FA  I     
Sbjct: 181 APTTASAIA----AAVAGIVVSNGSNLEGLFARNGGVVNLACAGETSWYGFASAIVAGLK 236

Query: 235 ERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            RG   +   +  I T  +PT+A RP  S LD S+L +   +   TW+E + + L
Sbjct: 237 SRGVKLAVEMITPIATADFPTRAKRPGNSRLDLSRLRDRLRVTTPTWQEALSSEL 291


>gi|311278964|ref|YP_003941195.1| dTDP-4-dehydrorhamnose reductase [Enterobacter cloacae SCF1]
 gi|308748159|gb|ADO47911.1| dTDP-4-dehydrorhamnose reductase [Enterobacter cloacae SCF1]
          Length = 293

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 171/291 (58%), Gaps = 8/291 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK L+ G NGQ+   L+     + +VE++   +  +D++  +   +      PD+IIN A
Sbjct: 1   MKVLLTGCNGQVGYCLAEQLKKISNVELLAFDKEQLDIVDTEQVNNIVSEKKPDIIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAE E ++A+SIN  GA  +A+AA  +G   I+ISTDYVF G       E   T
Sbjct: 61  AYTAVDKAEAESQLAYSINHIGAKNLAEAATKVGALLIHISTDYVFPGTKEGLYTESDQT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P+++YG+SKL GE  + +    Y+I+RTAWV+   G NF+ +MLRLAK  +++ VV DQ
Sbjct: 121 GPVSVYGRSKLDGENAIIASCAKYIIIRTAWVFGEHGHNFVKTMLRLAKTNKQLKVVSDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
            G PT A  IA+AI+ IA   ++  +T   G++H +  G P V+W+DFA  IF ++ ++ 
Sbjct: 181 QGGPTYAGDIAKAIVAIAVKFMK-EETVAYGLYHYS--GLPHVTWSDFAREIFNKAKDKN 237

Query: 238 --GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
                 +V  I T  YPT A RP  S L+  ++    +I+ S W+  + +I
Sbjct: 238 VLADIPQVIDIATTDYPTPAQRPKNSKLNTERITQEFDIQASDWQIALNSI 288


>gi|291615366|ref|YP_003525523.1| dTDP-4-dehydrorhamnose reductase [Sideroxydans lithotrophicus ES-1]
 gi|291585478|gb|ADE13136.1| dTDP-4-dehydrorhamnose reductase [Sideroxydans lithotrophicus ES-1]
          Length = 299

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 112/287 (39%), Positives = 157/287 (54%), Gaps = 6/287 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + LV G NGQ+   L        EII +    +DL  P           PD+I+NPAAYT
Sbjct: 3   RILVTGKNGQVGWELQRSLAAFGEIIALDSDSMDLADPDAIRRTIREVRPDIIVNPAAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE E E+A ++N    G +A+ A  +G   ++ STDYVFDG    P  E    NP 
Sbjct: 63  AVDKAESEMELANAVNGIAPGVLAEEAKLLGAILVHYSTDYVFDGSKPAPYVESDVPNPQ 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG++KLAGE+ V +    ++I RT+WVY + G NF+ +MLRLA+ER E+ +V DQFG 
Sbjct: 123 SVYGRTKLAGEQAVRASGCKHLIFRTSWVYGVHGGNFVKTMLRLARERNELRIVADQFGA 182

Query: 182 PTSALQIARAIIQIAHNLIENS-DTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           PT A  IA +     HN  + + D  L G++H+TA  G  +W  FAE I  E+ +     
Sbjct: 183 PTWAKDIANSTATALHNWQQLAWDDRLSGLYHLTA-AGRTNWHQFAETIIREARKYDTAL 241

Query: 241 S----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
           +     V  I T +YP  A RP  S L   K+ N   I +  W++ +
Sbjct: 242 AAKTIAVNPIATHEYPLPAKRPVNSVLANDKVRNAFGIAMPEWQDSL 288


>gi|54873718|gb|AAV41067.1| RmlD [Shigella boydii]
 gi|72003792|gb|AAZ65832.1| putative dTDP-4-dyhydrorhamnose reductase [Escherichia coli]
 gi|115503036|gb|ABI98961.1| RmlD [Escherichia coli]
 gi|332343821|gb|AEE57155.1| dTDP-4-dehydrorhamnose reductase RfbD [Escherichia coli UMNK88]
          Length = 299

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 118/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWYDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            E G P +  K+  + T  YPT A RP  S LD  K      + +  W+ GV+ +L
Sbjct: 235 REAGIPLALNKLNAVPTTAYPTLARRPHNSRLDTEKFQQNFALVLPDWQIGVKRML 290


>gi|182415801|ref|YP_001820867.1| dTDP-4-dehydrorhamnose reductase [Opitutus terrae PB90-1]
 gi|177843015|gb|ACB77267.1| dTDP-4-dehydrorhamnose reductase [Opitutus terrae PB90-1]
          Length = 292

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 108/287 (37%), Positives = 152/287 (52%), Gaps = 2/287 (0%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+ G  GQ+   L        +++ V  PD+D   P          +P+++IN AAYT
Sbjct: 5   KILLFGKVGQVGWELRRTLAPMSQLVAVDYPDVDFTAPDSIRRAIAEAAPNIVINAAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDK E E  +A  INA+  G +A+ A   G   ++ STDYVFDG   +P  E    NPL
Sbjct: 65  AVDKCESEFALAKQINADAPGVMAEEAQRRGALLVHYSTDYVFDGTKTSPYVEADAPNPL 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           + YG+SKLAG+E +     N++I R  WVY   G+NF+L+M RLA+ER ++ VV DQFG 
Sbjct: 125 SAYGRSKLAGDEAIRRTGCNHLIFRLCWVYGARGANFMLTMQRLAREREKLRVVADQFGC 184

Query: 182 PTSALQIARAIIQIAHNLIENSDT-SLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           PT +  IA        ++   +D  +L G +H+ A G   SW  FA  I           
Sbjct: 185 PTWSRMIAETTAHALRSVRSAADARALSGAYHLAASGH-TSWHGFASAIIDLMPLDARKC 243

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             V  I + +YPT   RPAYS L C+KL     +R+  W E +R ++
Sbjct: 244 RAVEAITSAEYPTPTKRPAYSVLSCAKLEQAFGLRLPDWHESLRQVV 290


>gi|224823817|ref|ZP_03696926.1| dTDP-4-dehydrorhamnose reductase [Lutiella nitroferrum 2002]
 gi|224604272|gb|EEG10446.1| dTDP-4-dehydrorhamnose reductase [Lutiella nitroferrum 2002]
          Length = 296

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/293 (37%), Positives = 165/293 (56%), Gaps = 5/293 (1%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L+ G+NGQ+   L        E+I + R ++DL  P    +    + P +I+NPAAYT
Sbjct: 3   RILITGSNGQVGFELKHALAPLGEVIALTRQEMDLADPASILAALNRYQPAIIVNPAAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE E E+A +INA+  G +A+ A+      I+ STDYVFDG       E    NP 
Sbjct: 63  AVDKAETEVELAMAINAKAPGVMAEWAEQHDALLIHYSTDYVFDGNKDGAYCEDDTANPQ 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG+SK  GE+ + + T +++ILRT+WV    G NFL ++LRLA ER  ++VV DQ G 
Sbjct: 123 SVYGRSKWEGEQAIRTCTAHHLILRTSWVVGAHGGNFLKTILRLAHERDSLNVVVDQIGA 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY- 240
           PT A  IA    Q+       +D    G +H+TA  G  SW D+A ++   + ++  P  
Sbjct: 183 PTPAALIADITAQLISCYRLPTDQFNYGTYHLTA-SGETSWYDYARFVVRLAEQQRCPLR 241

Query: 241 ---SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              S +  I T  YP  A RPA S LDCSKL++   + +  W++GV +++  +
Sbjct: 242 LAASAIRPISTSDYPLPAPRPANSRLDCSKLSHHFGLALPHWQQGVAHVVSQL 294


>gi|74317795|ref|YP_315535.1| dTDP-4-dehydrorhamnose reductase [Thiobacillus denitrificans ATCC
           25259]
 gi|74057290|gb|AAZ97730.1| dTDP-4-dehydrorhamnose reductase [Thiobacillus denitrificans ATCC
           25259]
          Length = 297

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 153/283 (54%), Gaps = 5/283 (1%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L+ G NGQ+   L        E++ +    ++L  P+       + +P +I+NPAAYT
Sbjct: 4   RILLTGPNGQVGWELQRTLGSLGEVVALDSSALNLADPRQVRETVRALAPRIIVNPAAYT 63

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE EPE+A ++N      +A+ A  +    ++ STDYVF+G    P  E  P +PL
Sbjct: 64  AVDKAESEPELARAVNVVAPALLAEEAHRLDALLVHYSTDYVFNGSGSRPWREDDPCDPL 123

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           N+YG +KL GE  +      ++I RT+WVY   GSNFLL+M RL +ER E+ +V DQ G 
Sbjct: 124 NVYGATKLEGERAIQESGCRHLIFRTSWVYGARGSNFLLTMTRLMRERPELKIVADQMGA 183

Query: 182 PTSALQIARAIIQIAHNL----IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
           PT    +A A  QI   L       +D +  G++H  A+GG  SW  FAE I     E  
Sbjct: 184 PTWCRDLAEATAQILSQLCAPQTRLTDPAPWGVYH-AANGGETSWHGFAEAIQRLEGEGP 242

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
             ++++  I +  YPT A RP  S LD  KLA    +R+  W+
Sbjct: 243 AAHARLLPIPSSDYPTPARRPLNSRLDSDKLARVFGLRLPDWR 285


>gi|166713450|ref|ZP_02244657.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 302

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 119/302 (39%), Positives = 159/302 (52%), Gaps = 17/302 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEI---IRVGR-PD------IDLLKPKDFASFFLSFS 50
           M  LV G NGQ+   L      D  +    R G+ PD       D   P+   +      
Sbjct: 1   MTTLVFGANGQVGTELLRALAVDGAVQATTRSGQLPDGSACETADFDAPETLTALLDRIK 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           P  ++N AAYTAVD+AE + E A   NA   G +A    S  +P ++ STDYVFDG    
Sbjct: 61  PSRVVNAAAYTAVDRAEQDRERATRANATAPGVVAAWCASNRVPLVHYSTDYVFDGQGTA 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P  E + T+PL +YG++KLAGE+ + +    ++ILRTAWVY+  G+NFL +MLR+  ER 
Sbjct: 121 PYREDAQTSPLGVYGETKLAGEQAIRASGAQHLILRTAWVYASHGANFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
           E+ VV DQ GTPT A  IA    Q+        DTS  G +H+TA  G  SW  FAE IF
Sbjct: 181 ELRVVADQIGTPTPAALIADVTAQLLRQ--RTPDTS--GTWHLTA-AGQTSWHGFAEAIF 235

Query: 231 WESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
            E+   G      +V  I T  YPT A RPAYS L   KL     I +  W+ G++ ++ 
Sbjct: 236 EEAVSAGLLERAPRVVPITTADYPTPARRPAYSRLSIDKLQGDFGIELPEWRVGLQRVIA 295

Query: 289 NI 290
            +
Sbjct: 296 EL 297


>gi|119947065|ref|YP_944745.1| dTDP-4-dehydrorhamnose reductase [Psychromonas ingrahamii 37]
 gi|119865669|gb|ABM05146.1| dTDP-4-dehydrorhamnose reductase [Psychromonas ingrahamii 37]
          Length = 294

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 116/293 (39%), Positives = 166/293 (56%), Gaps = 12/293 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ L+ G+ GQ+   L+       D + + +    +D+       +    F P +IIN A
Sbjct: 1   MRVLITGSKGQVGHCLTEQLRNYTDAQFLALDSKGLDITDQSAVQAVVNEFKPTIIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD+AEDE ++A++IN +GA  +A+AA S+    ++ISTDYVF G       E   T
Sbjct: 61  AYTAVDRAEDESDLAYAINRDGAKYLAEAAQSVNAVILHISTDYVFSGDKEGMYTEADLT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           +P  IYG+SKLAGE+ V    + ++ILRTAWV+   G+NF+  MLRLAK    + +V DQ
Sbjct: 121 SPQGIYGESKLAGEKAVIEACSRHIILRTAWVFGEHGNNFVKIMLRLAKTHDTLGIVGDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAE-- 235
           FG PT A  IA A++ +A  L  N D    GI+H +  G P VSW+ FA+ IF E+ +  
Sbjct: 181 FGGPTYAGDIASALVTVAKTL-SNGDNDKYGIYHYS--GFPHVSWSQFAQAIFDEAVQQT 237

Query: 236 --RGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
             +  P   V  I T  YPT A RPA S L  + + +   +  S WK  ++NI
Sbjct: 238 VLKQSPV--VNSITTADYPTPAKRPANSKLSTTLIKDKFGVNASDWKAALQNI 288


>gi|319424480|gb|ADV52554.1| dTDP-4-dehydrorhamnose reductase [Shewanella putrefaciens 200]
          Length = 294

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 118/291 (40%), Positives = 168/291 (57%), Gaps = 8/291 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSM--CVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           +K LV G NGQ+ + L +    +  + +    R  +D+   +   +    F PDVIIN A
Sbjct: 4   IKVLVTGCNGQVGRCLVTQMQTMSSITLCASERERLDITNREQVYTVVNQFHPDVIINAA 63

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAE E E+ ++IN +G   +A+AA+ +G   ++IS+DYVF G       E    
Sbjct: 64  AYTAVDKAEQEIELCYAINRDGPKYLAEAANQVGALILHISSDYVFSGRKHGLYTEDDIP 123

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           +PL +YG+SKLAGE +VA+    ++ILRTAWV+   G NF+ +ML L +   E+ VV DQ
Sbjct: 124 DPLGVYGQSKLAGEIEVANLCPRHIILRTAWVFGEHGKNFVNTMLGLTQTHDELGVVADQ 183

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA ++I I    I   + +  GI+H +  G P VSW  FAEYIF ++ + G
Sbjct: 184 FGGPTYAADIAASLITIT-KAIRLKNGANFGIYHYS--GEPHVSWHQFAEYIFEQAFDVG 240

Query: 238 --GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
                 +V  I T  YPT+A RPA S LDC K+     I  S W+  ++N+
Sbjct: 241 LINKEIRVNAITTTDYPTQATRPANSKLDCRKIMKQFGIAPSDWQAALKNL 291


>gi|254973883|ref|ZP_05270355.1| dTDP-4-dehydrorhamnose reductase, rfbD ortholog [Clostridium
           difficile QCD-66c26]
 gi|255091268|ref|ZP_05320746.1| dTDP-4-dehydrorhamnose reductase, rfbD ortholog [Clostridium
           difficile CIP 107932]
 gi|255312927|ref|ZP_05354510.1| dTDP-4-dehydrorhamnose reductase, rfbD ortholog [Clostridium
           difficile QCD-76w55]
 gi|255515686|ref|ZP_05383362.1| dTDP-4-dehydrorhamnose reductase, rfbD ortholog [Clostridium
           difficile QCD-97b34]
 gi|255648780|ref|ZP_05395682.1| dTDP-4-dehydrorhamnose reductase, rfbD ortholog [Clostridium
           difficile QCD-37x79]
 gi|260682000|ref|YP_003213285.1| dtdp-4-dehydrorhamnose reductase [Clostridium difficile CD196]
 gi|260685598|ref|YP_003216731.1| dtdp-4-dehydrorhamnose reductase [Clostridium difficile R20291]
 gi|306518897|ref|ZP_07405244.1| dtdp-4-dehydrorhamnose reductase [Clostridium difficile QCD-32g58]
 gi|260208163|emb|CBA60476.1| dtdp-4-dehydrorhamnose reductase [Clostridium difficile CD196]
 gi|260211614|emb|CBE01844.1| dtdp-4-dehydrorhamnose reductase [Clostridium difficile R20291]
          Length = 290

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 119/297 (40%), Positives = 172/297 (57%), Gaps = 25/297 (8%)

Query: 1   MKCLVIGNNGQIAQSLSSMCV---QDVE-----IIRVGRPDIDLLKPKDFASFFLSFSPD 52
           MK L+ G+NGQ+ + L S      Q +      I+   R D+D+    +  +F L   PD
Sbjct: 1   MKILITGSNGQLGKELVSQLEAINQSINQPKYVILATTRNDLDISNQTNIDNFILHNKPD 60

Query: 53  VIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPI 112
           VI+N AAYT VD  ED  EIA+ INA G   +A A++ +    ++ISTDYVF+G S+ P 
Sbjct: 61  VIVNCAAYTKVDACEDNIEIAYKINALGVRNLAIASEKVNAKLVHISTDYVFNGFSKYPY 120

Query: 113 DEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREI 172
            E + T P ++YGKSKL GE+ V  +++ Y ILRTAW+Y   G+NF+ +M++L+ E +E+
Sbjct: 121 REDNKTEPNSVYGKSKLMGEKFVEQFSHKYFILRTAWLYG-NGNNFVKTMIKLSLENKEV 179

Query: 173 SVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWE 232
           +VV DQFGTPTS + +A+ II+I        +T   G++H T + G  SW DFA+ IF  
Sbjct: 180 NVVNDQFGTPTSTVDLAKIIIRIM-------ETEHYGVYHATCE-GECSWYDFAKKIF-- 229

Query: 233 SAERGGPYSKVYRIFTKQYPTKAHRPAYSCLD--CSKLANTHNIRISTWKEGVRNIL 287
             E      KV  I + ++  KA RP YS LD    KL   ++ R   W+E +   L
Sbjct: 230 --ELKNIDIKVNPIKSNEFKCKAQRPLYSVLDNFMLKLIGLNSFR--KWEESIEEYL 282


>gi|255654310|ref|ZP_05399719.1| dTDP-4-dehydrorhamnose reductase, rfbD ortholog [Clostridium
           difficile QCD-23m63]
 gi|296452600|ref|ZP_06894294.1| possible dTDP-4-dehydrorhamnose reductase [Clostridium difficile
           NAP08]
 gi|296880988|ref|ZP_06904934.1| possible dTDP-4-dehydrorhamnose reductase [Clostridium difficile
           NAP07]
 gi|296258561|gb|EFH05462.1| possible dTDP-4-dehydrorhamnose reductase [Clostridium difficile
           NAP08]
 gi|296428009|gb|EFH13910.1| possible dTDP-4-dehydrorhamnose reductase [Clostridium difficile
           NAP07]
          Length = 290

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 117/297 (39%), Positives = 169/297 (56%), Gaps = 25/297 (8%)

Query: 1   MKCLVIGNNGQIAQSL--------SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPD 52
           MK L+ G+NGQ+ + L         SM      I+   R D D+    +  +F L+  PD
Sbjct: 1   MKILITGSNGQLGKELVNQLEAINQSMSQPKYAILATTRNDFDIYNQTNVDNFILNNKPD 60

Query: 53  VIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPI 112
           V++N AAYT VD  ED  E A+ +NA G   +A A++ +    I+ISTDYVF+G S+ P 
Sbjct: 61  VVVNCAAYTKVDACEDNIETAYKVNALGVRNLAIASEKVNAKLIHISTDYVFNGFSKYPY 120

Query: 113 DEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREI 172
            E S T P ++YGKSKL GE+ V  +++ Y ILRTAW+Y   G+NF+ +M++L+ E +E+
Sbjct: 121 REDSKTEPNSVYGKSKLMGEKFVEQFSHKYFILRTAWLYG-NGNNFVKTMIKLSLENKEV 179

Query: 173 SVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWE 232
           +VV DQFGTPTS + + + II+I        +T   G++H T + G  SW DFA+ IF  
Sbjct: 180 NVVNDQFGTPTSTVDLTKIIIRIM-------ETEHYGVYHATCE-GECSWYDFAKKIF-- 229

Query: 233 SAERGGPYSKVYRIFTKQYPTKAHRPAYSCLD--CSKLANTHNIRISTWKEGVRNIL 287
             E      KV  I + ++  KA RP YS LD    KL   ++ R   W+E +   L
Sbjct: 230 --ELKNIDIKVNPIKSNEFKCKAQRPLYSVLDNFMLKLIGLNSFR--NWEESIEEYL 282


>gi|289662629|ref|ZP_06484210.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289668427|ref|ZP_06489502.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 302

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 120/302 (39%), Positives = 161/302 (53%), Gaps = 17/302 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEI---IRVGR-PD------IDLLKPKDFASFFLSFS 50
           M  LV+G NGQ+   L      D  +    R G+ PD       D   P+  ++      
Sbjct: 1   MTTLVLGANGQVGTELLRALAVDGPVQATTRSGQLPDGSTCETADFNAPETLSALLDRVR 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           P  ++N AAYTAVD AE + E A   NA   G IA    S  +P ++ STDYVFDG    
Sbjct: 61  PSRVVNAAAYTAVDGAEQDRESAVRANATAPGVIAAWCASNRVPLVHYSTDYVFDGQGTA 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P  E + T+PL +YG++KLAGE+ + +    ++ILRTAWVY+  G+NFL +MLR+  ER 
Sbjct: 121 PYREDAHTSPLGVYGETKLAGEQAIRASGAQHLILRTAWVYASHGANFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
           E+ VV DQ GTPT A  IA    Q+        DTS  G +H+TA  G  SW  FAE IF
Sbjct: 181 ELRVVADQIGTPTPAALIADVTAQLLRQ--RTPDTS--GTWHLTA-AGQTSWHGFAEAIF 235

Query: 231 WESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
            E+   G      +V  I T  YPT A RPAYS L   KL +   I +  W+ G++ ++ 
Sbjct: 236 EEAVSAGLLERAPRVVPITTADYPTPAKRPAYSRLSIDKLQSDFGIELPEWRIGLQRVIA 295

Query: 289 NI 290
            +
Sbjct: 296 EL 297


>gi|332532394|ref|ZP_08408274.1| dTDP-4-dehydrorhamnose reductase [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332038261|gb|EGI74707.1| dTDP-4-dehydrorhamnose reductase [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 299

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 112/299 (37%), Positives = 166/299 (55%), Gaps = 13/299 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G NGQ+   L   C  +VE+I  G  ++D+   +      ++ SPD++IN AAY
Sbjct: 1   MKILVTGKNGQLGSELQKTCPSNVELICFGSKELDISNAEQVNELLITHSPDIVINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE + + A+++N  GA  +A     I    I+ISTD+VFDG S  P      TNP
Sbjct: 61  TAVDKAETDTDTAYAVNKLGAANLASTCKHINARLIHISTDFVFDGTSTMPYTASDATNP 120

Query: 121 LNIYGKSKLAGEEKVAS-YTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           L +YG SKLAGE+ +     +   I+RTAWVYS+FG+NF+ +MLRL  E+ ++ +V DQ 
Sbjct: 121 LGVYGASKLAGEQAINEILGSQATIVRTAWVYSVFGNNFVKTMLRLMAEKEQLGIVGDQV 180

Query: 180 GTPTSALQIARAIIQI-----AHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
           GTPT A  +A  +  +     +  ++   +T+   I + T D G  SW DFA  I  E A
Sbjct: 181 GTPTWAAGLANMLWALVAKASSEQVLNTENTAT--ILNWT-DAGVASWYDFAVAIQ-ELA 236

Query: 235 ERGGPYSK---VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              G  +K   +  I    YPT A RPA+S L+ ++      ++   W+  ++ +L  +
Sbjct: 237 IEQGLLTKSIPISAIPAASYPTPAKRPAFSVLNKAQAEEISGVKTVHWRTQLKEMLTEL 295


>gi|325920447|ref|ZP_08182375.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas gardneri ATCC 19865]
 gi|325549094|gb|EGD20020.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas gardneri ATCC 19865]
          Length = 302

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 161/302 (53%), Gaps = 17/302 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEI---IRVGR-PD------IDLLKPKDFASFFLSFS 50
           M  LV G NGQ+   L      D  +    R GR PD       D   P+   +     +
Sbjct: 1   MTTLVFGANGQVGTELLRALEADGAVQATTRSGRLPDGSACETADFDAPEALPALLDWIA 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           P  ++N AAYTAVD+AE +P+ A   NA   G IA    +  +P ++ STDYVFDG    
Sbjct: 61  PSRVVNAAAYTAVDRAEQDPDSAMRANALSPGVIAAWCAAHEVPLVHYSTDYVFDGQGTE 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P  E + T+PL +YG +KLAGE+ + +    ++ILRTAWVY+  G+NFL +MLR+  ER 
Sbjct: 121 PYLEDAQTSPLGVYGGTKLAGEDAIRASGAQHLILRTAWVYASHGANFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
           E+ VV DQ GTPT A  IA    Q+        DTS  G +H+TA  G  SW  FAE IF
Sbjct: 181 ELRVVADQIGTPTPAALIADVTAQLLRQ--RTPDTS--GTWHLTA-AGQTSWHGFAEAIF 235

Query: 231 WESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
            E+   G      +V  I T  YPT A RPAYS L   KL    +I +  W+ G++ ++ 
Sbjct: 236 EEAVSAGLLPRAPRVVPITTADYPTPAKRPAYSRLSIEKLQREFDIVLPDWQLGLQRVIA 295

Query: 289 NI 290
            I
Sbjct: 296 EI 297


>gi|270261090|ref|ZP_06189363.1| hypothetical protein SOD_a03150 [Serratia odorifera 4Rx13]
 gi|270044574|gb|EFA17665.1| hypothetical protein SOD_a03150 [Serratia odorifera 4Rx13]
          Length = 288

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 167/294 (56%), Gaps = 13/294 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G  GQ+ +       +   ++      +D+      +     F PD I+N AAY
Sbjct: 1   MRVLLTGAAGQLGRCFIDRLPEGWVLMATDSQQLDITDSSAVSKAVAEFKPDAIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE A +IN +G G +A AA  + IP +++STDYVFDG +  P  E +P +P
Sbjct: 61  TAVDKAESEPERAKAINTDGPGFLAAAAAMLNIPFVHVSTDYVFDGTASEPYCENTPCSP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YG++KL GE          V++RTAWV+S +G+NF+ +MLR+  +R E+ VV DQ+G
Sbjct: 121 KSVYGQTKLDGEHAALKANPKTVVIRTAWVFSEYGNNFVKTMLRVGAQRGELGVVSDQYG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLR-GIFHMTADGGPVSWADFAEYIFWESAERGGP 239
            PT A  IA A++ +       S T +  GI+H   D   VSW DFA+ IF E A+    
Sbjct: 181 CPTYAGDIAAAVVAML------SKTQVPCGIYHYCGDSA-VSWFDFAQIIF-EEAQVCTL 232

Query: 240 YS---KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           Y    KV  I + +YPT A RPAYS L   K+    N+R S WK+ ++ +L  I
Sbjct: 233 YPHQVKVNPIASHEYPTPASRPAYSILSTDKICAL-NLRPSPWKQQLKTVLRKI 285


>gi|288816243|gb|ADC54963.1| RmlD [Escherichia coli]
          Length = 299

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 167/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   +      + ++  + V  PD   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWEIKRALAPLGNLIALDVHSPDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRMALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|293602505|ref|ZP_06684951.1| dTDP-4-dehydrorhamnose reductase [Achromobacter piechaudii ATCC
           43553]
 gi|292819267|gb|EFF78302.1| dTDP-4-dehydrorhamnose reductase [Achromobacter piechaudii ATCC
           43553]
          Length = 298

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 108/285 (37%), Positives = 163/285 (57%), Gaps = 11/285 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L++G +GQ+ Q L    +   E+I +GR D+DL       +      PD I+N AAY
Sbjct: 1   MKILLLGKDGQVGQELQRTLLPLGEVIALGRHDVDLTDLDALHATLRVHRPDTIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE+E ++A  IN     A+A+ ++      I+ STDYVFDG ++ P  E  P  P
Sbjct: 61  TAVDKAENEKDLAAQINCRAVSALAQYSNEHNALLIHYSTDYVFDGAAKNPYSETDPVGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YG +KLAGE+ +       ++ RT+WV+S  G NFL ++LRLA+ +  ++VV DQFG
Sbjct: 121 QSVYGATKLAGEKAIIDSGCKALVFRTSWVFSSHGGNFLKTILRLARTKTSLNVVADQFG 180

Query: 181 TPTSALQIA--RAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            PTSA  IA   A+   ++   + ++    G++H+TA  G  SW +FA YI  E++ RG 
Sbjct: 181 APTSAELIADVSALAICSYRKKQFAE----GLYHLTA-SGTASWHEFARYIVSEASSRGA 235

Query: 239 PYS----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTW 279
                  ++  I  + YPT A RP  S L+ SKL+    +++  W
Sbjct: 236 ALQLTAERINAIPARDYPTPAKRPQNSRLNTSKLSQALQLQLPHW 280


>gi|119384852|ref|YP_915908.1| dTDP-4-dehydrorhamnose reductase [Paracoccus denitrificans PD1222]
 gi|119374619|gb|ABL70212.1| dTDP-4-dehydrorhamnose reductase [Paracoccus denitrificans PD1222]
          Length = 283

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 117/288 (40%), Positives = 163/288 (56%), Gaps = 12/288 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G +GQ+A  L+ +     E   +GR   +L      A+   +     ++N AAYTAV
Sbjct: 5   LVFGRSGQVATELARLAP---EARFLGRDQAELTDAAACAAAIRASGCTAVLNAAAYTAV 61

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D+AE EPE+A +INA+   A+A+ A  IG+P ++ISTDYVFDG    P  E  PT PL +
Sbjct: 62  DRAESEPELAHAINADAPAAMARTAAEIGVPFLHISTDYVFDGSGERPWSETDPTGPLGV 121

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG +KLAGE  +A+    + ILRT+WV+S  G+NFL +MLRL  ER E+ VV DQ G PT
Sbjct: 122 YGATKLAGERGIAAAGGQWAILRTSWVFSAHGANFLKTMLRLGAEREELRVVADQQGGPT 181

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGPYSK 242
            A  IA A + +   +   +D +  GI+H    GGP  SWA FA  I  ++    G   +
Sbjct: 182 PAGDIAAACLAMLGAM--RADAARGGIYHFA--GGPDTSWAGFAREIMAQA----GLSCR 233

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           V  I T  YPT A RP  S L+C+ ++    I    W+ G+  +L  +
Sbjct: 234 VTDISTADYPTPARRPVNSRLNCAAISRDFGIGRPDWRAGLAKVLQEL 281


>gi|120555541|ref|YP_959892.1| dTDP-4-dehydrorhamnose reductase [Marinobacter aquaeolei VT8]
 gi|120325390|gb|ABM19705.1| dTDP-4-dehydrorhamnose reductase [Marinobacter aquaeolei VT8]
          Length = 295

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 113/295 (38%), Positives = 159/295 (53%), Gaps = 8/295 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G++GQ+   L        ++I V R D DL   K+ A+     +PDV++NPAAY
Sbjct: 1   MKILVTGSDGQVGHELLKTLAPLGQVIGVTRKDADLASEKEVAALLARHNPDVVVNPAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE E + A+++N      +A    +     ++ STDYV+ G       E +PT P
Sbjct: 61  TAVDKAETEQDAAYALNERAPELMAAWCHAQNRLLVHYSTDYVYPGTGDAAQMETTPTGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YGKSKLAG+E V       +I RT+WVY   G NF+L+ML+LA E+  ++VV DQ G
Sbjct: 121 ASVYGKSKLAGDEAVLREAPEALIFRTSWVYGARGRNFMLTMLKLAAEKSRLTVVADQVG 180

Query: 181 TPTSALQIARAI-IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
            PT A  IA+   I +   L   +D S  G+FH+T  G   SW DFA  I   +   G  
Sbjct: 181 APTPAWLIAQVTAIAVRERLAGRADIS--GVFHLTCRGA-ASWCDFAREIVARARSAGRT 237

Query: 240 YS----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            +    +VY I T  YP  A RPA S LD S+L     + +  W+  +   L ++
Sbjct: 238 LAMDENQVYPIPTTDYPAPAPRPANSRLDVSRLEQALGLTLPQWQSALSITLADL 292


>gi|331668737|ref|ZP_08369585.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli TA271]
 gi|331063931|gb|EGI35842.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli TA271]
          Length = 299

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  INA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLINATSVEAIAKAANEVGAWAIHYSTDYVFPGTGEIPWQEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|300930357|ref|ZP_07145768.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli MS 187-1]
 gi|300461757|gb|EFK25250.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli MS 187-1]
          Length = 299

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 162/294 (55%), Gaps = 11/294 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPKGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQKHCAKHIIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          ++  + +  G++H+ A GG  +W D+A  +F E A +
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVAVDKPEVA--GLYHLVA-GGTTTWHDYAALVF-EEARK 236

Query: 237 GG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            G     +K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 237 AGINLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|83582779|ref|YP_425085.1| dTDP-4-dehydrorhamnose reductase [Rhodospirillum rubrum ATCC 11170]
 gi|83578095|gb|ABC24645.1| dTDP-4-dehydrorhamnose reductase [Rhodospirillum rubrum ATCC 11170]
          Length = 310

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 162/296 (54%), Gaps = 9/296 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQD--VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           + ++I   GQ+   L++       V ++R  R  IDL      ++         +IN AA
Sbjct: 8   RPVLILGTGQVGSELAAAKWPSGLVPVVR-DRKRIDLSNQGSVSAGVADQPWAFVINAAA 66

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE +PE AF++N +G   +A+A     IP +++STDYVFDG  + P  E  P  
Sbjct: 67  YTAVDKAETDPEAAFAVNRDGPRWLAEACARAHIPLLHLSTDYVFDGQKQEPYRETDPVA 126

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YG SK AGE  + +    ++ILRTAWV+S  G NF+ +MLRL +ER E+ VV DQ+
Sbjct: 127 PLGVYGASKEAGEAALRAVWERHIILRTAWVFSAHGHNFVKTMLRLGRERDELRVVADQY 186

Query: 180 GTPTSALQIARAIIQIAHNLIEN-----SDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
           G PT+A  IA +II I   L ++           G +H     GP +W   A+ +    A
Sbjct: 187 GCPTAASDIATSIIDIVRQLTDDKPRGGGQREGWGTYHFVG-AGPTTWYGLADAVMAGLA 245

Query: 235 ERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           ++ G    V  I T QYPT A RP  S LDC+++     IR  +W+EG+  +L  +
Sbjct: 246 KQEGRRPVVLPITTAQYPTPARRPVNSVLDCTQIEAVFGIRPRSWREGLDEVLQTL 301


>gi|168481293|gb|ACA24783.1| RmlD [Shigella dysenteriae]
          Length = 299

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  INA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLINATSVEAIAKAANEVGAWAIHYSTDYVFPGTGEIPWQEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLSAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|152974750|ref|YP_001374267.1| dTDP-4-dehydrorhamnose reductase [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152023502|gb|ABS21272.1| dTDP-4-dehydrorhamnose reductase [Bacillus cytotoxicus NVH 391-98]
          Length = 283

 Score =  198 bits (503), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 111/264 (42%), Positives = 154/264 (58%), Gaps = 13/264 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQD-VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           +K  + G NGQ+ + L  +   D  E+  +G+  +D+ K +D         PD++I+ AA
Sbjct: 4   IKVCITGANGQLGKELQEVFTLDKYEVHPLGKDVLDVTKMEDVMRLMQQLQPDIVIHAAA 63

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VDKAEDE  +AF +NA G   IA AA       +YISTDYVF G  +    EF  T 
Sbjct: 64  YTKVDKAEDEQALAFLVNAIGTRNIAVAAQEYNAKLVYISTDYVFSGDQKEGYHEFHATA 123

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+NIYG SKLAGE+ V S  + Y I+RT+W+Y  +G NF+ ++LRLA ER EIS+V DQ 
Sbjct: 124 PINIYGHSKLAGEQFVQSLHHRYFIVRTSWLYGKYGHNFVKTILRLADEREEISIVSDQI 183

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT A  +AR I ++        +T+L GI+H+  + G  SW +FA+     + +    
Sbjct: 184 GSPTYAGDLARMIEKLV-------ETNLYGIYHV-CNSGSCSWYEFAK----NALQIMRK 231

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCL 263
             KV+ I TK Y  KA RP YS L
Sbjct: 232 DVKVHPITTKDYGAKAKRPQYSIL 255


>gi|197334022|ref|YP_002154930.1| dTDP-4-dehydrorhamnose reductase [Vibrio fischeri MJ11]
 gi|197315512|gb|ACH64959.1| dTDP-4-dehydrorhamnose reductase [Vibrio fischeri MJ11]
          Length = 293

 Score =  198 bits (503), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 116/291 (39%), Positives = 167/291 (57%), Gaps = 8/291 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVE--IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ L+ G  GQ+   L+     +    ++ + R  +D+       +    F P +IIN A
Sbjct: 1   MRVLITGCYGQVGHCLTEQLADEESTIVLSLDRDQLDITNQDAVNTIVDDFQPTIIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAE+E ++++ IN +G   +A+AA  +    ++ISTDYVF+G       E   T
Sbjct: 61  AHTAVDKAEEEVDLSYVINRDGPSYLAQAAQRVDAAMLHISTDYVFEGNKVGEYQETDTT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           NP  +YG+SKLAGE  VA+  + ++ILRTAWV+   G+NF+ +MLRLA  R  +S+V DQ
Sbjct: 121 NPQGVYGESKLAGEIAVANACDKHIILRTAWVFGENGNNFVKTMLRLAATRNALSIVGDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA A+IQIA   I   D    G++H +  G P VSW +FAE IF  + ++ 
Sbjct: 181 FGGPTYAGDIAHALIQIAKR-ITKGDEVEYGVYHYS--GLPHVSWFEFAEAIFDTAVKQK 237

Query: 238 GPYSK--VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
              +K  +  I T QYPT A RP+ S L   K+ N   I+ S W   + NI
Sbjct: 238 VIPNKPSLTSITTDQYPTPAKRPSNSRLSTDKITNNFGIKASDWMAALNNI 288


>gi|73540419|ref|YP_294939.1| dTDP-4-dehydrorhamnose reductase [Ralstonia eutropha JMP134]
 gi|72117832|gb|AAZ60095.1| dTDP-4-dehydrorhamnose reductase [Ralstonia eutropha JMP134]
          Length = 304

 Score =  198 bits (503), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 115/293 (39%), Positives = 154/293 (52%), Gaps = 7/293 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G NGQ+   L         ++ + R   DL  P           PDVI+NPAAYTAV
Sbjct: 11  LVTGCNGQVGFELRRSLAPLGNVVALDRSACDLANPDALRRVVRQCRPDVIVNPAAYTAV 70

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE + E+AF+INA  AG +A+ A ++G   ++ S+DYVFDG       E    NP ++
Sbjct: 71  DKAETDAEVAFAINATAAGILAEEAKALGSLLVHYSSDYVFDGTKDGAYVETDAVNPQSV 130

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YGKSKLAGE+ +A+     V+LRT WV    G NF  +MLRL KER  + V+ DQFG PT
Sbjct: 131 YGKSKLAGEQAIAATGVQSVVLRTCWVAGAHGGNFAKTMLRLGKERDSLRVIADQFGAPT 190

Query: 184 SALQIARAIIQIA--HNLIENSDTSLRGIFHMTADGGPVSWADFA----EYIFWESAERG 237
           +A  IA    QI   H L  +      GI+H+ A  G  +W  +A     Y      E  
Sbjct: 191 TASLIADVTAQIVARHWLAGDRQAFANGIYHLAA-AGETTWHGYATEVLRYAKAHGVELK 249

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
               ++  I    YP  A RP+ S LD ++L  T  I +  WK+GV+ +L  I
Sbjct: 250 ADPEQIEAIPATAYPLPAPRPSNSRLDTTRLQETFGIHLPDWKQGVQFLLDQI 302


>gi|300717502|ref|YP_003742305.1| dTDP-4-dyhydrorhamnose reductase [Erwinia billingiae Eb661]
 gi|299063338|emb|CAX60458.1| dTDP-4-dyhydrorhamnose reductase [Erwinia billingiae Eb661]
          Length = 295

 Score =  198 bits (503), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 117/297 (39%), Positives = 170/297 (57%), Gaps = 11/297 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI----DLLKPKDFASFFLSFSPDVIIN 56
           MK L++G NGQ+   L         +I + R       DL   +  A+  L+  PDVI+N
Sbjct: 1   MKILLLGKNGQVGWELQRALAPLGTLIALDRHSTTYCGDLSNAEGIAATILAIKPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +N     A+A AA+ +G   ++ STDYVF+G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEVAAVLNTSSVAAMAAAAEEVGALLVHYSTDYVFNGQGEQPWTEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PL++YGK+K  GEE +A+  +NY+I RT+WVY+  G+NF  +ML+LAK+R E+SV+ 
Sbjct: 121 VTEPLSVYGKTKRDGEEAIAAACSNYLIFRTSWVYAAKGNNFAKTMLKLAKDREELSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIE-NSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           DQFG PT A  IA      AH + +   +  L GI+H+ A  G  +W D+A ++     E
Sbjct: 181 DQFGAPTGADLIADC---TAHAIRKAKGEPQLSGIYHLIAS-GTTTWHDYASFVITTGRE 236

Query: 236 R--GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           +  G   +K+  + T  +PT A RPA S LD +K   +  + +  W +GV  +L  I
Sbjct: 237 KGLGLKVNKINPVATSAFPTPAKRPANSRLDTAKFQQSFGLTLPDWHDGVERMLTEI 293


>gi|32455999|ref|NP_862001.1| rb126 [Ruegeria sp. PR1b]
 gi|22726351|gb|AAN05147.1| RB126 [Ruegeria sp. PR1b]
          Length = 282

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 127/291 (43%), Positives = 162/291 (55%), Gaps = 13/291 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M  LV G  GQ+A+ L++    D  ++ +GR   DL  P   A+   + +P  +IN AAY
Sbjct: 1   MSILVFGATGQVARELAT---HD-GVVCLGRDQADLSDPGACAAAIRAHAPRAVINAAAY 56

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE E E+A  IN    GA+A A   +G+P + ISTDYVF G    P     P  P
Sbjct: 57  TAVDKAEGEEELARIINGAAPGAMAAACVQLGVPLVQISTDYVFAGSGEMPWRPEDPVAP 116

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N YG+SK AGEE V +    Y ILRT+WV S  G NF+ +MLRL  ER ++++V DQ G
Sbjct: 117 PNAYGRSKRAGEEAVIAAGGTYAILRTSWVVSCHGHNFVKTMLRLGAERDQLTIVGDQIG 176

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A  IA A I +A  LI  +D    GI+H    G P VSWADFA  IF ++    G 
Sbjct: 177 APTPARDIAAACISMAEQLI--ADPGKSGIYHF--QGAPCVSWADFAREIFAQA----GL 228

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V  I T  YPT A RP  S LDC+ L     I    W+ G+R IL ++
Sbjct: 229 SCAVADIPTSDYPTPAARPLNSRLDCALLDTVFGIPQPDWRVGLREILKDL 279


>gi|300770495|ref|ZP_07080374.1| dTDP-4-dehydrorhamnose reductase [Sphingobacterium spiritivorum
           ATCC 33861]
 gi|300762971|gb|EFK59788.1| dTDP-4-dehydrorhamnose reductase [Sphingobacterium spiritivorum
           ATCC 33861]
          Length = 286

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 163/292 (55%), Gaps = 12/292 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK L+ G NGQ+   L  +    QDVE   + R  + L +     +    + PD+II+ A
Sbjct: 1   MKILITGANGQLGSELREIYNERQDVETFFLDRKQLPLEQTMLIQNILAMYEPDLIIHAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD AE EPE+A +IN   +  IA+     G   I ISTDYVFDG S   + E S  
Sbjct: 61  AYTAVDLAESEPELADAINHLASEQIAEYCAIHGTRLIAISTDYVFDGKSAVALSEDSSV 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P+++YGK+KL GE+ +     + +I+RT+WVYS++G NF+ +M+RL  ER EI VV DQ
Sbjct: 121 GPISVYGKTKLKGEQIIQRLCPDAIIIRTSWVYSVYGKNFVKTMIRLMTEREEIGVVSDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            G+PT+A  +A AI+ I      ++     GI+H + D G +SW DFA  I     +   
Sbjct: 181 IGSPTAAKDLASAIVHII-----DAAKWEGGIYHYSND-GEISWYDFALAI----KDFNR 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
               +  I T  YPT A RP +S LD SK+     + +  WK+ +R  L+ +
Sbjct: 231 LSCNIRAISTNNYPTPAQRPQFSLLDKSKIKRIFGVNVPYWKDSLRQTLMQL 282


>gi|26988515|ref|NP_743940.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas putida KT2440]
 gi|24983282|gb|AAN67404.1|AE016367_4 dTDP-4-dehydrorhamnose reductase [Pseudomonas putida KT2440]
          Length = 300

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 120/301 (39%), Positives = 162/301 (53%), Gaps = 13/301 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI-----DLLKPKDFASFFLSFSPDVII 55
           MK L++G NGQ+   L        E+I + R        DL      A+     +PDVI+
Sbjct: 1   MKILLLGKNGQVGWELQRALAPLGEVIALDRQGAEGLCGDLSNLDGLAATIRQLAPDVIV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVDKAE +  +A  INA     +A+   ++G   I+ STDYVFDG      +E 
Sbjct: 61  NAAAYTAVDKAESDQALAAMINAAAPAVLARETAALGAWLIHYSTDYVFDGSGSQRWEET 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
           +PT PL++YG++KL GE  + +     V+LRT+WVY+  G NF  +MLRLA ER  +SVV
Sbjct: 121 APTGPLSVYGRTKLEGEHAILASGAKAVVLRTSWVYAARGHNFAKTMLRLAAERETLSVV 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDT-SLRGIFHMTADGGPVSWADFAEYIFWESA 234
            DQFG PT A  IA     I   +    D   L GI+H+ A  G  SW  FA+++    A
Sbjct: 181 ADQFGAPTGADLIADVTAHILRQIFNGQDNRHLAGIYHLAAS-GETSWHGFAQFVL-AHA 238

Query: 235 ERGG-----PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           +R G        KV  I T+ YP  A RP  S L   KL NT N ++  W++GV+ +L  
Sbjct: 239 QRTGVALKVTADKVAAISTEAYPVPAPRPRNSRLALGKLENTFNFKMPLWEQGVQRMLDE 298

Query: 290 I 290
           I
Sbjct: 299 I 299


>gi|295088037|emb|CBK69560.1| dTDP-4-dehydrorhamnose reductase [Bacteroides xylanisolvens XB1A]
          Length = 288

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 166/292 (56%), Gaps = 12/292 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ LV G NGQ+   +  +  ++ +         ++++   +   ++      ++++N A
Sbjct: 1   MRILVTGANGQLGNEMQVLAKENPQHTYYFTDVEELNICDKQAVWAYIAEKRIELVVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED  E+A+ +N E    +A AA   G   I +STDYVFDG + TP  E    
Sbjct: 61  AYTAVDKAEDNSELAYQLNCEAPKQLASAAQFNGAAMIQVSTDYVFDGTAHTPYTEDCDP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG +KL GE  V +Y    V++RTAW+YS FG+NF+ +M+RL KER  + VV DQ
Sbjct: 121 CPDSVYGTTKLEGEYDVMNYCEKAVVIRTAWLYSTFGNNFVKTMIRLGKERDSLGVVFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +ARAI  I +  I      +RGI+H + + G  SW DF   I   +   G 
Sbjct: 181 IGTPTYANDLARAIYTIINKGI------VRGIYHFSNE-GVCSWYDFTVAIHRLA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              KV  + T +YP KA+RPAYS LD +K+  T +I I  W+E ++  L+ +
Sbjct: 231 TTCKVKPLHTAEYPAKANRPAYSVLDKTKIKTTFDIEIPHWEESLKQCLIKL 282


>gi|288801217|ref|ZP_06406672.1| dTDP-4-dehydrorhamnose reductase [Prevotella sp. oral taxon 299
           str. F0039]
 gi|288331828|gb|EFC70311.1| dTDP-4-dehydrorhamnose reductase [Prevotella sp. oral taxon 299
           str. F0039]
          Length = 284

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 168/286 (58%), Gaps = 12/286 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDV--EIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ LV G+NGQ+   + ++  Q+   +   +   ++D+   K    F +S S D IIN A
Sbjct: 1   MRILVTGSNGQLGSEIVALQAQESHHQWFNLDINELDITDKKAIEQFVMSNSIDGIINCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYT VDKAE++ E+ + +N +    +A+A + +G   I+ISTDYVFDG+S  P  E    
Sbjct: 61  AYTNVDKAEEDIEVCYKVNRDAPQYLAQAIEKVGGFIIHISTDYVFDGISNIPYTEQDNP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           NP+ IYGKSK+AGE+ V +    +VI+RTAWVYS FG NF+ +M++L KE+  + V+ DQ
Sbjct: 121 NPVTIYGKSKIAGEQNVCNSCKRHVIIRTAWVYSSFGKNFVKTMIKLGKEKANLGVIFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            G+PT A  +A+ I  I +  I      + G ++ + + G +SW DF ++I   +     
Sbjct: 181 IGSPTYARDLAKTITTIINQGI------IPGTYNFSNE-GVISWFDFTKHIHQLAKITS- 232

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
              KV  I T  YPT A RP +S LD +K+  T+NI I  W++ + 
Sbjct: 233 --CKVIPIHTADYPTLAKRPHFSVLDKTKIKKTYNIEIPYWRDSLE 276


>gi|109898446|ref|YP_661701.1| dTDP-4-dehydrorhamnose reductase [Pseudoalteromonas atlantica T6c]
 gi|109700727|gb|ABG40647.1| dTDP-4-dehydrorhamnose reductase [Pseudoalteromonas atlantica T6c]
          Length = 286

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 165/293 (56%), Gaps = 10/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK L+ G  GQ+   L +   +  VE+      ++D+   K  A  F S  P+V+IN AA
Sbjct: 1   MKVLITGKKGQLGWELCNRAPEPTVEVFAFDSAELDITDAKKVAEIFSSIQPNVVINCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE +   AF +N EGA  IA     +G   ++ISTD+VFDG   +P       N
Sbjct: 61  YTAVDKAETDEATAFLVNEEGAKNIANGCKEVGARLLHISTDFVFDGTKCSPYIVSDRPN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YG SKLAGE  + S     +I+RTAWVYS  G+NF+ +MLRL +E+ ++ +V DQ 
Sbjct: 121 PLGVYGASKLAGELAIQSMLPEAIIVRTAWVYSSHGNNFVKTMLRLMQEKSQLGIVSDQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           GTPT A  +A  +  +    ++  D  ++G++H T D G  SW DFA  I   + E+G  
Sbjct: 181 GTPTYAAGLADWLWAV----VDKPD--IKGMYHWT-DAGVASWYDFAIAIQELALEKGLL 233

Query: 240 YS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           +    V  I+  QYPT A RPA+S +D +       ++   W++ + N+L N+
Sbjct: 234 HKAISVQPIYAAQYPTPAKRPAFSVVDKTAAEQDSGVQTVHWRKQLSNMLDNL 286


>gi|194290477|ref|YP_002006384.1| tdp-rhamnose synthetase, NAD(P)-binding [Cupriavidus taiwanensis
           LMG 19424]
 gi|193224312|emb|CAQ70323.1| TDP-rhamnose synthetase, NAD(P)-binding [Cupriavidus taiwanensis
           LMG 19424]
          Length = 303

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 118/293 (40%), Positives = 161/293 (54%), Gaps = 7/293 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L+ G+NGQ+   L         ++ +GR   DL +P           PDVIINPAAYTAV
Sbjct: 10  LITGSNGQVGFELRRSLAPLGRVVALGRAGCDLSRPDQIRRVVRECRPDVIINPAAYTAV 69

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE E E+AF+IN   AG +A+ A ++G   ++ STDYVFDG       E  P NP ++
Sbjct: 70  DKAETEAELAFAINGTAAGVLAEEAKALGSLLVHYSTDYVFDGSKDGAYVETDPVNPQSV 129

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YGKSKLAGEE +A+   + ++LRT WV    G NF  +ML+L +ER  + V+ DQFG PT
Sbjct: 130 YGKSKLAGEEAIAAAGGHALVLRTCWVAGAHGGNFAKTMLKLGRERDSLRVIADQFGAPT 189

Query: 184 SALQIARAIIQIA--HNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY- 240
           +A  IA    QI   H L  +  T   G++H+ A  G  +W  +A  +   +A +G    
Sbjct: 190 TASLIADVTAQIVARHWLNGDRRTFASGVYHLAA-AGETTWHAYATEVLRYAAAQGIELK 248

Query: 241 ---SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              S +  I    YP  A RPA S LD  KL  T  I +  W++GV ++L  I
Sbjct: 249 VDPSHIEAIPATAYPLPAPRPANSRLDTGKLRQTFGIHLPDWQQGVHHLLDQI 301


>gi|93115470|gb|ABE98430.1| dTDP-4-dyhydrorhamnose reductase [Escherichia coli]
          Length = 299

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 118/297 (39%), Positives = 165/297 (55%), Gaps = 17/297 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRMALNKPE-----VAGLYHLVAS-GTTTWHDYAALVF-EE 233

Query: 234 AERGG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           A + G     +K+  + T  YPT A RP  S LD  K      + +  WK GV+ +L
Sbjct: 234 ARKAGIALALNKLNAVPTTAYPTPARRPHNSRLDTEKFQQNFALVLPDWKIGVKRML 290


>gi|323948400|gb|EGB44384.1| RmlD substrate binding domain-containing protein [Escherichia coli
           H120]
 gi|324119069|gb|EGC12958.1| RmlD substrate binding domain-containing protein [Escherichia coli
           E1167]
          Length = 299

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  SAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|126464815|ref|YP_001041791.1| dTDP-4-dehydrorhamnose reductase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126106630|gb|ABN79155.1| dTDP-4-dehydrorhamnose reductase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 283

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 125/288 (43%), Positives = 166/288 (57%), Gaps = 13/288 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G  GQ+A+ L+    Q  +   +GR + DL  P+  A       PD  IN AA+TAV
Sbjct: 3   LVFGRTGQVARELAR---QAPDARFLGRDEADLADPEACARAIREAKPDAAINAAAWTAV 59

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D+AE+E   A  +N E  GA+A+A  ++GIP + ISTDYVFDG    P     P  PL  
Sbjct: 60  DRAEEEEAPATVVNGEAPGAMARACAALGIPFVQISTDYVFDGSGTRPWQPGDPVGPLGA 119

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKLAGEE V +    + ILRT+WV+S  G+NF+ +MLRL   R  ++VVCDQ G PT
Sbjct: 120 YGRSKLAGEEAVRAAGGPHAILRTSWVFSAHGANFVKTMLRLGATRDRLTVVCDQVGGPT 179

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGPYSK 242
            A  IA A + +A  L    D  L G +H++  GGP VSWADFA  IF ++         
Sbjct: 180 PAADIAAACLAMARGLAARPD--LSGTYHLS--GGPDVSWADFAREIFRQAEL----DCL 231

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           V  I +  YP KAHRPA S +DCS LA     R   W++G+  +L ++
Sbjct: 232 VADIASADYPQKAHRPANSRMDCSDLARFGLTR-PDWRQGLARVLADL 278


>gi|206561476|ref|YP_002232241.1| dTDP-4-keto-L-rhamnose reductase [Burkholderia cenocepacia J2315]
 gi|198037518|emb|CAR53455.1| dTDP-4-keto-L-rhamnose reductase [Burkholderia cenocepacia J2315]
          Length = 307

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 116/291 (39%), Positives = 162/291 (55%), Gaps = 9/291 (3%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G NGQ+   L        +++   R D+D         F  + +PD++IN AAYTAV
Sbjct: 13  LVTGANGQVGWELVRALQPLGKVVAATRSDVDFADAAAVGRFVETVAPDIVINAAAYTAV 72

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D+AE+EP+ AF++N +   A+A+ A + G   ++ STDYVFDG  + P  E     PLN+
Sbjct: 73  DRAENEPDAAFAVNRDAVRAMARVAAARGSLLVHFSTDYVFDGSKQAPYSESDDIGPLNV 132

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG SKLAGE+ VA    ++++ RT+WVY+  G NFL +MLRL   R  +SVV DQ+G PT
Sbjct: 133 YGASKLAGEQAVADIGGDWLVFRTSWVYASRGQNFLRTMLRLGTSREALSVVNDQYGAPT 192

Query: 184 SALQIARAIIQ-IAHNLIE-NSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY- 240
           SA  IA   +  IA +L E  + T   G++HMTA  G  +W +FAE IF   A R  P  
Sbjct: 193 SARTIADLTVHAIAKSLAERRAGTFESGVYHMTAR-GTTTWHEFAEAIF-TGARRVSPQC 250

Query: 241 ----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
                +V  I   +YPTK  RP YS LD  +      +    W + +  +L
Sbjct: 251 DLAIREVTPIPAAEYPTKTPRPTYSVLDNMRFDERFGLYRPQWVDALALVL 301


>gi|168481240|gb|ACA24735.1| RmlD [Escherichia coli]
          Length = 299

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 167/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E +
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEAN 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRMALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|188578645|ref|YP_001915574.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188523097|gb|ACD61042.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 302

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 158/302 (52%), Gaps = 17/302 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEI---IRVGR-PD------IDLLKPKDFASFFLSFS 50
           M  LV G NGQ+   L      D  +    R G+ PD       D   P+   +      
Sbjct: 1   MTTLVFGANGQVGTELLRALAVDGAVQATTRSGQLPDGSACETADFDAPETLTALLDRIK 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           P  ++N AAYTAVD+AE + E A   NA   G +A    S  +P ++ STDYVFDG    
Sbjct: 61  PSRVVNAAAYTAVDRAEQDRERATRANATAPGVVAAWCASNRVPLVHYSTDYVFDGQGAA 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P  E + T+PL +YG++KLAGE+ + +    ++ILRTAWVY+  G+NFL +MLR+  ER 
Sbjct: 121 PYRENAQTSPLGVYGETKLAGEQAIRASGAQHLILRTAWVYASHGANFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
           E+ VV DQ GTPT A  IA    Q+        DTS  G +H+TA  G  SW  FAE IF
Sbjct: 181 ELRVVADQIGTPTPAALIADVTAQLLRQ--RTPDTS--GTWHLTA-AGQTSWHGFAEAIF 235

Query: 231 WESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
            E+   G      +V  I T  YPT A RPAYS L    L     I +  W+ G++ ++ 
Sbjct: 236 EEAVSAGLLERAPRVVPITTADYPTPARRPAYSRLSIDTLQGDFGIELPEWRVGLQRVIA 295

Query: 289 NI 290
            +
Sbjct: 296 EL 297


>gi|84622380|ref|YP_449752.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|84366320|dbj|BAE67478.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 302

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 158/302 (52%), Gaps = 17/302 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEI---IRVGR-PD------IDLLKPKDFASFFLSFS 50
           M  LV G NGQ+   L      D  +    R G+ PD       D   P+   +      
Sbjct: 1   MTTLVFGANGQVGTELLRALAVDGAVQATTRSGQLPDGSACETADFDAPETLTALLDRIK 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           P  ++N AAYTAVD+AE + E A   NA   G +A    S  +P ++ STDYVFDG    
Sbjct: 61  PSRVVNAAAYTAVDRAEQDRERATRANATAPGVVAAWCASNRVPLVHYSTDYVFDGQGAA 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P  E + T+PL +YG++KLAGE+ + +    ++ILRTAWVY+  G+NFL +MLR+  ER 
Sbjct: 121 PYRENAQTSPLGVYGETKLAGEQAIRASGAQHLILRTAWVYASHGANFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
           E+ VV DQ GTPT A  IA    Q+        DTS  G +H+TA  G  SW  FAE IF
Sbjct: 181 ELRVVADQIGTPTPAALIADVTAQLLRQ--RTPDTS--GTWHLTA-AGQTSWHGFAEAIF 235

Query: 231 WESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
            E+   G      +V  I T  YPT A RPAYS L    L     I +  W+ G++ ++ 
Sbjct: 236 EEAVSAGLLERAPRVVPITTADYPTPARRPAYSRLSIDTLQGDFGIELPEWRVGLQRVIA 295

Query: 289 NI 290
            +
Sbjct: 296 EL 297


>gi|203285009|gb|ACH97128.1| RmlD [Escherichia coli]
          Length = 299

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRMALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLKAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|299067779|emb|CBJ38989.1| TDP-rhamnose synthetase, NAD(P)-binding [Ralstonia solanacearum
           CMR15]
          Length = 305

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 112/295 (37%), Positives = 156/295 (52%), Gaps = 7/295 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K LV G+NGQ+   L        E+I + R   DL +P           PDVI+NPAAYT
Sbjct: 10  KLLVTGSNGQVGFELRRSLAPLGEVIALDRSACDLTQPDALRRLVREHRPDVIVNPAAYT 69

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE + E AF++N   AG +A+ A ++G   ++ STDYVFDG       E    NP 
Sbjct: 70  AVDKAETDAETAFAVNGTAAGVLAEEARALGSLLVHYSTDYVFDGSKPAAYVETDAVNPQ 129

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YGKSKLAGE+ +A+     ++LRT WV    G NF  +ML+L +ER  + V+ DQFG 
Sbjct: 130 SVYGKSKLAGEQAIAASGAAALVLRTCWVAGAHGGNFAKTMLKLGRERDSLRVIADQFGA 189

Query: 182 PTSALQIARAIIQIAHNLIENSDTSL--RGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PT+A  IA    QI      + D +    G++H+ A  G  +W  +A  +   +  RG  
Sbjct: 190 PTTAALIADVTAQIVARFWLSGDRAAFPGGLYHLAA-AGETTWHGYATAVLRYAKARGVE 248

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                 ++  I    YP  A RPA S +D  KL  T  I +  W++GV  +L  I
Sbjct: 249 LKVDPERIEAIPATAYPLPAPRPANSRMDTGKLTETFGIHLPDWQQGVHLLLDQI 303


>gi|281179139|dbj|BAI55469.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Escherichia coli SE15]
          Length = 299

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 162/294 (55%), Gaps = 11/294 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQKHCAKHIIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          ++  + +  G++H+ A GG  +W D+A  +F E A +
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVAVDKPEVA--GLYHLVA-GGTTTWHDYAALVF-EEARK 236

Query: 237 GG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            G     +K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 237 AGINLALNKLNSVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|56413000|ref|YP_150075.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197361928|ref|YP_002141565.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|56127257|gb|AAV76763.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093405|emb|CAR58860.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 299

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 118/299 (39%), Positives = 168/299 (56%), Gaps = 15/299 (5%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+ IG   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANEIGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      Y+I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ATSPLNVYGKTKLAGEKALQDNCPKYLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQ+G PT A  +A      I++A N  E     + G++H+ A GG  +W D+A  +F E+
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVA-GGTTTWHDYAALVFDEA 234

Query: 234 AERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            + G     +++  + T  YPT A RP  S L+  K      + +  W+ GV+ +L  +
Sbjct: 235 RKAGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFGLILPQWELGVKRMLTEM 293


>gi|192359580|ref|YP_001983890.1| dTDP-4-dehydrorhamnose reductase [Cellvibrio japonicus Ueda107]
 gi|190685745|gb|ACE83423.1| dTDP-4-dehydrorhamnose reductase [Cellvibrio japonicus Ueda107]
          Length = 293

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 158/292 (54%), Gaps = 10/292 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQD-VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G NGQ+   L    + + +    V R  +D+            + P+++IN AA
Sbjct: 1   MKILVTGANGQVGHCLHQQLINNSMSFKAVTRKQLDITDVSAVERSLKEYQPNIVINAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE + E AF IN +G   +A  + +IG    +ISTDYVF G +  P  E   T+
Sbjct: 61  YTAVDKAESDQENAFRINRDGVANLASVSSAIGAAIFHISTDYVFAGNNDHPYREDDDTS 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P  IYG+SKLAGE  V      ++ILRTAWV+   G+NF+ +M+RL + R  + +V DQ 
Sbjct: 121 PQGIYGQSKLAGEIAVIQTNPKHIILRTAWVFGEHGNNFVKTMIRLGRTRDSLGIVADQH 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGG 238
           G PT A  IA A+I+IAH  I+  D    G +H    G P  +W +FA  IF +  E   
Sbjct: 181 GGPTHAGDIATALIRIAHQYIKTGDLPW-GTYHYA--GMPHTNWYEFARAIF-KQVEAEN 236

Query: 239 PYSK----VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
            Y K    +  I T  YPT A RPA S LDC+K+     I  S W+  + NI
Sbjct: 237 LYDKATPSLNAIATADYPTPAKRPANSRLDCTKIQTNFGIAPSDWQAALNNI 288


>gi|312960468|ref|ZP_07774977.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas fluorescens WH6]
 gi|311285353|gb|EFQ63925.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas fluorescens WH6]
          Length = 297

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 107/294 (36%), Positives = 166/294 (56%), Gaps = 8/294 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ +V G  GQ+ + L         +I  G  ++D+              P ++IN AAY
Sbjct: 1   MRVIVTGAQGQVGRELLLRAPSGFNVIGYGSGELDISDSVQVEEVLARIKPQLLINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE + E A+++N +G   +A+AA + GI  ++ISTDYVFDG    P      T P
Sbjct: 61  TAVDKAESDIERAYAVNRDGVAHLARAAQAQGIAVLHISTDYVFDGNHTLPYTPADVTAP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
             +YG SKLAGE+++  + + +VILRT+WV+   G+NF+ +MLRL +ER E++VV DQ G
Sbjct: 121 SGVYGSSKLAGEQQLQQHCSRHVILRTSWVFGAHGNNFVKTMLRLGRERDELAVVADQRG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLR-GIFHMTADGGPV-SWADFAEYIFWESAERG- 237
            PTSA  IA  +  +A   I   D  L+ G++H +  G P  +W DFA+ IF ++     
Sbjct: 181 CPTSAGSIADTLWALA--TIFRRDGMLKWGVYHYS--GAPACTWYDFADEIFNQARSEAL 236

Query: 238 -GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                ++  I + ++PT+A RP +S LDC  L   + +   +WK  ++ +L  +
Sbjct: 237 LEKKPRLKAITSAEFPTQAKRPGWSVLDCQTLEQDYGVSTRSWKVELQQVLQQL 290


>gi|218699368|ref|YP_002406997.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli IAI39]
 gi|253773028|ref|YP_003035859.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162032|ref|YP_003045140.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli B str. REL606]
 gi|297520373|ref|ZP_06938759.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli OP50]
 gi|306814836|ref|ZP_07448998.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli NC101]
 gi|218369354|emb|CAR17112.1| dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of
           dTDP-L-rhamnose synthase [Escherichia coli IAI39]
 gi|224613065|dbj|BAH24284.1| dTDP-4-dehydrorhamnose reductase subunit [Escherichia coli B]
 gi|242377692|emb|CAQ32452.1| dTDP-4-dehydrorhamnose reductase, subunit of dTDP-L-rhamnose
           synthetase [Escherichia coli BL21(DE3)]
 gi|253324072|gb|ACT28674.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973933|gb|ACT39604.1| dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of
           dTDP-L-rhamnose synthase [Escherichia coli B str.
           REL606]
 gi|253978127|gb|ACT43797.1| dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of
           dTDP-L-rhamnose synthase [Escherichia coli BL21(DE3)]
 gi|305852230|gb|EFM52682.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli NC101]
          Length = 299

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 162/294 (55%), Gaps = 11/294 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQKHCAKHIIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          ++  + +  G++H+ A GG  +W D+A  +F E A +
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVAVDKPEVA--GLYHLVA-GGTTTWHDYAALVF-EEARK 236

Query: 237 GG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            G     +K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 237 AGINLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|86144026|ref|ZP_01062364.1| putative dTDP-4-dehydrorhamnose reductase [Leeuwenhoekiella
           blandensis MED217]
 gi|85829486|gb|EAQ47950.1| putative dTDP-4-dehydrorhamnose reductase [Leeuwenhoekiella
           blandensis MED217]
          Length = 289

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 166/291 (57%), Gaps = 12/291 (4%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           + LV G+NGQ+ Q L  +     D+    V R + DL   +   ++    +PD +IN AA
Sbjct: 4   RILVTGSNGQLGQELQVLASTYPDMLFDFVTREEFDLEDEEQLLTYLNKTTPDYVINCAA 63

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE EPE A  INA     +A  +       ++ISTDYVFDG S  P  E + TN
Sbjct: 64  YTAVDKAESEPEKATQINAHAVRLLANWSAEHHAKLVHISTDYVFDGSSSIPYTETAVTN 123

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P ++YG +KL GE+   +     +I+RTAWVYS+FG+NF+ +MLRL +ER  +++V DQ 
Sbjct: 124 PQSVYGSTKLEGEQAALASNPEVLIIRTAWVYSVFGNNFVKTMLRLMQERDSLNIVKDQI 183

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT A  +A+AI++I  +    S     GI+H + + G +SW +FA+ I     E  G 
Sbjct: 184 GSPTYAADLAQAILKILASAHWES-----GIYHYS-NAGRISWYEFAQAI----KEVAGL 233

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              +  I T  YPT A RPAYS L+  K+   + + +  +KE +   L ++
Sbjct: 234 ACDLDGIPTSAYPTPAKRPAYSLLNTQKIQQVYKVAVPDYKESLTMCLQHL 284


>gi|260856023|ref|YP_003229914.1| putative dTDP-6-deoxy-L-mannose-dehydrogenase [Escherichia coli
           O26:H11 str. 11368]
 gi|24417731|gb|AAN60455.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Escherichia coli]
 gi|56800697|gb|AAW31111.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Escherichia coli]
 gi|77737730|gb|ABB01682.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Escherichia coli]
 gi|257754672|dbj|BAI26174.1| predicted dTDP-6-deoxy-L-mannose-dehydrogenase [Escherichia coli
           O26:H11 str. 11368]
 gi|323152430|gb|EFZ38718.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli EPECa14]
          Length = 299

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWLIHYSTDYVFPGNGDMPWRETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  Y   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEYCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQKFALVLPDWQVGVKRML 290


>gi|293415328|ref|ZP_06657971.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli B185]
 gi|291432976|gb|EFF05955.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli B185]
          Length = 299

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVGSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRMALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTSAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|168481328|gb|ACA24815.1| RmlD [Escherichia coli]
          Length = 299

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 163/293 (55%), Gaps = 9/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          ++  + +  G++H+ A  G  +W D+A  +F E+ + 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVAS-GTTTWHDYAALVFEEARKA 237

Query: 237 GGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 238 GIPLALNKLNAVPTSAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|308272532|emb|CBX29136.1| hypothetical protein N47_J01170 [uncultured Desulfobacterium sp.]
          Length = 294

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 109/290 (37%), Positives = 160/290 (55%), Gaps = 12/290 (4%)

Query: 1   MKCLVIGNNGQIA-QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK L+ G+ GQ+  + L        E I    P ID+    D      +  PD++IN A 
Sbjct: 1   MKILITGSQGQLGWELLREAKSYGFETIGFDLPQIDITIKPDVEKVINNIRPDIVINAAG 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VD+AEDE E+ F+ N  G G IA   +++ IP I+ISTDYVFDG   TP  E    +
Sbjct: 61  YTNVDRAEDEREVCFAANCTGPGNIAAVCNNLDIPMIHISTDYVFDGRKNTPYTEKDIIS 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+N YGK K  G+  V+     ++I+RT+W+Y I  +NF+ ++LRL KE+  + VV DQ+
Sbjct: 121 PINAYGKCKAEGDNAVSDVLQKHIIIRTSWLYGIHCNNFVKTILRLGKEKEVLEVVSDQY 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT    +A A++ I+ + I+N+   + GI++     G  +W  FAE I     E  G 
Sbjct: 181 GSPTFVTDLADAVLTISSH-IKNNSGDIWGIYNYCG-AGVTTWHGFAEKII----EEAGK 234

Query: 240 YSKVYRIF-----TKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           Y  +  I      +K+YP KA RP+YS LDCS +     I    W+E ++
Sbjct: 235 YLDIKTILVKPITSKEYPAKAGRPSYSALDCSLINRQFGIVSKPWQESLK 284


>gi|78049262|ref|YP_365437.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78037692|emb|CAJ25437.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 273

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/255 (42%), Positives = 143/255 (56%), Gaps = 8/255 (3%)

Query: 35  DLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIP 94
           D   P+          P  ++N AAYTAVD+AE E + AF  NAE    IA+     G+P
Sbjct: 19  DFDAPETLPGLLDRLQPSCVVNAAAYTAVDRAEQERDAAFRANAEAPAVIAQWCARAGVP 78

Query: 95  CIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIF 154
            ++ STDYVFDG    P      T PL +YG+SKLAGE+ V +    ++I RTAWVY+  
Sbjct: 79  LVHYSTDYVFDGQGTHPYRPDDATAPLGVYGQSKLAGEQAVQAAGGRHLIFRTAWVYAAH 138

Query: 155 GSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMT 214
           G NFL +MLR+  ER  + VV DQ GTPT A  IA      AH L +  + S  G++H+T
Sbjct: 139 GHNFLRTMLRVGAERDVLRVVADQIGTPTPAALIADI---TAHALRQPGEPS--GLWHLT 193

Query: 215 ADGGPVSWADFAEYIFWESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTH 272
           A  G  +W  FAE IF ++  RG      +V  I T  YPT A RPAYS LD   L +T 
Sbjct: 194 A-AGQTTWHGFAEAIFAQARARGLLARAPRVEAISTADYPTPATRPAYSRLDIHSLQDTF 252

Query: 273 NIRISTWKEGVRNIL 287
            +R+  W++G+  +L
Sbjct: 253 GVRLPDWQDGLSQVL 267


>gi|17545402|ref|NP_518804.1| dTDP-4-dehydrorhamnose reductase oxidoreductase [Ralstonia
           solanacearum GMI1000]
 gi|17427694|emb|CAD14213.1| probable dtdp-4-dehydrorhamnose reductase oxidoreductase protein
           [Ralstonia solanacearum GMI1000]
          Length = 305

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 112/295 (37%), Positives = 156/295 (52%), Gaps = 7/295 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K LV G+NGQ+   L        E+I + R   DL +P           PDVI+NPAAYT
Sbjct: 10  KLLVTGSNGQVGFELRRSLAPLGEVIALDRAACDLTRPDALRRLVREHRPDVIVNPAAYT 69

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE + E AF++N   AG +A+ A ++G   ++ STDYVFDG       E    NP 
Sbjct: 70  AVDKAETDAETAFAVNGMAAGVLAEEARALGSLLVHYSTDYVFDGSKAAAYVETDAVNPQ 129

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YGKSKLAGE+ +A+     ++LRT WV    G NF  +ML+L +ER  + V+ DQFG 
Sbjct: 130 SVYGKSKLAGEQAIAASGAAALVLRTCWVAGAHGGNFAKTMLKLGRERDSLRVIADQFGA 189

Query: 182 PTSALQIARAIIQIAHNLIENSDTSL--RGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PT+A  IA    QI      + D +    G++H+ A  G  +W  +A  +   +  RG  
Sbjct: 190 PTTAALIADVTAQIVARFWLSGDRAAFPGGLYHLAA-AGETTWHGYATAVLRYAKVRGLE 248

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                 ++  I    YP  A RPA S +D  KL  T  I +  W++GV  +L  I
Sbjct: 249 LKVDPERIEAIPATAYPLPAPRPANSRMDTGKLTETFGIHLPDWQQGVHLLLDQI 303


>gi|113868863|ref|YP_727352.1| dTDP-4-dehydrorhamnose reductase [Ralstonia eutropha H16]
 gi|113527639|emb|CAJ93984.1| dTDP-4-dehydrorhamnose reductase [Ralstonia eutropha H16]
          Length = 311

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 119/298 (39%), Positives = 157/298 (52%), Gaps = 16/298 (5%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L+ G+NGQ+   L         I+ + R   DL  P           PD I+N AAYTAV
Sbjct: 11  LLTGSNGQVGFELRRSLAPLGRIVALDRSACDLADPAQIRRAIRQSRPDAIVNAAAYTAV 70

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE E ++AF+INA     +A+ A  +G   ++ STDYVFDG       E  P NPL+ 
Sbjct: 71  DKAETEADLAFAINATAVAVMAEEARRLGTLLVHYSTDYVFDGRKDGLYLETDPVNPLSE 130

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YGKSK+AGEE + +     +ILRT+WV    G NF  ++L LA+ERRE+ V  DQ G PT
Sbjct: 131 YGKSKVAGEESILAAGVASLILRTSWVAGAHGKNFATTILGLARERRELRVAADQHGAPT 190

Query: 184 SALQIARAIIQI--AHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           SA  IA    QI   H L  N DT   GI+H+ A  G  +W  +A  +   +A  G    
Sbjct: 191 SASLIADVTAQILARHWLFSNRDTFPAGIYHLAAS-GETTWHAYATEVLRHAASHG---- 245

Query: 242 KVYRI---------FTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            V +I           + Y   A RPA S LD +KL  T  I + +W+EGVR++L  I
Sbjct: 246 VVLKIRPEDIQGIPAAEYYSAAAPRPANSRLDTTKLRKTFGIHLPSWEEGVRHLLDQI 303


>gi|16129980|ref|NP_416544.1| dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of
           dTDP-L-rhamnose synthase [Escherichia coli str. K-12
           substr. MG1655]
 gi|89108860|ref|AP_002640.1| dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of
           dTDP-L-rhamnose synthase [Escherichia coli str. K-12
           substr. W3110]
 gi|170081670|ref|YP_001730990.1| dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of
           dTDP-L-rhamnose synthase [Escherichia coli str. K-12
           substr. DH10B]
 gi|238901230|ref|YP_002927026.1| dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of
           dTDP-L-rhamnose synthase [Escherichia coli BW2952]
 gi|2507299|sp|P37760|RMLD_ECOLI RecName: Full=dTDP-4-dehydrorhamnose reductase; AltName:
           Full=dTDP-4-keto-L-rhamnose reductase; AltName:
           Full=dTDP-6-deoxy-L-lyxo-4-hexulose reductase; AltName:
           Full=dTDP-6-deoxy-L-mannose dehydrogenase; AltName:
           Full=dTDP-L-rhamnose synthase
 gi|1736730|dbj|BAA15882.1| dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of
           dTDP-L-rhamnose synthase [Escherichia coli str. K12
           substr. W3110]
 gi|1788352|gb|AAC75101.1| dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of
           dTDP-L-rhamnose synthase [Escherichia coli str. K-12
           substr. MG1655]
 gi|2665490|gb|AAB88399.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Escherichia coli]
 gi|169889505|gb|ACB03212.1| dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of
           dTDP-L-rhamnose synthase [Escherichia coli str. K-12
           substr. DH10B]
 gi|238861012|gb|ACR63010.1| dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of
           dTDP-L-rhamnose synthase [Escherichia coli BW2952]
          Length = 299

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 116/293 (39%), Positives = 160/293 (54%), Gaps = 9/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L         +I   V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIAFDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  INA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLINATSVEAIAKAANEVGAWVIHYSTDYVFPGNGDMPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  Y   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEYCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          +   D +  G++H+ A  G  +W D+A  +F E+ + 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPDVA--GLYHLVAS-GTTTWYDYAALVFEEARKA 237

Query: 237 GGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 238 GIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|16588695|gb|AAL26873.1|AF315583_2 dTDP-rhamnose synthetase [Acinetobacter calcoaceticus]
          Length = 297

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 112/298 (37%), Positives = 165/298 (55%), Gaps = 12/298 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI-----DLLKPKDFASFFLSFSPDVII 55
           MK L++G NGQ+   L        E+I + R  +     D+ +P+  +   L+  PDV++
Sbjct: 1   MKILLLGKNGQVGWELQRALAPLGEVIALDRHGLNGLSGDMTQPQAISDTILAVQPDVVV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N +AYTAVD AE E E+A  +N +   A+AKA   +    ++ STDYVFDG+  T   E 
Sbjct: 61  NASAYTAVDLAETERELADVVNHQTVMAVAKACQHVNALFVHYSTDYVFDGVGETAFVET 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
               PLN+YGK+K  GE+ +      Y+I RT+WVY+  G NFL +ML LA++R E+S++
Sbjct: 121 DAIAPLNVYGKTKALGEQAIVQSGCQYLIFRTSWVYASKGKNFLKTMLGLAQQREELSII 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIEN-SDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
            DQ G PTSA  IA      AH + +  +D S  G +H+ A  G  SW  +A ++F +  
Sbjct: 181 ADQIGAPTSAELIADV---TAHAIPQTLTDKSKVGTYHLVAS-GETSWFGYASFVFEQVR 236

Query: 235 ERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             G   +   V  I T  YPT A RP  S L+  K+ +T  I +  W++GV+  LV +
Sbjct: 237 AFGQALTIQNVNAIPTSAYPTPATRPHNSRLNNQKIQHTFGILLPNWQDGVKRALVEL 294


>gi|332525496|ref|ZP_08401654.1| dTDP-4-dehydrorhamnose reductase [Rubrivivax benzoatilyticus JA2]
 gi|332108763|gb|EGJ09987.1| dTDP-4-dehydrorhamnose reductase [Rubrivivax benzoatilyticus JA2]
          Length = 299

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 115/297 (38%), Positives = 165/297 (55%), Gaps = 12/297 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGR-PDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK +++G  GQ+   L         ++ + R    D  +P+   +   +  PDVI+N AA
Sbjct: 1   MKLMLLGCGGQLGWELQRALAPLGTLVALDRDTGADFSRPETLPALLDTHRPDVIVNAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           +TAVD+AE EPE+A +INAE  G +A+ A + G   ++ STDYVFDG       E +PT 
Sbjct: 61  HTAVDRAESEPELARTINAEAPGLLAREAAARGAWLVHYSTDYVFDGSGTHARAEDAPTG 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL++YG++KL GEE+V +    ++ILRT+WVY+  G+NF  +ML+LA ER ++ VV DQ 
Sbjct: 121 PLSVYGRTKLEGEEQVRASGCRHLILRTSWVYAARGANFAKTMLKLAAEREKLRVVADQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDT-SLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
           G PT A  +A      AH L +   T SL G +H  A GG  SW  +A  +  E A   G
Sbjct: 181 GAPTGADLLADV---SAHALRQAMATPSLAGTYHCVA-GGETSWHGYARLVV-EHARAAG 235

Query: 239 PYSKVY-----RIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              ++       + T  YPT A RP  S LD S L     + +  W++GVR +L  I
Sbjct: 236 HTLRITPDAIEPVPTSDYPTPARRPLNSRLDTSALRERFGLHLPPWQDGVRRMLDEI 292


>gi|171319431|ref|ZP_02908537.1| dTDP-4-dehydrorhamnose reductase [Burkholderia ambifaria MEX-5]
 gi|171095360|gb|EDT40339.1| dTDP-4-dehydrorhamnose reductase [Burkholderia ambifaria MEX-5]
          Length = 307

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 119/292 (40%), Positives = 162/292 (55%), Gaps = 9/292 (3%)

Query: 3   CLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
            LV G NGQ+   L         ++   R ++DL  P     F     PD+++N AAYTA
Sbjct: 12  ILVTGANGQVGWELVRALQPLGRVVAATRRNVDLQDPVAVGLFIEKVEPDIVVNAAAYTA 71

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VD+AED+   AF++N +   ++A AA + G   I+ STDYVFDG  +TP  E    +PLN
Sbjct: 72  VDRAEDDVVTAFAVNRDAVASLASAAAARGSLLIHFSTDYVFDGSKQTPYSESDGVHPLN 131

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YG SKLAGE+ +A    ++++ RT+WVY   G NFL +MLRL   R  +SVV DQ+G P
Sbjct: 132 VYGASKLAGEQAIADIGGDWLVFRTSWVYGARGQNFLRTMLRLGASREVLSVVNDQYGAP 191

Query: 183 TSALQIARAIIQ-IAHNLIE-NSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TSA  IA      IA  L E  + T   GI+HMTA  G  +W  FAE IF + A    P 
Sbjct: 192 TSARTIADLTAHAIAKALAERQAGTFESGIYHMTAR-GMTTWHAFAEAIF-DGARHLSPQ 249

Query: 241 S-----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           S     +V  I   +YPTK  RPAYS LD ++      +R   W++ +  +L
Sbjct: 250 SELAIRQVNPIPAAEYPTKTPRPAYSVLDNARFDARFRLRRPEWRDALALVL 301


>gi|320352682|ref|YP_004194021.1| dTDP-4-dehydrorhamnose reductase [Desulfobulbus propionicus DSM
           2032]
 gi|320121184|gb|ADW16730.1| dTDP-4-dehydrorhamnose reductase [Desulfobulbus propionicus DSM
           2032]
          Length = 295

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 159/296 (53%), Gaps = 8/296 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G NGQ+   L         +  V + D DL   +   S   S  PD+I++PAAY
Sbjct: 1   MRILLTGKNGQVGFELQRALAPLGTLTAVDQTDCDLTDQQAIRSLVRSIQPDIIVHPAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE E ++A +IN    G + + A  IG   ++  TDYV DG  +    E  P NP
Sbjct: 61  TAVDRAEAESDLAMAINGTAPGILGEEAARIGALVVHYCTDYVHDGTKQGFHTENDPPNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YG SKLAG + +   TN ++I RT WV+   G+NF+ +ML+LA ER  ++VV DQFG
Sbjct: 121 RNVYGASKLAGTKSLCQKTNKHLIFRTCWVFGAHGANFVKTMLKLAGERETLNVVADQFG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLR-GIFHMTADGGPVSWADFAEYIFWESAERG-- 237
            PTSA  IA    Q+        +     G++H+ A  G  +W +FA+ +   S   G  
Sbjct: 181 APTSASLIADITAQVIGQYQRTEEKHFPFGLYHLAA-AGVTTWHEFAQTVVAASLRAGMG 239

Query: 238 ---GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
               P S +  I T QYP  A RPA S L   KL +T ++ +  W++G+ ++L  I
Sbjct: 240 LKLTPQS-IRPITTAQYPLPARRPANSRLATDKLRDTFSLHLPPWQDGLSHVLQQI 294


>gi|218460817|ref|ZP_03500908.1| dTDP-4-dehydrorhamnose reductase protein [Rhizobium etli Kim 5]
          Length = 206

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/200 (55%), Positives = 141/200 (70%), Gaps = 1/200 (0%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+  V G  GQ+ QSL     +  VEII VGRP++DL  P   A+ F +  PDVI++ AA
Sbjct: 1   MRIAVTGKQGQVVQSLLRRGAETGVEIIAVGRPEMDLSDPARIAAAFSALRPDVIVSAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE E E+AFS+NA GAGA+A+AA  IG+P I+ISTDYVF G   +   E   T 
Sbjct: 61  YTAVDKAESEAELAFSVNAAGAGAVAEAAARIGVPVIHISTDYVFSGDKASAYCEEDATG 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+++YG+SKLAGE+ VA+   N+VILRTAWVYS FG+NFL +MLRL++ R  + VV DQ 
Sbjct: 121 PISVYGRSKLAGEKAVAAANPNHVILRTAWVYSPFGANFLKTMLRLSETRDHLRVVADQR 180

Query: 180 GTPTSALQIARAIIQIAHNL 199
           G PTSAL IA AI+ IA  +
Sbjct: 181 GCPTSALDIADAILAIATRI 200


>gi|33637051|gb|AAQ23688.1| dTDP-4-dehydrorhamnose reductase [Geobacillus stearothermophilus]
          Length = 286

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/287 (38%), Positives = 164/287 (57%), Gaps = 13/287 (4%)

Query: 2   KCLVIGNNGQI-AQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           K LV G  GQ+ A+ +  +   + E+   GR ++D+   +   S      P+V+I+ AAY
Sbjct: 5   KILVTGAKGQLGAEMVKLLKDMEYEVYGYGRAELDITDFQQVKSVIDHIHPNVVIHAAAY 64

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD AE EP+ AF +NA G   +  A++ IG   +YISTDYVFDG +  P +EF+ T+P
Sbjct: 65  TNVDAAESEPDQAFFVNAYGTRNVVVASEHIGAKFVYISTDYVFDGTANAPYNEFAFTSP 124

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +++YGKSKLAGE+ V    + + I+RT+WVY   G+NF+ +ML+LA+E++E+ VV DQ G
Sbjct: 125 ISVYGKSKLAGEQFVRDLHSKFFIIRTSWVYGKHGNNFVKTMLKLAQEQKELFVVDDQIG 184

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT  + +A  I Q+ H       T   G++H++ + G  SW +FA+ IF    E     
Sbjct: 185 CPTYTVDLASCIFQLIH-------TEKYGVYHIS-NSGHCSWYEFAKAIF----EEANVN 232

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             V    TK YP  A RP YS LD   L       +  W+E ++  +
Sbjct: 233 IVVNPCKTKDYPRPAQRPLYSVLDHMALRLNGFKELRHWREALKEFI 279


>gi|91211324|ref|YP_541310.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli UTI89]
 gi|300986907|ref|ZP_07177885.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli MS 45-1]
 gi|91072898|gb|ABE07779.1| dTDP-4-dehydrorhamnose reductase, subunit of dTDP-L-rhamnose
           synthetase [Escherichia coli UTI89]
 gi|288816224|gb|ADC54946.1| RmlD [Escherichia coli]
 gi|294490643|gb|ADE89399.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli IHE3034]
 gi|300407836|gb|EFJ91374.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli MS 45-1]
 gi|307626416|gb|ADN70720.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli UM146]
 gi|315295250|gb|EFU54585.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli MS 153-1]
          Length = 299

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEED 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTVYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|260173433|ref|ZP_05759845.1| putative dTDP-4-dehydrorhamnose reductase [Bacteroides sp. D2]
          Length = 286

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 164/289 (56%), Gaps = 12/289 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ LV G NGQ+   +  +  ++ +         ++++   +   ++      ++++N A
Sbjct: 1   MRILVTGANGQLGNEMQVLAKENPQHTYYFTDVEELNICDKQAVWAYIAEKRIELVVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED  E+A+ +N E    +A AA   G   I +STDYVFDG + TP  E    
Sbjct: 61  AYTAVDKAEDNSELAYQLNCEAPKQLASAAQFNGAAMIQVSTDYVFDGTAHTPYTEDCDP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG +KL GE  V +Y    V++RTAW+YSIFG+NF+ +M+RL KER  + VV DQ
Sbjct: 121 CPDSVYGTTKLEGEYDVMNYCEKAVVIRTAWLYSIFGNNFVKTMIRLGKERDSLGVVFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +ARAI  I +  I      +RGI+H + + G  SW DF   I   +   G 
Sbjct: 181 IGTPTYANDLARAIYTIINKGI------VRGIYHFSNE-GVCSWYDFTVAIHRLA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              KV  + T +YP KA+RPAYS LD +K+  T  I I  W+E ++  L
Sbjct: 231 TSCKVKPLHTAEYPAKANRPAYSVLDKTKIKTTFGIEIPHWEESLQRCL 279


>gi|323968174|gb|EGB63583.1| RmlD substrate binding domain-containing protein [Escherichia coli
           M863]
 gi|327253172|gb|EGE64826.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli STEC_7v]
          Length = 299

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGSWVIHYSTDYVFPGTGEIPWQEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCVKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|63054927|gb|AAY29004.1| dTDP-4-dehydrorhamnose reductase [Stenotrophomonas maltophilia]
          Length = 299

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 117/302 (38%), Positives = 156/302 (51%), Gaps = 18/302 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI----------DLLKPKDFASFFLSFS 50
           M  L+ G NGQ+ Q L         I+   R             D   P    +      
Sbjct: 1   MTVLLFGANGQVGQELLRSLAPLGSIVATTRSGTLANGVPCEVADFDNPGSLVALLDRVH 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           PD ++N AAYTAVD+AE + E A+  NAE  G IA+   + G+P ++ STDYVFDG    
Sbjct: 61  PDTVVNAAAYTAVDRAEQDREAAWRTNAESPGVIARWCAAAGVPLVHFSTDYVFDGQGTR 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P  E  PT PL +YG+SKLAGE  +      ++I RTAWVY+   +NFL +MLR+  ER 
Sbjct: 121 PYRESDPTGPLGVYGESKLAGEIAIREAGGRHLIFRTAWVYAPHSANFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
            + VV DQ GTPT A     A+I     L       L G +H+TA  G  SW  FAE IF
Sbjct: 181 LLRVVADQVGTPTPA-----ALIADVTALALQHPGQLSGTWHLTAT-GEASWHGFAEAIF 234

Query: 231 WESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             +  RG      +V  I T  YPT A RPAYS LD ++L +   I + TW++G+  ++ 
Sbjct: 235 AAAVARGVLPRAPRVEAITTADYPTPARRPAYSHLDVTRLQSDFGIDLPTWQDGLAQVMA 294

Query: 289 NI 290
            +
Sbjct: 295 QL 296


>gi|21230099|ref|NP_636016.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769910|ref|YP_244672.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21111626|gb|AAM39940.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575242|gb|AAY50652.1| dTDP-4-dehydrorhamnose reductase [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 302

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 117/304 (38%), Positives = 157/304 (51%), Gaps = 21/304 (6%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEI---IRVGR-PD------IDLLKPKDFASFFLSFS 50
           M  LV G NGQ+   L      D  +    R GR PD       D   P+   +      
Sbjct: 1   MTTLVFGANGQVGAELLRALAADGAVQATTRSGRLPDGSACETADFDAPETLPALLDQIG 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           P +++N AAYTAVD+AE +   A   NA+    IA    +  +P ++ STDYVFDG    
Sbjct: 61  PSLVVNAAAYTAVDRAEQDRVSAMRANAQAPLTIAAWCAARDVPLVHYSTDYVFDGQGTA 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P  E + T+PL +YG++KLAGE  + +    ++ILRTAWVY+  G NFL +MLR+  ER 
Sbjct: 121 PYLEDAQTSPLGVYGETKLAGENAIRASGAQHLILRTAWVYASHGGNFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
           E+ VV DQ GTPT A  IA     I   L+        G +H+TA  G  SW  FAE IF
Sbjct: 181 ELRVVADQIGTPTPAALIA----DITAQLLRQRTAETSGTWHLTA-AGQTSWHGFAEAIF 235

Query: 231 WESAERG----GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
            E+   G     P  +V  I T  YPT A RPAYS L   KL    +I +  W+ G++ +
Sbjct: 236 EEAVSAGLLPRAP--RVVPITTADYPTPAKRPAYSRLSIEKLQRDFDIVLPEWRPGLQRV 293

Query: 287 LVNI 290
           +  +
Sbjct: 294 IAEV 297


>gi|237713729|ref|ZP_04544210.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262409365|ref|ZP_06085908.1| dTDP-4-dehydrorhamnose reductase [Bacteroides sp. 2_1_22]
 gi|293371466|ref|ZP_06617889.1| dTDP-4-dehydrorhamnose reductase [Bacteroides ovatus SD CMC 3f]
 gi|298482894|ref|ZP_07001076.1| dTDP-4-dehydrorhamnose reductase [Bacteroides sp. D22]
 gi|229446176|gb|EEO51967.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262352817|gb|EEZ01914.1| dTDP-4-dehydrorhamnose reductase [Bacteroides sp. 2_1_22]
 gi|292633569|gb|EFF52129.1| dTDP-4-dehydrorhamnose reductase [Bacteroides ovatus SD CMC 3f]
 gi|298270866|gb|EFI12445.1| dTDP-4-dehydrorhamnose reductase [Bacteroides sp. D22]
          Length = 288

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 170/292 (58%), Gaps = 12/292 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ LV G NGQ+   +  +  ++ +         ++D+   +   ++      ++++N A
Sbjct: 1   MRILVTGANGQLGNEMQVLAKENPQHTYYFTDVQELDICDKQAVWTYMAEKQIELVVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED  E+A+ +N E    +A AA + G   I +STDYVFDG + TP  E    
Sbjct: 61  AYTAVDKAEDNQELAYKLNCEAPKQLASAAQANGAAMIQVSTDYVFDGTAHTPYTEDCNP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG +KL GE++V ++    V++RTAW+YSIFG+NF+ +MLRL KER  + VV DQ
Sbjct: 121 CPDSVYGTTKLEGEKEVMNHCEQAVVIRTAWLYSIFGNNFVKTMLRLGKERDSLGVVFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +ARAI  I +  I      +RGI+H + + G  SW DF   I   +   G 
Sbjct: 181 IGTPTYANDLARAIYAIINKGI------VRGIYHFSNE-GVCSWYDFTVAIHRLA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              KV  + T +YP KA+RPAYS LD +K+  T +I I  W+E ++  L+ +
Sbjct: 231 TTCKVKPLHTAEYPAKANRPAYSVLDKTKIKTTFDIEIPHWEESLKQCLIKL 282


>gi|126726123|ref|ZP_01741965.1| dTDP-4-dehydrorhamnose reductase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705327|gb|EBA04418.1| dTDP-4-dehydrorhamnose reductase [Rhodobacterales bacterium
           HTCC2150]
          Length = 285

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 118/288 (40%), Positives = 157/288 (54%), Gaps = 12/288 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M  LV G  GQ++Q L+    +   II +GR   DL  P   A          +IN AAY
Sbjct: 1   MSILVFGTTGQVSQELAR---RREGIIALGRDQADLSDPAACAKLITETDCHAVINAAAY 57

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +  +A  +N     A+A A  + GIP ++ISTDYVFDG    P      T P
Sbjct: 58  TAVDKAESDEAMAALVNGAAPTAMATACAAKGIPFVHISTDYVFDGTGDQPWMVNDLTAP 117

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L  YG++KL GEE V +    Y ILRT+WV+S  G+NF+ +M RL  ER  +++V DQ G
Sbjct: 118 LGAYGRTKLTGEEGVRAAGGTYGILRTSWVFSAHGNNFVKTMRRLGAERDRLTIVADQIG 177

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT+A  IA A + +A  L+ +S  S  G +H    GGP VSWADFA  IF +S      
Sbjct: 178 GPTAAGDIADACLAMADQLLADSGKS--GTYHFA--GGPDVSWADFAREIFAQS----NL 229

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             +V  I T  +PT A RPA S +DCS L     I    W+  + +++
Sbjct: 230 TPEVVDIPTSDFPTPAARPANSRMDCSTLETVFGITRLDWRVSLADVI 277


>gi|73809578|gb|AAZ85704.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Escherichia coli]
          Length = 299

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 162/293 (55%), Gaps = 9/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          +   D +  G++H+ A  G  +W D+A  +F E+ + 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPDVA--GLYHLVAS-GTTTWYDYAALVFEEARKA 237

Query: 237 GGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 238 GIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|323525017|ref|YP_004227170.1| dTDP-4-dehydrorhamnose reductase [Burkholderia sp. CCGE1001]
 gi|323382019|gb|ADX54110.1| dTDP-4-dehydrorhamnose reductase [Burkholderia sp. CCGE1001]
          Length = 308

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 157/292 (53%), Gaps = 10/292 (3%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G NGQ+   L+        ++ V R  +DL       +      P +I+NPAAYTAV
Sbjct: 11  LVTGVNGQVGYELARTLQGLGRVVAVDRSTLDLSNLDQIRAVVRDVKPALIVNPAAYTAV 70

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE EPE+A  IN E  G +A+ A  +G   I+ STDYVFDG  +    E  PTNP N 
Sbjct: 71  DKAEQEPELAMRINGEAPGVLAEEAKKLGAALIHYSTDYVFDGEKQDAYVESDPTNPQNA 130

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG++KLAGE  +A+   ++++LRT+WVY   G NFLL+MLRL  +R E+ VV DQFG PT
Sbjct: 131 YGRTKLAGERAIAATGVDHLVLRTSWVYGTRGKNFLLTMLRLGADRPELKVVADQFGAPT 190

Query: 184 SALQIARAIIQIAHNLIENSDTS-----LRGIFHM-TADGGPVSWADFAEYIFWESAERG 237
               IA     IA       D +       G++H+  AD    SW  FA  IF E A+  
Sbjct: 191 WCNTIATLTAHIAAQSFAAPDANSWWQERSGVYHLCCADS--TSWHGFASAIF-ELADLP 247

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
              S +  I   +YPT A RP+ S +  +KLA    +    W+E +R  L +
Sbjct: 248 NRPSTL-PIPAAEYPTPAKRPSNSRMSNAKLAQVFGLAAPHWREALRLCLTD 298


>gi|113867832|ref|YP_726321.1| dTDP-4-dehydrorhamnose reductase [Ralstonia eutropha H16]
 gi|113526608|emb|CAJ92953.1| dTDP-4-dehydrorhamnose reductase [Ralstonia eutropha H16]
          Length = 305

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 156/293 (53%), Gaps = 7/293 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G+NGQ+   L         ++ + R   DL  P +       + PDVI+NP AYTAV
Sbjct: 12  LVTGSNGQVGFELRRSLAPLGRVVALDRTGCDLSCPDEIRRMVREYRPDVIVNPGAYTAV 71

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D+AE EP++AF+IN   AG +A+ A ++G   ++ STDYVFDG       E    NPL++
Sbjct: 72  DEAETEPDLAFAINGTAAGILAEEAKALGSLLVHYSTDYVFDGTKNGTYIETDLVNPLSV 131

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YGKSKLAGE+ + +     +ILRT W     G NF  +MLRL +ER  + V+ DQFG PT
Sbjct: 132 YGKSKLAGEQAITATGAQSLILRTCWAAGAHGGNFAKTMLRLGRERESLRVIADQFGAPT 191

Query: 184 SALQIARAIIQIAHN--LIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           +A  IA    QI     L  +  +   G++H+ A  G  +W  +A  +   +A  G    
Sbjct: 192 TATLIADVTAQIVGRRWLCGDRMSFPSGLYHLAA-AGETTWHAYATEVLRYAAAHGIELK 250

Query: 242 K----VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                +  I    YP  A RPA S LD SKL  T +I +  W++GV  +L  I
Sbjct: 251 VDPGCIEPIPATAYPLPAPRPANSRLDTSKLRQTFDIHLPDWQQGVHFLLDQI 303


>gi|9957865|gb|AAG09538.1|AF279625_2 dTDP-6-deoxy-L-mannose-dehydrogenase [Salmonella enterica]
          Length = 299

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 116/299 (38%), Positives = 169/299 (56%), Gaps = 15/299 (5%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++ ++ V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIVLDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGSWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQ+G PT A  +A      I++A N  E     + G++H+ A GG  +W D+A  +F E+
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVA-GGTTTWHDYAALVFDEA 234

Query: 234 AERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            + G     +++  + T  YPT A RP  S L+  K     ++ +  W+ GV+ +L  +
Sbjct: 235 RKAGITLALTELNAVPTSAYPTSASRPGNSRLNTEKFQRNFDLILPQWELGVKRMLTEM 293


>gi|16761028|ref|NP_456645.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29141276|ref|NP_804618.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213419658|ref|ZP_03352724.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213425546|ref|ZP_03358296.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213650450|ref|ZP_03380503.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|289827041|ref|ZP_06545849.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25291468|pir||AE0767 dTDP-4-dehydrorhamnose reductase [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16503326|emb|CAD02459.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29136902|gb|AAO68467.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 299

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 167/297 (56%), Gaps = 11/297 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+ IG   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANEIGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      Y+I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ATSPLNVYGKTKLAGEKALQDNCPKYLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           DQ+G PT A  +A      AH + +  +   + G++H+ A GG  +W D+A  +F E+ +
Sbjct: 181 DQYGAPTGAELLADC---TAHAIRVTLNKPEVAGLYHLVA-GGTTTWHDYAALVFDEARK 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            G     +++  + T  YPT A RP  S L+  K      + +  W+ GV+ +L  +
Sbjct: 237 AGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFGLILPQWELGVKRMLTEM 293


>gi|260435295|ref|ZP_05789265.1| dTDP-4-dehydrorhamnose reductase [Synechococcus sp. WH 8109]
 gi|260413169|gb|EEX06465.1| dTDP-4-dehydrorhamnose reductase [Synechococcus sp. WH 8109]
          Length = 294

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 113/292 (38%), Positives = 155/292 (53%), Gaps = 9/292 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G  GQ+ Q+L +   + +E++   R  +DL   +          PD ++N  AY
Sbjct: 1   MKVLLTGAGGQLGQALIASAPEGIELVATSRQQLDLADTEACRGAVQEHQPDWVLNAGAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE+A ++NA    A A+A D  G   + ISTD+VF+G   TP       NP
Sbjct: 61  TAVDKAESEPELAHAVNAGAPEAFARALDQQGGRLLQISTDFVFNGTQGTPYQPEQARNP 120

Query: 121 LNIYGKSKLAGEEKVASY---TNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD 177
           L +YG SK AGE  V +        +ILRT+WV    G NF L+MLRL +ER ++ VV D
Sbjct: 121 LGVYGASKAAGEAAVQTIFGAGGRGLILRTSWVIGPVGRNFALTMLRLHRERDQLGVVAD 180

Query: 178 QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
           Q G PTS L +A+A  Q    L    D  L  + H + D G  SW D A  +    A+ G
Sbjct: 181 QVGCPTSTLNLAQACWQ---TLRIAGDRELPAVMHWS-DAGASSWYDVAVAVGQIGADLG 236

Query: 238 --GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
                + V  I T  YPT A RPAYS LDC+      ++    W++ ++N+L
Sbjct: 237 LIDTPAAVQPITTADYPTPAERPAYSLLDCTSTRAALDLNGEHWQQALKNVL 288


>gi|82777432|ref|YP_403781.1| dTDP-4-dehydrorhamnose reductase [Shigella dysenteriae Sd197]
 gi|81241580|gb|ABB62290.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Shigella dysenteriae Sd197]
          Length = 299

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 115/296 (38%), Positives = 165/296 (55%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRL KER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLGKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAT-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|220935511|ref|YP_002514410.1| dTDP-4-dehydrorhamnose reductase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996821|gb|ACL73423.1| dTDP-4-dehydrorhamnose reductase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 298

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 115/282 (40%), Positives = 158/282 (56%), Gaps = 11/282 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L+ G  GQ+  +L  +  + VE++ + R  +D+            F P  +IN AAYT
Sbjct: 14  RVLLSGAAGQVGVALRDLMPEGVELLALERSTLDISDADRVTETVAHFRPHWVINAAAYT 73

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE EP++AF+IN +GA  +A+AA S+    ++ISTDYVFDG    P       NP+
Sbjct: 74  AVDKAEHEPDLAFAINRDGAANLARAAQSVRARMVHISTDYVFDGRKSCPYTPDDLPNPI 133

Query: 122 NIYGKSKLAGEEKVAS-YTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           N+YG+SKLAGE        +N +ILRTAWVY+  G NFL +MLRL +ER E+ VV DQ G
Sbjct: 134 NVYGESKLAGEIATRDILGDNLLILRTAWVYAPHGRNFLTTMLRLLQERDELRVVEDQVG 193

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPT A  +A  I++       +    L G +H T D G  SW DFA  I   +   G   
Sbjct: 194 TPTHAASLAEVILR-------SISQDLTGTYHWT-DAGVASWYDFAIAIQEMAISTGLDV 245

Query: 241 S--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
           +  +V  I T+ YPT A RPAY+ LD S +        + W+
Sbjct: 246 ATCRVSPIPTRDYPTPASRPAYTVLDKSAIRERLGHHGTHWR 287


>gi|167903952|ref|ZP_02491157.1| dTDP-4-dehydrorhamnose reductase [Burkholderia pseudomallei NCTC
           13177]
          Length = 298

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 153/289 (52%), Gaps = 12/289 (4%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + LV G NGQ+   L+        ++ + R  +DL  P    +      P +I+NPAAYT
Sbjct: 8   RILVTGVNGQVGFELARTLQGLGTVVALDRGALDLADPDRIRAVMREIRPTLIVNPAAYT 67

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE E ++A +IN    G +A+ A  +G P I+ STDYVFDG+      E  PT P 
Sbjct: 68  AVDKAERERDLAIAINGVAPGVLAEEAKRLGAPLIHYSTDYVFDGMKDGEYTETDPTCPQ 127

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           N+YG+SKLAGE  +A+    ++I RT+WVY   G NF+L+MLRL  ER E+ VV DQ G 
Sbjct: 128 NVYGESKLAGEVAIAASGAAHLIFRTSWVYGARGRNFMLTMLRLGNERSELKVVSDQIGA 187

Query: 182 PTSALQIARAIIQIAHNLIENSDTSL-----RGIFHMTADGGPVSWADFAEYIFWESAER 236
           PT +  IA     +        D +       G++H++A G   SW  FA  IF    E 
Sbjct: 188 PTWSNTIATLTSHVVAQANSVQDVTQWWSERSGVYHLSASGA-TSWHGFASAIF----EL 242

Query: 237 GGPYSK--VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
            G  ++  V  I T +YP  A RPA S +   KL     +R   WKE +
Sbjct: 243 AGGETRPIVLPISTAEYPVPATRPANSRMSGDKLQEVFGLRAPDWKEAL 291


>gi|217421054|ref|ZP_03452559.1| dTDP-4-dehydrorhamnose reductase [Burkholderia pseudomallei 576]
 gi|217396466|gb|EEC36483.1| dTDP-4-dehydrorhamnose reductase [Burkholderia pseudomallei 576]
          Length = 300

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 153/289 (52%), Gaps = 12/289 (4%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + LV G NGQ+   L+        ++ + R  +DL  P    +      P +I+NPAAYT
Sbjct: 10  RILVTGVNGQVGFELARTLQGLGTVVALDRGALDLADPDRIRAVMREIRPTLIVNPAAYT 69

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE E ++A +IN    G +A+ A  +G P I+ STDYVFDG+      E  PT P 
Sbjct: 70  AVDKAERERDLAIAINGVAPGVLAEEAKRLGAPLIHYSTDYVFDGMKDGEYTETDPTCPQ 129

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           N+YG+SKLAGE  +A+    ++I RT+WVY   G NF+L+MLRL  ER E+ VV DQ G 
Sbjct: 130 NVYGESKLAGEVAIAASGAAHLIFRTSWVYGARGRNFMLTMLRLGNERSELKVVSDQIGA 189

Query: 182 PTSALQIARAIIQIAHNLIENSDTSL-----RGIFHMTADGGPVSWADFAEYIFWESAER 236
           PT +  IA     +        D +       G++H++A G   SW  FA  IF    E 
Sbjct: 190 PTWSNTIATLTSHVVAQANSVQDVTQWWSERSGVYHLSASGA-TSWHGFASAIF----EL 244

Query: 237 GGPYSK--VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
            G  ++  V  I T +YP  A RPA S +   KL     +R   WKE +
Sbjct: 245 AGGETRPIVLPISTAEYPVPATRPANSRMSGDKLQEVFGLRAPDWKEAL 293


>gi|78213550|ref|YP_382329.1| dTDP-4-dehydrorhamnose reductase [Synechococcus sp. CC9605]
 gi|78198009|gb|ABB35774.1| dTDP-4-dehydrorhamnose reductase [Synechococcus sp. CC9605]
          Length = 294

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 154/292 (52%), Gaps = 9/292 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G  GQ+ Q+L +     +E++   R ++DL  P+          PD ++N  AY
Sbjct: 1   MKVLLTGAGGQLGQALIACAPDGIELVVTSRQELDLADPEACGGAVKQHKPDWVLNAGAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE+A ++NA    A A+A D  G   + ISTD+VF+G    P       +P
Sbjct: 61  TAVDKAESEPELAHAVNAGAPEAFARALDQQGGRLLQISTDFVFNGTQGKPYQPEQARDP 120

Query: 121 LNIYGKSKLAGEEKVASY---TNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD 177
           L +YG SK AGE  V S        +ILRT+WV    G NF L+MLRL +ER ++ VV D
Sbjct: 121 LGVYGASKAAGEAAVQSIFGARGQGLILRTSWVIGPVGKNFALTMLRLHRERDQLGVVAD 180

Query: 178 QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
           Q G PTS L +A+A  Q    L    D  L  + H + D G  SW D A  +    A+ G
Sbjct: 181 QVGCPTSTLNLAQACWQ---TLQIAGDRELPAVMHWS-DAGAASWYDVAVAVGQIGADLG 236

Query: 238 --GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
                + V  I T  YPT A RPAYS LDC+      ++    W++ ++ +L
Sbjct: 237 LIDTPAAVQPITTADYPTPAERPAYSLLDCTSTRAALDLNGEHWQQAIKTVL 288


>gi|51246074|ref|YP_065958.1| dTDP-4-rhamnose reductase [Desulfotalea psychrophila LSv54]
 gi|50877111|emb|CAG36951.1| probable dTDP-4-rhamnose reductase [Desulfotalea psychrophila
           LSv54]
          Length = 298

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 116/293 (39%), Positives = 169/293 (57%), Gaps = 10/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ LV G+ GQ+ + L       VE++   R ++D+   K        F PD+IIN   Y
Sbjct: 1   MRILVTGSGGQVGKCLCRQLSGKVELLTTNRSELDITCQKAVLKTVTGFQPDIIINATGY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDG-LSR-TPIDEFSPT 118
           TAVD AE+  E A+ +N +GA  + +AA ++G   ++ISTDYVF G  SR     E    
Sbjct: 61  TAVDLAEENSEEAYRVNQDGAKFLGQAATAVGAALLHISTDYVFSGEKSRDESYSEGEEP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            PL +YGKSKLAGE+ VA+    ++ILRT+WV+S +G NF+ +M+ L ++   +S+V DQ
Sbjct: 121 GPLGVYGKSKLAGEKAVANTCKRHIILRTSWVFSEYGRNFVKTMIALGQKHDSLSIVSDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           +G PT A  IA A+I IA   I + +    G++H    G P ++W+ FA+ IF E AER 
Sbjct: 181 YGGPTYAGDIASALITIAEK-ISDENFCQWGLYHFA--GQPFMNWSGFAKVIFSE-AERE 236

Query: 238 G--PYSKVY-RIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              P   V   + ++QYP+ A RP  S LD SKL     I  S W++ +R I+
Sbjct: 237 NLLPAEPVINNVSSEQYPSLAKRPGNSQLDTSKLTAQFGISPSDWQQALREII 289


>gi|88813325|ref|ZP_01128563.1| dTDP-4-dehydrorhamnose reductase [Nitrococcus mobilis Nb-231]
 gi|88789383|gb|EAR20512.1| dTDP-4-dehydrorhamnose reductase [Nitrococcus mobilis Nb-231]
          Length = 291

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 161/292 (55%), Gaps = 10/292 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G NGQ+ ++L  +    VE++  GR  +D+ +P+      L+  P VI+N AAY
Sbjct: 1   MKVLVTGANGQLGRALVRLAPAGVELLAYGRDALDVTQPQSVPRV-LAMEPAVIVNAAAY 59

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE E   A+++N  GA  +A+AA  +G   ++ISTD+VFDG    P    S  NP
Sbjct: 60  TAVDQAETERAAAYAVNVGGAEHMARAARELGCRLVHISTDFVFDGAQGRPYTPESKPNP 119

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           LN+YG SKLAGE+   +   + +ILRTAW+Y   GSNF+ SMLRL + R E+ VV DQ G
Sbjct: 120 LNVYGASKLAGEQAAQAIKPDALILRTAWLYGETGSNFVHSMLRLMRTRAELHVVDDQIG 179

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG--G 238
           TPT+   +A+ + +     +      L GI H T D G  SW DFA  I   +   G   
Sbjct: 180 TPTAVAGLAQCVWRAIEGRL------LSGIQHWT-DAGVASWYDFAVAIRQTAMALGLLQ 232

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             + V  + +  YPT A RPA+S LD +       +    W   + + L  +
Sbjct: 233 RPAAVLPVPSSAYPTPASRPAFSVLDKTATWRALALTPGHWSAALADTLAAV 284


>gi|309787872|ref|ZP_07682482.1| dTDP-4-dehydrorhamnose reductase [Shigella dysenteriae 1617]
 gi|50982493|gb|AAT91847.1| dTDP-4-dyhydrorhamnose reductase [Shigella dysenteriae]
 gi|308924271|gb|EFP69768.1| dTDP-4-dehydrorhamnose reductase [Shigella dysenteriae 1617]
          Length = 299

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 115/296 (38%), Positives = 165/296 (55%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRL KER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLGKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVAVNKPE-----VAGLYHLVAT-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|63033902|gb|AAY28253.1| RmlD [Escherichia coli]
          Length = 299

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 114/293 (38%), Positives = 160/293 (54%), Gaps = 9/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  G +   L      + ++  + V   D   D   P   A    S  PD+I+N
Sbjct: 1   MNILLFGKTGHVGWELQRALAPLGNLIALDVHSTDYCGDFSNPDGVAETIRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFSGNGDMPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  Y   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 TTAPLNVYGETKLAGEKALQEYCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          +   D +  G++H+ A  G  +W D+A  +F E+ + 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPDVA--GLYHLVAS-GTTTWYDYAALVFEEARKA 237

Query: 237 GGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G P S  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 238 GIPLSLNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|187880657|gb|ACD37159.1| RmlD [Escherichia coli]
 gi|187880666|gb|ACD37167.1| RmlD [Escherichia coli]
 gi|187880675|gb|ACD37175.1| RmlD [Escherichia coli]
          Length = 299

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 118/297 (39%), Positives = 166/297 (55%), Gaps = 17/297 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EP+ A  +NA    AIAKAA+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPKFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGNGDTPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A GG  +W D+A  +F E 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVAANKPE-----VAGLYHLVA-GGTTTWHDYAALVF-EE 233

Query: 234 AERGG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           A R G     +K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 234 ARRAGINLALNKLNAVPTTAYPTPARRPYNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|224826610|ref|ZP_03699711.1| dTDP-4-dehydrorhamnose reductase [Lutiella nitroferrum 2002]
 gi|224601211|gb|EEG07393.1| dTDP-4-dehydrorhamnose reductase [Lutiella nitroferrum 2002]
          Length = 297

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 160/294 (54%), Gaps = 6/294 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+IG +GQ+   L        ++   GR  +DL +P   A   L F+PD+I+N AAY
Sbjct: 1   MRILLIGGSGQLGFELRRSLALYGKLWAPGREVLDLSRPDQLAPPVLEFAPDLIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE EP +A  +NAE    +A+ A+ +G   ++ STDYVFDG    P  E   T P
Sbjct: 61  TAVDRAETEPALAERVNAEAPAELARLAERLGATLLHFSTDYVFDGAGAAPYREGDVTRP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L++YG++K  GE  V +  + + +LRT+WVY   G NF+ ++LRLA +R  ++VV DQ G
Sbjct: 121 LSVYGRTKRDGELAVMNDCSRHYVLRTSWVYGSVGGNFVKTILRLAAQRDTLNVVHDQVG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PTSA+ IA    Q+   L E       G++H+TA  G  SW  FA  I   + + GG  
Sbjct: 181 APTSAMLIADVSAQLVSRLREGRVLPY-GLYHLTA-AGETSWHGFAREIVGLAQDVGGGL 238

Query: 241 ----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                 +  I    YP  A RPA S LD  KL     I +  W+  ++ +L  +
Sbjct: 239 VLKPEAIQAIPAADYPAAAERPANSRLDTHKLRVALGIVLPDWRHHLQLVLQQL 292


>gi|190572702|ref|YP_001970547.1| putative dTDP-4-dehydrorhamnose reductase [Stenotrophomonas
           maltophilia K279a]
 gi|190010624|emb|CAQ44233.1| putative dTDP-4-dehydrorhamnose reductase [Stenotrophomonas
           maltophilia K279a]
          Length = 301

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 118/304 (38%), Positives = 162/304 (53%), Gaps = 22/304 (7%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGR----PD------IDLLKPKDFASFFLSFS 50
           M  LV G NGQ+ Q L        +++   R    PD       D  +P+   +      
Sbjct: 1   MTVLVFGGNGQVGQELLRALAPLGKVVATTRSGTLPDGSACETADFGQPESLPALLDRLR 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           P +++N AAYTAVD+AE E + AF+ NA+  G IA+   + G+P ++ STDYVFDG    
Sbjct: 61  PSIVVNAAAYTAVDRAEQEVDAAFAANAQAPGVIARWCAAHGVPFVHYSTDYVFDGQGTV 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P  E  PT PL +YG SK  GE+ V +    ++I RTAWVY+  G+NFL +MLR+  ER 
Sbjct: 121 PYHEDEPTAPLGVYGTSKRDGEDAVRAAGGRHLIFRTAWVYASHGANFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
           ++ VV DQ GTPT A  IA    Q   +        L G +H+TA  G  SW  FAE IF
Sbjct: 181 QLRVVADQVGTPTPAALIADVTAQALQH-----PGQLSGTWHLTAS-GQTSWHGFAEAIF 234

Query: 231 WESAERG----GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
            ES   G     P   V  I + +YPT A RPA+S LD  KL     I +  W++G++ +
Sbjct: 235 AESLAAGVLVKAP--SVEAIPSSEYPTPAKRPAWSVLDNRKLQQDFGIVLPVWQDGLKRV 292

Query: 287 LVNI 290
           +  +
Sbjct: 293 IGEV 296


>gi|331658120|ref|ZP_08359082.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli TA206]
 gi|331056368|gb|EGI28377.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli TA206]
          Length = 299

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 118/297 (39%), Positives = 165/297 (55%), Gaps = 17/297 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EP  A  +NA    AIAKAA+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPNFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGNGDTPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A GG  +W D+A  +F E 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVAANKPE-----VAGLYHLVA-GGTTTWHDYAALVF-EE 233

Query: 234 AERGG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           A R G     +K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 234 ARRAGINLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|153808463|ref|ZP_01961131.1| hypothetical protein BACCAC_02757 [Bacteroides caccae ATCC 43185]
 gi|149128785|gb|EDM20002.1| hypothetical protein BACCAC_02757 [Bacteroides caccae ATCC 43185]
          Length = 282

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 164/289 (56%), Gaps = 12/289 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ LV G +GQ+   +  +  ++ +         ++D+   +   ++      ++I+N A
Sbjct: 1   MRILVTGADGQLGNEMQVLAKENPQHTYYFTDVQELDICDKQAVWAYIAEKRIELIVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED PE+A+ +N E A  +A AA   G   I +STDYVFDG +  P  E    
Sbjct: 61  AYTAVDKAEDNPELAYKLNCEAAKELASAAQFNGAAMIQVSTDYVFDGTAHIPYTEDCDP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG +KL GE  V +Y    V++RTAW+YS FG+NF+ +M+RL KER  + VV DQ
Sbjct: 121 CPDSVYGTTKLEGEYDVMNYCEKAVVIRTAWLYSTFGNNFVKTMIRLGKERDSLGVVFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +A+AI  I +  I      +RGI+H + + G  SW DF   I   +   G 
Sbjct: 181 IGTPTYANDLAQAIYTIINKGI------VRGIYHFSNE-GVCSWYDFTVAIHRLA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              KV  + T +YP KA+RPAYS LD +K+  T  I I  W+E ++  +
Sbjct: 231 TSCKVKPLHTAEYPAKANRPAYSVLDKTKIKTTFGIEIPHWEESLKRCI 279


>gi|254459903|ref|ZP_05073319.1| dTDP-4-dehydrorhamnose reductase [Rhodobacterales bacterium
           HTCC2083]
 gi|206676492|gb|EDZ40979.1| dTDP-4-dehydrorhamnose reductase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 284

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 128/291 (43%), Positives = 170/291 (58%), Gaps = 13/291 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVE-IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+ L+ G  GQ+AQ L     Q  E I  +GR D DL  P   A    +   D++IN AA
Sbjct: 1   MRVLIFGKTGQVAQEL-----QRFEGITALGREDADLNDPAACAEIIANTDADIVINAAA 55

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVD AE + + AF +NA+   A+A+AA    +P ++ISTDYVFDG   TP  E  PT 
Sbjct: 56  YTAVDAAETDTDKAFVVNADAPKAMAEAAAKRAMPFLHISTDYVFDGTGTTPWREDDPTA 115

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL IYG SKLAGE  V +   ++ ILRT+WV S  G+NF+ +MLRL  ER  +++V DQ 
Sbjct: 116 PLGIYGSSKLAGEHGVRAVGGSHAILRTSWVVSAHGTNFVRTMLRLGTERDALNIVADQI 175

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PT A  IA A++ +A  LI++  TS  G +H  A     SWADFA  IF ++    G 
Sbjct: 176 GGPTCARDIAAALMHMARKLIDDPSTS--GTYHF-ASTPDTSWADFAREIFTQA----GL 228

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V  I +  YPT A RP  S LDC+K+A   NI    W+ G+ +IL ++
Sbjct: 229 SCDVTDIPSSAYPTPAARPKNSRLDCTKIATVFNINRPDWRIGLADILSDL 279


>gi|255099386|ref|ZP_05328363.1| dTDP-4-dehydrorhamnose reductase, rfbD ortholog [Clostridium
           difficile QCD-63q42]
 gi|255305244|ref|ZP_05349416.1| dTDP-4-dehydrorhamnose reductase, rfbD ortholog [Clostridium
           difficile ATCC 43255]
          Length = 290

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 117/297 (39%), Positives = 171/297 (57%), Gaps = 25/297 (8%)

Query: 1   MKCLVIGNNGQIAQSL--------SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPD 52
           MK L+ G+NGQ+ + L         S+      I+   R D+D+    +  +F L   PD
Sbjct: 1   MKILITGSNGQLGKELVNQLEAINQSINQPKYVILATTRSDLDISNQTNVDNFILHNKPD 60

Query: 53  VIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPI 112
           V++N AAYT VD  ED  EIA+ INA G   +A A++ +    I+ISTDYVF+G S+ P 
Sbjct: 61  VVVNCAAYTKVDACEDNIEIAYKINALGVRNLAIASEKVNAKLIHISTDYVFNGFSKYPY 120

Query: 113 DEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREI 172
            E + T P ++YGKSKL GE+ V  +++ Y ILRTAW+Y   G+NF+ +M++L+ E +E+
Sbjct: 121 REDNKTEPNSVYGKSKLMGEKFVEQFSHKYFILRTAWLYG-NGNNFVKTMIKLSLENKEV 179

Query: 173 SVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWE 232
           +VV DQFGTPTS + +A+ II+I        +T   G++H T + G  SW DFA+ IF  
Sbjct: 180 NVVNDQFGTPTSTVDLAKIIIRIM-------ETEHYGVYHATCE-GECSWYDFAKKIF-- 229

Query: 233 SAERGGPYSKVYRIFTKQYPTKAHRPAYSCLD--CSKLANTHNIRISTWKEGVRNIL 287
             +      KV  I + ++  KA RP YS LD    KL   ++ R   W+E +   L
Sbjct: 230 --KLKNIDIKVNPIKSNEFKCKAPRPLYSVLDNFMLKLIGLNSFR--KWEESIEEYL 282


>gi|269102101|ref|ZP_06154798.1| dTDP-4-dehydrorhamnose reductase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268161999|gb|EEZ40495.1| dTDP-4-dehydrorhamnose reductase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 296

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 118/288 (40%), Positives = 167/288 (57%), Gaps = 10/288 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK L+ G NGQ+   L        + EI+ V R ++D+    D       F P +IIN A
Sbjct: 1   MKVLITGCNGQVGSCLVEQLQTFPNTEILAVDRNELDITSQYDVIKSVNEFKPHIIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAE E +++++IN +G   +A+AA+++G   ++ISTDYVF G       E    
Sbjct: 61  AHTAVDKAETEVDLSYAINRDGPLYLAQAAENVGATLLHISTDYVFSGDKDGMYIETDTV 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           +P  +YGKSKLAGE  V    +  +ILRTAWV+   G+NF+ +MLRLA++R E+ +V DQ
Sbjct: 121 DPQGVYGKSKLAGENAVLDNCSRSIILRTAWVFGEEGNNFVKTMLRLAQQRDELGIVADQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLI---ENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESA 234
           FG PT A  IA A+I IA  +I    N + S  GI+H +  G P  SW  FA+ IF ++ 
Sbjct: 181 FGGPTYARDIATALISIARTIIAEGSNFELSKYGIYHYS--GLPHTSWYGFAQTIFDKAV 238

Query: 235 ERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
           E+        V  I T+ Y T A RPA S L+  K+  T +I+ S W+
Sbjct: 239 EQKVLNKAPIVNGIKTEDYLTPAKRPANSKLNIQKITETFDIQASDWQ 286


>gi|115503046|gb|ABI98970.1| RmlD [Escherichia coli]
 gi|187880503|gb|ACD37021.1| RmlD [Shigella boydii]
          Length = 299

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 115/296 (38%), Positives = 165/296 (55%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+       S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVGETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQESD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCVKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 CKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|73809590|gb|AAZ85715.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia coli]
          Length = 299

 Score =  195 bits (496), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGNGDTPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRMALNKPE-----VAGLYHLVAT-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|168818215|ref|ZP_02830215.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205345064|gb|EDZ31828.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|320086528|emb|CBY96299.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 299

 Score =  195 bits (496), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 167/299 (55%), Gaps = 15/299 (5%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A GG  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVA-GGTTTWHDYAALVFDEA 234

Query: 234 AERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            + G     +++  + T  YPT A RP  S L+  K      + +  W+ GV+ +L  +
Sbjct: 235 RKAGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFGLILPQWELGVKRMLTEM 293


>gi|327399837|ref|YP_004340706.1| dTDP-4-dehydrorhamnose reductase [Hippea maritima DSM 10411]
 gi|327182466|gb|AEA34647.1| dTDP-4-dehydrorhamnose reductase [Hippea maritima DSM 10411]
          Length = 292

 Score =  195 bits (496), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 163/294 (55%), Gaps = 13/294 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMC-------VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDV 53
           M  LV G NGQ+   +  +        ++ +      +  +D+ K ++   F      D+
Sbjct: 1   MNVLVTGANGQLGSEIKYLVKNNLTSNIKHLTFFFTDKDKLDITKKEEIEKFVKEKDIDL 60

Query: 54  IINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPID 113
           IIN AAYTAVDKAE+E E++  IN +    +A  +    I  I+ISTDYVFDG +  P  
Sbjct: 61  IINCAAYTAVDKAEEEKELSDLINHQAVKYLANISKENDITLIHISTDYVFDGKNYKPYK 120

Query: 114 EFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREIS 173
           E   TNP  IYG +KL GEE   +     +I+RT+WVYS FG NF+ +MLRL K+R E++
Sbjct: 121 EDYKTNPQGIYGLTKLKGEEAFINSGARGIIIRTSWVYSTFGHNFVKTMLRL-KDRSELN 179

Query: 174 VVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           VV DQ GTPT A  +A+AI++I     E  +     IFH + + G  SW DFA+ IF   
Sbjct: 180 VVFDQVGTPTYARDLAKAILEIIDKNYEKLNNFKAEIFHFSNE-GICSWYDFAKAIF--- 235

Query: 234 AERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            +      K+  I TK YPT A RP YS L+ +K+    NI I  W+E ++ +L
Sbjct: 236 -DIKSIDIKINPIETKDYPTPAKRPYYSVLNKNKIKKEFNIEIPYWRESLKKML 288


>gi|9957830|gb|AAG09510.1|AF279618_2 dTDP-6-deoxy-L-mannose-dehydrogenase [Salmonella enterica]
          Length = 299

 Score =  195 bits (495), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 166/296 (56%), Gaps = 9/296 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+ IG   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANEIGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A          ++  + +  G++H+ A GG  +W D+A  +F E+ + 
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVA-GGTTTWHDYAALVFDEARKA 237

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +++  + T  YPT A RP  S L+  K  +   + +  W+ GV+ +L  +
Sbjct: 238 GLTLALTELNAVPTSAYPTPASRPGNSRLNTEKFQSNFGLILPQWELGVKRMLTEM 293


>gi|307340769|gb|ADN43832.1| RmlD [Escherichia coli]
          Length = 299

 Score =  195 bits (495), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 165/297 (55%), Gaps = 17/297 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVF-EE 233

Query: 234 AERGG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           A + G     +K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 234 ARKAGILLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|159046646|ref|YP_001542315.1| dTDP-4-dehydrorhamnose reductase [Dinoroseobacter shibae DFL 12]
 gi|157914405|gb|ABV95834.1| dTDP-4-dehydrorhamnose reductase [Dinoroseobacter shibae DFL 12]
          Length = 285

 Score =  195 bits (495), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 162/288 (56%), Gaps = 12/288 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G  GQ+A+ L++      E + +GR   DL  P   A+   + +P  +IN AAYTAV
Sbjct: 3   LVFGQTGQVARELAARVP---EALFLGRDAADLSDPDACAAALRAAAPSAVINAAAYTAV 59

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D+AE E ++A  IN    GA+A AA  +G+P ++ISTDYVFDG    P    +P  PL  
Sbjct: 60  DRAEAEEDLATRINGAAPGAMAVAAAELGVPFVHISTDYVFDGAGTAPFAPDAPVGPLGA 119

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKLAGEE V +    + ILRT+WV S  G NF+ +MLRL  ER  +S+V DQ G PT
Sbjct: 120 YGRSKLAGEEAVRAVGGVHAILRTSWVVSAHGGNFVKTMLRLGAERDSLSIVADQVGGPT 179

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGPYSK 242
           +A  IA A ++IA  L   +D    G +H    G P VSWADFA  IF ++    G    
Sbjct: 180 AAGDIAAACLKIAARLA--ADPGKSGTYHFA--GAPDVSWADFAREIFGQA----GLDCA 231

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           V  I +  YPT A RP  S LDCS L     I    W E +  IL ++
Sbjct: 232 VTDIPSAAYPTPARRPHNSRLDCSSLQAAFGIARPDWAESLSGILRDL 279


>gi|168481392|gb|ACA24874.1| RmlD [Escherichia coli]
          Length = 299

 Score =  195 bits (495), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGNGDMPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|93115447|gb|ABE98409.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia coli]
 gi|203285021|gb|ACH97139.1| RmlD [Escherichia coli]
          Length = 299

 Score =  195 bits (495), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 167/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    +IAKAA+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVESIAKAANEVGAWVIHFSTDYVFPGNGDTPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRMALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLKAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|160886448|ref|ZP_02067451.1| hypothetical protein BACOVA_04459 [Bacteroides ovatus ATCC 8483]
 gi|156108333|gb|EDO10078.1| hypothetical protein BACOVA_04459 [Bacteroides ovatus ATCC 8483]
          Length = 286

 Score =  195 bits (495), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 163/289 (56%), Gaps = 12/289 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ LV G NGQ+   +  +  ++ +         ++++   +   ++      ++++N A
Sbjct: 1   MRILVTGANGQLGNEMQVLAKENPQHTYYFTDVEELNICDKQAVWAYIAEKRIELVVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED  E+A+ +N E    +A AA   G   I +STDYVFDG + TP  E    
Sbjct: 61  AYTAVDKAEDNSELAYQLNCEAPKQLASAAQFNGAAMIQVSTDYVFDGTAHTPYTEDCDP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG +KL GE  V +Y    V++RTAW+YS FG+NF+ +M+RL KER  + VV DQ
Sbjct: 121 CPDSVYGTTKLEGEYDVMNYCEKAVVIRTAWLYSTFGNNFVKTMIRLGKERDSLGVVFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +ARAI  I +  I      +RGI+H + + G  SW DF   I   +   G 
Sbjct: 181 IGTPTYANDLARAIYTIINKGI------VRGIYHFSNE-GVCSWYDFTVAIHRLA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              KV  + T +YP KA+RPAYS LD +K+  T  I I  W+E ++  L
Sbjct: 231 TSCKVKPLHTAEYPAKANRPAYSVLDKTKIKTTFGIEIPHWEESLQRCL 279


>gi|325497858|gb|EGC95717.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia fergusonii
           ECD227]
          Length = 299

 Score =  195 bits (495), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 167/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    +IAKAA+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVESIAKAANEVGAWVIHFSTDYVFPGNGDTPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRMALNKPE-----VAGLYHLVAS-GTTTWHDYATLVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|91215487|ref|ZP_01252458.1| dTDP-4-dehydrorhamnose reductase [Psychroflexus torquis ATCC
           700755]
 gi|91186439|gb|EAS72811.1| dTDP-4-dehydrorhamnose reductase [Psychroflexus torquis ATCC
           700755]
          Length = 283

 Score =  195 bits (495), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 160/294 (54%), Gaps = 16/294 (5%)

Query: 1   MKCLVIGNNGQIAQSLS----SMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           MK LV G+NGQ+ Q L     S+ + D +   +    +DL + +    +F    PD  +N
Sbjct: 1   MKILVTGSNGQLGQCLQKHAKSLTLFDFKFETL--ESLDLTQEETLNLYFEKHRPDFCVN 58

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AAYT V+ AED    AF +NAE    +AK  +      I+ISTDYVFDGL   P  E  
Sbjct: 59  CAAYTNVEGAEDNENSAFQVNAEAVHKLAKLCEKFKTKLIHISTDYVFDGLKNRPYHESD 118

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
             NP+N+YG SK  GE  + S  N Y +LRT+W+YS FG NF  ++L+ A  +  +++  
Sbjct: 119 KENPINVYGASKFQGETHITSTMNTYFMLRTSWLYSEFGHNFFNTILKKAASQHPLNITT 178

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           +Q GTPT+A  +A+ I+ +       +D++  G++H  ++ G  +W DFA  I     E 
Sbjct: 179 EQIGTPTNANDLAKFILHLIQ-----TDSTDYGLYHY-SNKGEATWYDFARLIL----EE 228

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                ++    T  YPTKA RP +S LD SK+ +T  I I  W+E + N+L  +
Sbjct: 229 KNLDQEISLQATFSYPTKAKRPKFSVLDKSKVLSTFAIGIPHWRESLVNLLKEV 282


>gi|22298494|ref|NP_681741.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Thermosynechococcus elongatus
           BP-1]
 gi|22294674|dbj|BAC08503.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Thermosynechococcus elongatus
           BP-1]
          Length = 304

 Score =  195 bits (495), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 160/296 (54%), Gaps = 11/296 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRP----DIDLLKPKDFASFFLSFSPDVIIN 56
           M+ L++G  GQ+   L       VE+I V R      +DL      +    +  PDV+IN
Sbjct: 8   MRLLILGATGQVGWQLVQQAPPRVEVIPVARQGTAVTLDLEDLDAISPLLKTLRPDVVIN 67

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AAYTAVD+AE E E A  IN+   G +A     +G   I+ STDYVF G    P  E  
Sbjct: 68  AAAYTAVDQAEQETERAQRINSTAVGLLAATMAELGGLLIHYSTDYVFAGNQSLPYRETD 127

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
              PLN YG +K  GE+ +A +   ++ILRT+WVY + G NFL +M+RLA+ R  + VV 
Sbjct: 128 APAPLNAYGYTKWLGEQAIARHHPAHLILRTSWVYDLRGKNFLRTMVRLAQTRPLVRVVA 187

Query: 177 DQFGTPTSALQIARAIIQIAHNLIEN--SDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
           DQ GTPT+A  IA    Q+ + L+E+  +  SL G++H+T  G   SW  FA  IF    
Sbjct: 188 DQIGTPTAAPFIA----QVTYQLLEHWQATPSLSGLYHLTPRGS-TSWYGFAAKIFDHLR 242

Query: 235 ERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            +G   + +  I + +YPT+A RPA+S L+C KL       +  W+  +  +L  +
Sbjct: 243 AKGYAAATLEAIPSSEYPTRAKRPAFSTLNCEKLETVLGTPLPPWEAVLEPLLQQL 298


>gi|117624236|ref|YP_853149.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli APEC O1]
 gi|237704494|ref|ZP_04534975.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia sp. 3_2_53FAA]
 gi|300936656|ref|ZP_07151560.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli MS 21-1]
 gi|115513360|gb|ABJ01435.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia coli APEC O1]
 gi|226900860|gb|EEH87119.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia sp. 3_2_53FAA]
 gi|288816199|gb|ADC54923.1| RmlD [Escherichia coli]
 gi|300458237|gb|EFK21730.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli MS 21-1]
 gi|323951792|gb|EGB47666.1| RmlD substrate binding domain-containing protein [Escherichia coli
           H252]
          Length = 299

 Score =  195 bits (495), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 161/293 (54%), Gaps = 9/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKRIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    +IAKAA+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVESIAKAANEVGAWVIHYSTDYVFPGNGDTPWLEMD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          +   D +  G++H+ A  G  +W D+A  +F E+   
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPDVA--GLYHLVAS-GTTTWYDYAALVFEEARNA 237

Query: 237 GGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 238 GIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|191167706|ref|ZP_03029514.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli B7A]
 gi|76366003|gb|ABA42228.1| RmlD [Escherichia coli]
 gi|190902219|gb|EDV61960.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli B7A]
          Length = 299

 Score =  195 bits (495), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGNCDTPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWYDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQLGVKRML 290


>gi|46451852|gb|AAS98027.1| RmlD [Shigella boydii]
          Length = 299

 Score =  194 bits (494), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 164/294 (55%), Gaps = 11/294 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    +IAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVESIAKAANEVGAWVIHYSTDYVFPGTGEIPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           DQFG PT A  +A      AH + +    T + G++H+ A  G  +W D+A  +F E+ +
Sbjct: 181 DQFGAPTGAELLADC---TAHAIRVALKKTEVAGLYHLVAS-GTTTWYDYAALVFEEARK 236

Query: 236 RGGP--YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            G P   +K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 237 AGIPLVLNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|82543418|ref|YP_407365.1| dTDP-4-dehydrorhamnose reductase [Shigella boydii Sb227]
 gi|16611724|gb|AAL27311.1|AF402312_3 dTDP-6-deoxy-L-mannose-dehydrogenase [Shigella boydii]
 gi|81244829|gb|ABB65537.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Shigella boydii Sb227]
 gi|167410110|gb|ABZ79714.1| RmlD [Escherichia coli]
 gi|332097187|gb|EGJ02170.1| dTDP-4-dehydrorhamnose reductase [Shigella boydii 3594-74]
          Length = 299

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 164/296 (55%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D    +  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNSEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S LD  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLDTEKFQQNFALVLPDWQIGVKRML 290


>gi|212550650|ref|YP_002308967.1| dTDP-4-dehydrorhamnose reductase [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
 gi|212548888|dbj|BAG83556.1| dTDP-4-dehydrorhamnose reductase [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
          Length = 293

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 117/291 (40%), Positives = 163/291 (56%), Gaps = 10/291 (3%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEI--IRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           LV G  GQ+   L+ +  Q  E   I      +DL   K+   F      D IIN AAYT
Sbjct: 6   LVTGAKGQLGCELTKVFTQHSEFNFIPTDIDTLDLTNKKEVIHFVKKHKIDYIINCAAYT 65

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE+E ++ + IN +    I +AA       I+IST+YVFDG+  TP  E   TNP 
Sbjct: 66  AVDKAEEEIDLCYLINRDAVKNIVEAAARGKAKIIHISTNYVFDGVKNTPYIETDITNPQ 125

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YGKSKL GE  +       +I+RT+W+YSI+G NF+  +LRL KE+ EI+VVCDQ GT
Sbjct: 126 SVYGKSKLEGENTLMKNCPESIIIRTSWLYSIYGYNFVKKILRLIKEKSEINVVCDQIGT 185

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A  +A  I+ +    ++ +     GIFH  ++ G VSW DFA+ I   S  +     
Sbjct: 186 PTFAPDLANTILVLI-TFLKKTKNFHSGIFHY-SNEGIVSWFDFAKKILQLSETKN---C 240

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR---NILVN 289
           K+  I T+QYP +A RP YS L+  K+    +I I  W+  ++   N+L N
Sbjct: 241 KIRPITTEQYPIRAKRPFYSALNKKKIKKAFDIVIPNWEVSLKKCINLLTN 291


>gi|300692302|ref|YP_003753297.1| TDP-rhamnose synthetase, NAD(P)-binding [Ralstonia solanacearum
           PSI07]
 gi|299079362|emb|CBJ52034.1| TDP-rhamnose synthetase, NAD(P)-binding [Ralstonia solanacearum
           PSI07]
          Length = 305

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 110/295 (37%), Positives = 157/295 (53%), Gaps = 7/295 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + LV G+NGQ+   L        E+I + R   DL +P           PDVI+NPAAYT
Sbjct: 10  RLLVTGSNGQVGFELRRSLAPLGEVIALDRAACDLTQPDALRRLVREHRPDVIVNPAAYT 69

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE + E AF++N   AG +A+ A ++G   ++ STDYVFDG       E    NP 
Sbjct: 70  AVDKAETDAETAFAVNGTAAGVLAEEARALGSLLVHYSTDYVFDGSKAGAYVESDAVNPQ 129

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YGKSKLAGE+ +A+     ++LRT WV    G NF  +ML+L +ER  + V+ DQFG 
Sbjct: 130 SVYGKSKLAGEQAIAASGAAALVLRTCWVAGAHGGNFAKTMLKLGRERDSLRVIADQFGA 189

Query: 182 PTSALQIARAIIQIAHNLIENSDTSL--RGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PT+A  IA    QI      + D +    G++H+ A  G  +W  +A  +   +  RG  
Sbjct: 190 PTTAALIADVTAQIVARFWLSGDRAAFPGGLYHLAA-AGETTWHGYATAVLRYAKARGLE 248

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                 ++  I    YP  A RPA S ++ +KL  T  I +  W++GV  +L  I
Sbjct: 249 LKVDPERIEAIPATAYPLPAPRPANSRMNTAKLTETFGIHLPDWQQGVHLLLDQI 303


>gi|114321465|ref|YP_743148.1| dTDP-4-dehydrorhamnose reductase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227859|gb|ABI57658.1| dTDP-4-dehydrorhamnose reductase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 306

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 114/299 (38%), Positives = 155/299 (51%), Gaps = 12/299 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI-----DLLKPKDFASFFLSFSPDVII 55
           M+ L+ G NGQ+   L        E+I +GR +      DL      A    S  PD+I+
Sbjct: 1   MRTLLFGPNGQVGWELRRSLAPLGELIPLGRHEWQGLRGDLTDKDAIAHAIRSLRPDLIV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVD+AE EPE A  INA   G +A+ A       I+ STDYVFDG    P  E 
Sbjct: 61  NAAAYTAVDQAESEPEQARLINATAPGVMAELAREQQALFIHYSTDYVFDGSGDRPWHED 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
            PT PLN+YG++K  GEE V +   +++I RTAWVY+  G NF+ +M+RLA +R  + V+
Sbjct: 121 DPTAPLNVYGQTKREGEEAVRAADGHHLIFRTAWVYAARGHNFIRTMIRLACQRDTLQVI 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
            DQ G PT A  IA      A       D  LRG +H+TA  G  +W  +A ++  ++  
Sbjct: 181 NDQHGAPTGAELIADVTAHAARTASTRPD--LRGTYHLTA-AGETTWHGYARFVIEQARA 237

Query: 236 RGGPY----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            G P       +  + T  +PT A RP  S LD  KL  T  ++   W+ GV   L  +
Sbjct: 238 GGAPVRVAPEAIEAVATDAFPTVARRPHNSRLDGHKLETTFGLKRPDWRSGVARALQEM 296


>gi|16611767|gb|AAL27348.1|AF402315_3 dTDP-6-deoxy-L-mannose-dehydrogenase [Shigella boydii]
          Length = 299

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 162/293 (55%), Gaps = 9/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EP+ A  INA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPKFAQLINATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  Y   ++I RT+WVY+  G+NF+ +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEYCAKHLIFRTSWVYAGKGNNFVKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          +   D +  G++H+ A  G  +W D+A  +F E+ + 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPDVA--GLYHLVAS-GTTTWYDYAALVFEEARKA 237

Query: 237 GGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G P +  K+  + T  Y T A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 238 GIPLALNKLNAVPTTAYTTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|332883225|gb|EGK03508.1| dTDP-4-dehydrorhamnose reductase [Dysgonomonas mossii DSM 22836]
          Length = 317

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 164/289 (56%), Gaps = 13/289 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIR-----VGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           LV G+NGQ+   +  +        R     V   DI  L+  DF  F    +   IIN A
Sbjct: 31  LVTGSNGQLGNEIRRISANHENNFRFFFTDVAELDITDLRSVDF--FIKENNIKYIINCA 88

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED+ ++ + IN +    + +AA +     I+ISTDYV+DG +  P  E    
Sbjct: 89  AYTAVDKAEDDVDLCYKINRDAVANLGQAATNNKAKVIHISTDYVYDGTANKPYVETDTV 148

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           NP ++YGKSK  GE ++     + +ILRTAW+YSIFG+NF+ +M++L KER  ++VV DQ
Sbjct: 149 NPQSVYGKSKQEGEAELLKACADSIILRTAWLYSIFGNNFVKTMIKLGKERETLNVVADQ 208

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT+   +A+ I++I       ++    GI+H + +G   +W DF   I  E+   G 
Sbjct: 209 RGTPTNGTDLAKTIVKILD--FSEANGFKPGIYHYSNEGA-TTWYDFTLAIHKEA---GI 262

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              KV  I T+QYP KA RP YS LD +K+ +T N+ I  W+E + N +
Sbjct: 263 NTCKVNPITTEQYPVKATRPKYSVLDKTKIKSTFNLTIPKWEESLNNCI 311


>gi|115503059|gb|ABI98982.1| RmlD [Escherichia coli]
          Length = 300

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKRIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    +IAKAA+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVESIAKAANEVGAWVIHYSTDYVFPGNGDTPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|16765426|ref|NP_461041.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167991011|ref|ZP_02572110.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168242169|ref|ZP_02667101.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194448060|ref|YP_002046146.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197264888|ref|ZP_03164962.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|132498|sp|P26392|RMLD_SALTY RecName: Full=dTDP-4-dehydrorhamnose reductase; AltName:
           Full=dTDP-4-keto-L-rhamnose reductase; AltName:
           Full=dTDP-6-deoxy-L-lyxo-4-hexulose reductase; AltName:
           Full=dTDP-6-deoxy-L-mannose dehydrogenase; AltName:
           Full=dTDP-L-rhamnose synthase
 gi|21730455|pdb|1KBZ|A Chain A, Crystal Structure Of Apo-Dtdp-6-Deoxy-L-Lyxo-4-Hexulose
           Reductase (Rmld) From Salmonella Enterica Serovar
           Typhimurium
 gi|21730457|pdb|1KC1|A Chain A, Crystal Structure Of Dtdp-6-Deoxy-L-Lyxo-4-Hexulose
           Reductase (Rmld) In Complex With Nadph
 gi|21730458|pdb|1KC3|A Chain A, Crystal Structure Of Dtdp-6-Deoxy-L-Lyxo-4-Hexulose
           Reductase (Rmld) In Complex With Nadph And
           Dtdp-L-Rhamnose
 gi|24987882|pdb|1N2S|A Chain A, Crystal Structure Of Dtdp-6-Deoxy-L-Lyxo-4-Hexulose
           Reductase (Rmld) In Complex With Nadh
 gi|47890|emb|CAA40116.1| dTDP-6-deoxy-L-mannose dehydrogenase [Salmonella enterica]
 gi|16420628|gb|AAL21000.1| TDP-rhamnose synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|194406364|gb|ACF66583.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197243143|gb|EDY25763.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|205330551|gb|EDZ17315.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205338312|gb|EDZ25076.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|261247311|emb|CBG25136.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267994150|gb|ACY89035.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301158657|emb|CBW18169.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312913087|dbj|BAJ37061.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321224744|gb|EFX49807.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|323130419|gb|ADX17849.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|332989031|gb|AEF08014.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 299

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 116/299 (38%), Positives = 168/299 (56%), Gaps = 15/299 (5%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQ+G PT A  +A      I++A N  E     + G++H+ A GG  +W D+A  +F E+
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVA-GGTTTWHDYAALVFDEA 234

Query: 234 AERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            + G     +++  + T  YPT A RP  S L+  K     ++ +  W+ GV+ +L  +
Sbjct: 235 RKAGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFDLILPQWELGVKRMLTEM 293


>gi|170019634|ref|YP_001724588.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli ATCC 8739]
 gi|169754562|gb|ACA77261.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli ATCC 8739]
          Length = 299

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 115/296 (38%), Positives = 167/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   + ++  + V   D   D   P+  +       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPLGNLIALDVHSTDYCGDFSNPEGVSETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    +IAKAA+ +G   I+ STDYVF G    P  E +
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVESIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEAN 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|78223675|ref|YP_385422.1| dTDP-4-dehydrorhamnose reductase [Geobacter metallireducens GS-15]
 gi|78194930|gb|ABB32697.1| dTDP-4-dehydrorhamnose reductase [Geobacter metallireducens GS-15]
          Length = 280

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 113/284 (39%), Positives = 159/284 (55%), Gaps = 15/284 (5%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV+G  G + Q L  +   DV  + +   +ID+  P+      L+  P V++N AAYT V
Sbjct: 3   LVVGAKGMLGQDLMRVLPGDVRGVDI--EEIDITSPESVRRVLLTLKPRVVVNCAAYTDV 60

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D  E   ++A  +N +G G +A A   IG   + +STDYVFDG   TP  E    NPL++
Sbjct: 61  DGCETNVDLAMRVNGDGVGHLAAATREIGALLVQVSTDYVFDGTKGTPYVEDDRVNPLSV 120

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YGKSKL GE+K A    +++I+RT W+Y   G NF+ +MLRLA ER EI+VV DQ G+PT
Sbjct: 121 YGKSKLVGEKK-ARENPDHLIVRTQWLYGHGGKNFVETMLRLAGERTEIAVVDDQIGSPT 179

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKV 243
               ++ AI +    LIEN   + RG +H  A+ G  SW +FA  IF E+    G    V
Sbjct: 180 WTADLSLAITE----LIEN---NCRGTYH-AANRGTCSWYEFARAIFAEA----GVGMTV 227

Query: 244 YRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               T++    A RP YS LDC KL +   + +  W+E ++N L
Sbjct: 228 RPQSTEELGRPAPRPLYSVLDCDKLTHDAGLELEDWREALKNYL 271


>gi|149277565|ref|ZP_01883706.1| dTDP-4-dehydrorhamnose reductase [Pedobacter sp. BAL39]
 gi|149231798|gb|EDM37176.1| dTDP-4-dehydrorhamnose reductase [Pedobacter sp. BAL39]
          Length = 288

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 170/286 (59%), Gaps = 15/286 (5%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIR----VGRPDIDLLKPKDFASFFLSFSPDVIINP 57
           + LV G  GQ+ Q L+ +  Q+  +I     + + + D+L     +  F   +P+ +IN 
Sbjct: 3   RILVFGGKGQLGQCLAKVA-QERNMIEMFLFLSQEEGDILDEISLSLLFHRENPEYVINC 61

Query: 58  AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSP 117
           AAYTAVD+AE+E ++   IN  G+  +AK    I    I+ISTD+VF+G     ++E SP
Sbjct: 62  AAYTAVDQAENERDLCELINKTGSINLAKYCQEIKATLIHISTDFVFEGNIPHLLNEESP 121

Query: 118 TNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD 177
           TNP+N+YG++KL GE  +A   N ++I+RT+W+YS  G+NF+ +M RLA ER E+ V+ D
Sbjct: 122 TNPINVYGRTKLDGELGIARLLNEHIIIRTSWLYSEIGNNFMKTMKRLASERTELGVIVD 181

Query: 178 QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
           Q GTPT A+ +A  II I        +    G++H + + G  SW DFA+ IF  S  + 
Sbjct: 182 QAGTPTYAIDLANTIIDIV-----KLNHHKYGVYHYSNE-GVASWYDFAKAIFDISQIK- 234

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
               K+  I+T  YPTKA RP YS +D +K+ +T  ++I  W++ +
Sbjct: 235 ---IKLNPIYTSAYPTKAKRPMYSVMDKTKIKSTFELQIPYWRDSL 277


>gi|226943710|ref|YP_002798783.1| dTDP-4-dehydrorhamnose reductase [Azotobacter vinelandii DJ]
 gi|226718637|gb|ACO77808.1| dTDP-4-dehydrorhamnose reductase [Azotobacter vinelandii DJ]
          Length = 299

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 164/296 (55%), Gaps = 13/296 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK L++G NGQ+   L      +  +EI    R D+D  +P+  A+      P VI+N A
Sbjct: 1   MKILLLGANGQVGWELQRALAPLGRLEICDRLRADLD--RPESLAALVERIQPQVIVNAA 58

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAE +   +  +NAE    +A AA S     ++ STDYVFDG       E  P 
Sbjct: 59  AYTAVDKAESDAARSRRVNAESVEVLADAARSCDAWLVHYSTDYVFDGCKAAAYTEDDPV 118

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            PL++YG++KL GE+ + +    ++ILRT+WVY+  GSNF+ +MLRLA ER E+ V+ DQ
Sbjct: 119 GPLSVYGQTKLEGEQAIQASGCKHLILRTSWVYAARGSNFIKTMLRLAAEREELRVIADQ 178

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLR--GIFHMTADGGPVSWADFAEYIFWESAE- 235
            G PTSA  IA     + + L  +   + +  G++H+TA  G  SW  +A ++  ++A  
Sbjct: 179 IGAPTSAELIADVSALLLYRLRHDRALAEQATGVYHLTA-AGETSWHGYARFVVAKAAAL 237

Query: 236 ----RGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               + GP   ++ I T  YP  A RPA S LD  KL  T ++ +  W+  V  +L
Sbjct: 238 DMSLKAGP-DDIHAIGTADYPLPARRPANSRLDTGKLRRTFDLHLPQWEYHVERML 292


>gi|288559365|ref|YP_003422851.1| dTDP-4-dehydrorhamnose reductase RfbD [Methanobrevibacter
           ruminantium M1]
 gi|288542075|gb|ADC45959.1| dTDP-4-dehydrorhamnose reductase RfbD [Methanobrevibacter
           ruminantium M1]
          Length = 286

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 113/283 (39%), Positives = 162/283 (57%), Gaps = 13/283 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G  G +   L  + +++ ++I  G  D+D+   +    F     P+++IN AAY
Sbjct: 1   MRILITGAYGMLGSDLREV-LKNHDLIATGSKDLDITDEERCIDFIAKERPEIVINAAAY 59

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD  E   + A+++NA G   +A A + I IP ++ISTDYVFDG  RTP+ E     P
Sbjct: 60  TAVDDCETHYDDAYAVNALGPRNLAIACNKIDIPLVHISTDYVFDGTKRTPLIENDKLGP 119

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            + YGK+KLAGEE +   T  Y ILRTAW+Y I G NF+ +ML LAKE  EI+VV DQ G
Sbjct: 120 QSAYGKTKLAGEEFIQENTQKYFILRTAWLYGIHGGNFVKTMLDLAKEHDEITVVNDQIG 179

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT +L +A AI ++        D+   GI+H+T D G  SW DFA+ IF  S       
Sbjct: 180 SPTFSLDLAMAICEVL-------DSDKYGIYHLTND-GECSWYDFAKEIFRISDID---- 227

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
            KV  + T+++P  A RP YS L   K  +   + +  +KE +
Sbjct: 228 VKVIPVSTEEFPRPAPRPHYSVLSNVKWKSAGFVPMRDYKEAL 270


>gi|168481339|gb|ACA24825.1| RmlD [Escherichia coli]
 gi|320198730|gb|EFW73330.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli EC4100B]
          Length = 299

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKRIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    +IAKAA+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVESIAKAANEVGAWVIHYSTDYVFPGNGDTPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|24113425|ref|NP_707935.1| dTDP-4-dehydrorhamnose reductase [Shigella flexneri 2a str. 301]
 gi|30063491|ref|NP_837662.1| dTDP-4-dehydrorhamnose reductase [Shigella flexneri 2a str. 2457T]
 gi|110806009|ref|YP_689529.1| dTDP-4-dehydrorhamnose reductase [Shigella flexneri 5 str. 8401]
 gi|27735226|sp|P37778|RMLD_SHIFL RecName: Full=dTDP-4-dehydrorhamnose reductase; AltName:
           Full=dTDP-4-keto-L-rhamnose reductase; AltName:
           Full=dTDP-6-deoxy-L-lyxo-4-hexulose reductase; AltName:
           Full=dTDP-6-deoxy-L-mannose dehydrogenase; AltName:
           Full=dTDP-L-rhamnose synthase
 gi|294897|gb|AAA53680.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Shigella flexneri]
 gi|24052448|gb|AAN43642.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Shigella flexneri 2a str.
           301]
 gi|30041744|gb|AAP17471.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Shigella flexneri 2a str.
           2457T]
 gi|110615557|gb|ABF04224.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Shigella flexneri 5 str.
           8401]
 gi|281601493|gb|ADA74477.1| dTDP-4-dehydrorhamnose reductase [Shigella flexneri 2002017]
 gi|313649923|gb|EFS14343.1| dTDP-4-dehydrorhamnose reductase [Shigella flexneri 2a str. 2457T]
 gi|332756673|gb|EGJ87022.1| dTDP-4-dehydrorhamnose reductase [Shigella flexneri K-671]
 gi|332756856|gb|EGJ87201.1| dTDP-4-dehydrorhamnose reductase [Shigella flexneri 2747-71]
 gi|332766385|gb|EGJ96594.1| dTDP-4-dehydrorhamnose reductase [Shigella flexneri 2930-71]
 gi|333002465|gb|EGK22027.1| dTDP-4-dehydrorhamnose reductase [Shigella flexneri K-218]
 gi|333002552|gb|EGK22113.1| dTDP-4-dehydrorhamnose reductase [Shigella flexneri VA-6]
 gi|333017170|gb|EGK36491.1| dTDP-4-dehydrorhamnose reductase [Shigella flexneri K-304]
          Length = 299

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 118/297 (39%), Positives = 165/297 (55%), Gaps = 17/297 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EP  A  +NA    AIAKAA+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPNFAQLLNATCVEAIAKAANEVGAWVIHYSTDYVFPGNGDTPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A GG  +W D+A  +F E 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVAANKPE-----VAGLYHLVA-GGTTTWHDYAALVF-EE 233

Query: 234 AERGG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           A R G     +K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 234 ARRAGINLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|186477067|ref|YP_001858537.1| dTDP-4-dehydrorhamnose reductase [Burkholderia phymatum STM815]
 gi|184193526|gb|ACC71491.1| dTDP-4-dehydrorhamnose reductase [Burkholderia phymatum STM815]
          Length = 297

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 115/288 (39%), Positives = 155/288 (53%), Gaps = 13/288 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L+ G NGQ+   L+        I+   R ++DL   +          P +I+NPAAYTAV
Sbjct: 10  LLTGVNGQVGFELARSLQGLGTIVAPRRDELDLSDLEQVRRVVREVKPVLIVNPAAYTAV 69

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE + + A  INAE    +A+ A  +G   ++ STDYVFDG       E    NP+N+
Sbjct: 70  DKAETDVDAAMRINAEAPSVLAEEAKRLGAALVHYSTDYVFDGTKDGAYVESDAVNPINV 129

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKL GE+ +A+    ++I RT+WVY   G NFLL+MLRL  ER E+SVV DQFG PT
Sbjct: 130 YGRSKLEGEQAIAAVGGAHMIFRTSWVYGTRGKNFLLTMLRLGAEREELSVVADQFGAPT 189

Query: 184 SALQIARAIIQIAHNLIENSDT-------SLRGIFHMTADGGPVSWADFAEYIFWESAER 236
            +  IA      AH L + + T          G++H+TA GG  SW  FAE IF  S+ +
Sbjct: 190 WSNTIA---TSTAHVLAQATATDGEQWWREHSGVYHLTA-GGVTSWYGFAEAIFEFSSLQ 245

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
             P   V  I    YPT A RP  S +   KLA    +R   W+E ++
Sbjct: 246 KKP--AVKPIPASAYPTPASRPTNSSMSNDKLAAAFGVRAPDWREALQ 291


>gi|62955958|gb|AAY23334.1| RmlD [Shigella boydii]
          Length = 299

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKRIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    +IAKAA+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVESIAKAANEVGAWVIHYSTDYVFPGNGDTPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|324114027|gb|EGC08000.1| RmlD substrate binding domain-containing protein [Escherichia
           fergusonii B253]
          Length = 299

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 118/299 (39%), Positives = 166/299 (55%), Gaps = 21/299 (7%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI-------DLLKPKDFASFFLSFSPDV 53
           M  L+ G  GQ+   L         +I +   DI       D   P+  A       PDV
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPLGNLIAL---DIHSTEYCGDFSNPEGVAETVKKIRPDV 57

Query: 54  IINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPID 113
           I+N AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G   TP  
Sbjct: 58  IVNAAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGDTPWL 117

Query: 114 EFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREIS 173
           E   T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++
Sbjct: 118 ETDATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELA 177

Query: 174 VVCDQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
           V+ DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F
Sbjct: 178 VINDQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVF 231

Query: 231 WESAERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            E+ + G P +  K+  + T  YPT A RP  S L+  K  +   + +  W+ GV+ +L
Sbjct: 232 EEARKAGIPLALNKLNAVPTIAYPTPACRPHNSRLNTEKFQHNFALVLPDWQVGVKRML 290


>gi|9957821|gb|AAG09503.1|AF279616_2 dTDP-6-deoxy-L-mannose-dehydrogenase [Salmonella enterica]
          Length = 299

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 164/296 (55%), Gaps = 9/296 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLTALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A          ++  + +  G++H+ A GG  +W D+A  +F E+ + 
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVA-GGTTTWHDYAALVFDEARKA 237

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +++  + T  YPT A RP  S L+  K      + +  W+ GV+ +L  +
Sbjct: 238 GITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFGLILPQWELGVKRMLTEM 293


>gi|158423456|ref|YP_001524748.1| dTDP-4-dehydrorhamnose reductase [Azorhizobium caulinodans ORS 571]
 gi|158330345|dbj|BAF87830.1| dTDP-4-dehydrorhamnose reductase [Azorhizobium caulinodans ORS 571]
          Length = 297

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 112/282 (39%), Positives = 165/282 (58%), Gaps = 4/282 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+ L++G +GQ+ + L+++ V+  + +  + R   D+  P   A    +  PDV++N AA
Sbjct: 1   MRVLLLGADGQLGRELTALAVERGLALAALNRAATDITDPVAVAKALEAHKPDVVVNAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE EP++A  +NA   G IA+   S G+P I++STDYVFDG       E  P  
Sbjct: 61  YTAVDKAESEPDLAAKVNAVAPGLIAERCASAGVPLIHVSTDYVFDGTKTGAYVESDPLA 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YG++K AGE  + +    ++ILRTAWVY I+G+NFL +MLRLAK+R  +++V DQ 
Sbjct: 121 PLGVYGRTKAAGEAAIRAAGEKHLILRTAWVYGIYGNNFLKTMLRLAKDRDRLTIVADQR 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PT+   IA  I+  A   +  S  +  G +H+    G  +W  FA+ I   +A   G 
Sbjct: 181 GCPTATRDIAEGILAAAAPAVAGS--ARWGTYHLGGT-GVTTWHGFAQAIIDRAATYTGR 237

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKE 281
             +V  I T +YPT A RPA S LD S    T + R + W++
Sbjct: 238 RPEVAAITTAEYPTPARRPANSELDSSLFERTFHFRAAPWQQ 279


>gi|319638377|ref|ZP_07993139.1| dTDP-4-dehydrorhamnose reductase [Neisseria mucosa C102]
 gi|317400126|gb|EFV80785.1| dTDP-4-dehydrorhamnose reductase [Neisseria mucosa C102]
          Length = 287

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 119/292 (40%), Positives = 168/292 (57%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G  GQ+A+ L     +D E+I      +D+   +       +F PD I+N AAY
Sbjct: 1   MRTLLTGAKGQLARCLRDHLPEDWELIATDSTSLDITDTEAVHHMIKNFQPDAIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE+  E AF++NA     +A AA +     I+ISTDYVFDG  + P  E   TNP
Sbjct: 61  TAVDKAEENAEAAFAVNASAVHNLAAAARAAHARFIHISTDYVFDGEGKRPYRETDYTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            + YG+SK+AGE    +     +I+RT+W++S +GSNF+ +MLRLAKER  +SVV DQ G
Sbjct: 121 RSTYGQSKVAGELLALAAHPESIIIRTSWLFSEYGSNFVKTMLRLAKERDSLSVVHDQTG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT A  +A AII++         TS RGIFH   +    +W +F + IF  + +    +
Sbjct: 181 CPTYAGDLAHAIIELLQQ-----PTSPRGIFHYCGNKS-ATWYEFTKAIFQTAQQLDDSF 234

Query: 241 S--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              ++  I T QYP  A RPAYS +DCS+L     I+ S W++ +R IL  I
Sbjct: 235 RIPELNAITTDQYPLPAPRPAYSIMDCSRLETEFGIKPSDWQKALREILRKI 286


>gi|187730759|ref|YP_001879839.1| dTDP-4-dehydrorhamnose reductase [Shigella boydii CDC 3083-94]
 gi|187427751|gb|ACD07025.1| dTDP-4-dehydrorhamnose reductase [Shigella boydii CDC 3083-94]
          Length = 299

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 161/293 (54%), Gaps = 9/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  P++I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPEIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  INA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLINATSVEAIAKAANEVGAWVIHYSTDYVFPGNGDMPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  Y   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEYCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          +   D +  G++H+ A  G  +W D+A  +F E+ + 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPDVA--GLYHLVAS-GTTTWYDYAALVFEEARKA 237

Query: 237 GGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ + 
Sbjct: 238 GIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRMF 290


>gi|114326769|ref|YP_743926.1| dTDP-4-dehydrorhamnose reductase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114314943|gb|ABI61003.1| dTDP-4-dehydrorhamnose reductase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 301

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 159/278 (57%), Gaps = 2/278 (0%)

Query: 4   LVIGNNGQIAQSLSSMCV-QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
           LV G +GQ+A +L      + V + RVGRP+ D  +P    + F   SP +++N AAYTA
Sbjct: 8   LVTGGSGQVALALEEAAKARGVSVRRVGRPEFDFDRPDSIETVFREVSPSLVVNAAAYTA 67

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VD AE +   A   N +G   +A+     GIP I+ISTDYVFDG    P  E  PTNP  
Sbjct: 68  VDAAESDVAAAERANRDGPARLAELCAVAGIPLIHISTDYVFDGSKGAPYVETDPTNPTG 127

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YG++KLAGE+ V +     ++LRTAWV S  G NF+ +ML  A++   + VV DQ G P
Sbjct: 128 VYGRTKLAGEDAVLATCRQAIVLRTAWVVSHTGKNFVKTMLNAARKTDTLRVVADQQGNP 187

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
           TSA  +A AI+ IA  L +  + +  G  H  A  G  +W   AE +F ++A+ G P   
Sbjct: 188 TSAADLAEAILDIAKKLEKGWNDTYFGPTH-AAGTGATTWHGLAEAVFEQAAKHGAPRPA 246

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
           V+ I T  +PT A RPA S LDC++L     +R+  W+
Sbjct: 247 VHPIKTSDWPTPARRPADSRLDCTRLETVFGVRMPDWQ 284


>gi|299149344|ref|ZP_07042401.1| dTDP-4-dehydrorhamnose reductase [Bacteroides sp. 3_1_23]
 gi|298512531|gb|EFI36423.1| dTDP-4-dehydrorhamnose reductase [Bacteroides sp. 3_1_23]
          Length = 286

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 169/292 (57%), Gaps = 12/292 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ LV G NGQ+   +  +  ++ +         ++D+   +   ++      ++++N A
Sbjct: 1   MRILVTGANGQLGNEMQVLAKENPQHTYYFTDVQELDICDKQAVWTYMAEKQIELVVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED  E+A+ +N E    +A AA + G   I +STDYVFDG + TP  E    
Sbjct: 61  AYTAVDKAEDNQELAYKLNCEAPKQLASAAQANGAAMIQVSTDYVFDGTAHTPYTEDCNP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG +KL GE++V ++    V++RTAW+YSIFG+NF+ +MLRL KER  + VV DQ
Sbjct: 121 CPDSVYGTTKLEGEKEVMNHCEQAVVIRTAWLYSIFGNNFVKTMLRLGKERDSLGVVFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +ARAI  I +  I      +RGI+H + + G  SW DF   I   +   G 
Sbjct: 181 IGTPTYANDLARAIYAIINKGI------VRGIYHFSNE-GVCSWYDFTVAIHRLA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              KV  + T +YP KA+RPAYS LD +K+  T +I I  W+E ++  +  I
Sbjct: 231 TTCKVKPLHTAEYPAKANRPAYSVLDKTKIKTTFDIEIPHWEESLKQCIDKI 282


>gi|313500047|gb|ADR61413.1| DTDP-4-dehydrorhamnose reductase [Pseudomonas putida BIRD-1]
          Length = 301

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 114/299 (38%), Positives = 161/299 (53%), Gaps = 13/299 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRV-GRPDI---DLLKPKDFASFFLSFSPDVIIN 56
           MK L++G +GQ+   L        +++ +  R      DL      A     ++PDVI+N
Sbjct: 1   MKVLLLGKDGQVGWELQRSLAPLGQLLALNARSQAYCGDLANLPGLAETVRVYAPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AAYTAVDKAE + E AF +NA+  G +A+AA   G   ++ STDYVF G    P  E  
Sbjct: 61  AAAYTAVDKAESDREQAFKVNADAVGVLARAAAECGALLVHYSTDYVFPGQGTQPWREDD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
             +PLN YG SKLAGE+ + +    ++I RT WVY+  G+NF  +MLRLA ER  + V+ 
Sbjct: 121 AVDPLNTYGASKLAGEQAIQAAGCQHLIFRTCWVYAARGNNFAKTMLRLAAERDSLGVID 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIEN-SDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           DQ G PT A  IA      AH ++    + SL G++H+ A+ G  +W  +A Y+  ++A 
Sbjct: 181 DQHGAPTGAELIADI---TAHAIVATRRNPSLAGLYHLAAE-GETTWCGYARYVLEQAAV 236

Query: 236 RGGPY----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            G P       V  + T+ YPT A RPA S LD  KL     + +  W+ GV  +L  I
Sbjct: 237 HGVPLKAHAENVTPLTTEAYPTAAMRPANSRLDTHKLQKAFALTLPDWRLGVARMLTEI 295


>gi|302880021|ref|YP_003848585.1| dTDP-4-dehydrorhamnose reductase [Gallionella capsiferriformans
           ES-2]
 gi|302582810|gb|ADL56821.1| dTDP-4-dehydrorhamnose reductase [Gallionella capsiferriformans
           ES-2]
          Length = 295

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 154/294 (52%), Gaps = 7/294 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L++G NGQ+   L        E++ +G    +        +    F+PDVI+N AA+
Sbjct: 1   MKILLLGKNGQVGWELQRSLAPLGEVLALGSDRCNFTDMDGLTNTVRQFAPDVIVNAAAH 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE EPE+A +INA   G +A  A  +G   I+ STDYVFDG    P  E  PT P
Sbjct: 61  TAVDRAESEPELARTINALAPGVLAAEAKRLGAWLIHYSTDYVFDGSGNKPWMETDPTGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L++YG SKL GE  +A     + I RT+WVY   G NF  +MLRLA+ER  + V+ DQ G
Sbjct: 121 LSVYGASKLEGERLIAESGCRHFIFRTSWVYGARGGNFAKTMLRLAQERDSMKVIDDQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT A  +A          + N D +  G++H+ A GG  SW  +A ++   + + G P 
Sbjct: 181 APTGAELLADVSAHAIRTSLVNPDVA--GLYHLVA-GGETSWHGYANFVIDFARQAGVPI 237

Query: 241 S----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                 +  + T  +PT A RP  S L   KL +   + +  W+ GV  +L  +
Sbjct: 238 KVMPDAIEAVPTSAFPTAATRPHNSRLSTGKLTSAFGLHLPHWQVGVTRMLTEV 291


>gi|167032393|ref|YP_001667624.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas putida GB-1]
 gi|166858881|gb|ABY97288.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas putida GB-1]
          Length = 301

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 113/299 (37%), Positives = 162/299 (54%), Gaps = 13/299 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRV-GRPDI---DLLKPKDFASFFLSFSPDVIIN 56
           MK L++G +GQ+   L        +++ +  R      DL      A    +F+PDVI+N
Sbjct: 1   MKVLLLGRDGQVGWELQRSLAPLGQVLALNARSQAHCGDLANLHGLAETVRAFAPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AAYTAVDKAE + E+AF +NAE    +A+AA   G   ++ STDYVF G    P  E  
Sbjct: 61  AAAYTAVDKAESDRELAFRVNAEAVDVLARAAADCGALLVHYSTDYVFPGQGTQPWREDD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
              PLN YG SKLAGE+ + +    +++ RT WVY+  G+NF  +MLRLA ER  + V+ 
Sbjct: 121 AVGPLNTYGASKLAGEQAILAAGCQHLVFRTCWVYAARGNNFAKTMLRLAAERDSLGVID 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIEN-SDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           DQ G PT A  IA      AH +  +  + +L G++H+ A GG  +W  +A Y+  ++A 
Sbjct: 181 DQHGAPTGAELIADI---TAHAITASRRNPALAGLYHLAA-GGETTWCGYARYVLAQAAA 236

Query: 236 RG----GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            G        +V  + T+ YPT A RPA S LD +KL     + +  W+ GV  +L  I
Sbjct: 237 HGVRLKTHAEQVKPLTTEAYPTPAKRPANSRLDTNKLQKAFALTLPDWRLGVARMLTEI 295


>gi|327482468|gb|AEA85778.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas stutzeri DSM 4166]
          Length = 336

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 159/296 (53%), Gaps = 7/296 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M  L++G NGQ+   L         ++   R   DL +P        +  PDVI+N AAY
Sbjct: 8   MSILLLGANGQVGWELQRALAPLGNLLACDRRRADLTRPDQLERLVEAQQPDVIVNAAAY 67

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE EP+ A  INAE  G +A+AA   G   ++ STDY+FDG +     E   T P
Sbjct: 68  TAVDRAESEPQQAHLINAEAVGVLAQAAQRCGALLVHYSTDYIFDGNAIGMQAEDRQTAP 127

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           LN+YG +KL GE  + +   +++ILRT WVY+  G NF  ++LRLA ER E+ +V DQ G
Sbjct: 128 LNVYGCTKLEGERLIRASGCHHLILRTCWVYASRGHNFAKTILRLASEREELRIVADQIG 187

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLR--GIFHMTADGGPVSWADFAEYIFWESAERGG 238
            PTSA  IA     +   +  +   + R  G +H+ A GG  SW ++A YI   +AE G 
Sbjct: 188 APTSAELIADITAIMLLRMANDPGLAQRAYGTYHLAA-GGHTSWHEYACYIVRTAAELGM 246

Query: 239 PY----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            +    S++  + + ++ T A RP  S LD S+L  T  + +  W    R +L  +
Sbjct: 247 QFRTDPSRILAVKSGEFVTAAARPRNSLLDTSRLQETFGLTLPHWTTHARRMLQEV 302


>gi|329902105|ref|ZP_08273032.1| dTDP-4-dehydrorhamnose reductase [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327548871|gb|EGF33498.1| dTDP-4-dehydrorhamnose reductase [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 296

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 111/299 (37%), Positives = 161/299 (53%), Gaps = 13/299 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID----LLKPKDFASFFLSFSPDVIIN 56
           MK L++G  GQ+   L        E+I V     D           A    + +PD+I+N
Sbjct: 1   MKILLLGKGGQVGWELQRSLAPLGELIAVDFDSTDYCGDFTNLSGLADTIRAIAPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A +INA     +A+ A  +G   ++ STDYVFDG    P    S
Sbjct: 61  AAAHTAVDKAESEPELARTINALAPAILAQEAQRLGAWLVHYSTDYVFDGSGTAPWTVTS 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT PL++YG++KL GEE + +    ++I RT+WVY+  G NF  +MLRLAKER  ++V+ 
Sbjct: 121 PTGPLSVYGQTKLEGEEAIGASGCKHLIFRTSWVYAARGGNFARTMLRLAKERDRLTVID 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G PT A  +A          ++  D S  G++H+ A GG  SW  +A ++  + A +
Sbjct: 181 DQIGAPTGADLLADVTAHAIRTALQRPDVS--GLYHLVA-GGQTSWHGYASFVV-DFARQ 236

Query: 237 GGPYSKVYR-----IFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            G   KV +     + T  +PT A RP  S L+  KL  T ++ +  W+ GV  +L  I
Sbjct: 237 AGVDIKVAQEAILPVATSAFPTPATRPNNSLLNTEKLQQTFSLTLPHWQTGVARLLTEI 295


>gi|168236254|ref|ZP_02661312.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194734178|ref|YP_002115185.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194709680|gb|ACF88901.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197290512|gb|EDY29867.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
          Length = 299

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 116/299 (38%), Positives = 167/299 (55%), Gaps = 15/299 (5%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQ+G PT A  +A      I++A N  E     + G++H+ A GG  +W D+A  +F E+
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVA-GGTTTWHDYAALVFDEA 234

Query: 234 AERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            + G     +++  + T  YPT A RP  S L+  K      + +  W+ GV+ +L  +
Sbjct: 235 RKAGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFGLILPQWELGVKRMLTEM 293


>gi|213585954|ref|ZP_03367780.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 291

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 115/293 (39%), Positives = 165/293 (56%), Gaps = 11/293 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+ IG   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANEIGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      Y+I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ATSPLNVYGKTKLAGEKALQDNCPKYLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           DQ+G PT A  +A      AH + +  +   + G++H+ A GG  +W D+A  +F E+ +
Sbjct: 181 DQYGAPTGAELLADC---TAHAIRVTLNKPEVAGLYHLVA-GGTTTWHDYAALVFDEARK 236

Query: 236 RG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
            G     +++  + T  YPT A RP  S L+  K      + +  W+ GV+ +
Sbjct: 237 AGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFGLILPQWELGVKRM 289


>gi|9957840|gb|AAG09518.1|AF279620_2 dTDP-6-deoxy-L-mannose-dehydrogenase [Salmonella enterica]
          Length = 299

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 166/296 (56%), Gaps = 9/296 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ITSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A          ++  + +  G++H+ A GG  +W D+A  +F E+ + 
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVA-GGTTTWHDYAALVFDEARKA 237

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +++  + T  YPT A+RP  S L+  K     ++ +  W+ GV+ +L  +
Sbjct: 238 GITLALTELNAVPTSAYPTSANRPGNSRLNTEKFQRNFDLILPQWELGVKRMLTEM 293


>gi|161613224|ref|YP_001587189.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167551042|ref|ZP_02344797.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|198242562|ref|YP_002216183.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205353239|ref|YP_002227040.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207857532|ref|YP_002244183.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|161362588|gb|ABX66356.1| hypothetical protein SPAB_00934 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197937078|gb|ACH74411.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205273020|emb|CAR37968.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205324048|gb|EDZ11887.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|206709335|emb|CAR33675.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|326623930|gb|EGE30275.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326628326|gb|EGE34669.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 299

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 165/296 (55%), Gaps = 9/296 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A          ++  + +  G++H+ A GG  +W D+A  +F E+ + 
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVA-GGTTTWHDYAALVFDEARKA 237

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +++  + T  YPT A RP  S L+  K     ++ +  W+ GV+ +L  +
Sbjct: 238 GITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFDLILPQWELGVKRMLTEM 293


>gi|156539324|gb|ABU80587.1| dTDP-6-deoxy-L-mannose dehydrogenase [Shigella flexneri]
 gi|156539339|gb|ABU80597.1| dTDP-6-deoxy-L-mannose dehydrogenase [Shigella flexneri]
 gi|168481276|gb|ACA24768.1| RmlD [Shigella flexneri 6]
          Length = 299

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 115/296 (38%), Positives = 165/296 (55%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKRIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    +IAK A+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVESIAKEANEVGAWVIHYSTDYVFPGNGDTPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAAKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|9957816|gb|AAG09499.1|AF279615_2 dTDP-6-deoxy-L-mannose-dehydrogenase [Salmonella enterica]
          Length = 299

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 164/296 (55%), Gaps = 9/296 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A         ++   + +  G++H+ A GG  +W D+A  +F E+ + 
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVVLNKPEVA--GLYHLVA-GGTTTWHDYAALVFDEARKA 237

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +++  + T  YPT A RP  S L+  K      + +  W+ GV+ +L  +
Sbjct: 238 GITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFGLILPQWELGVKRMLTEM 293


>gi|39997461|ref|NP_953412.1| dTDP-4-dehydrorhamnose reductase [Geobacter sulfurreducens PCA]
 gi|39984352|gb|AAR35739.1| dTDP-4-dehydrorhamnose reductase [Geobacter sulfurreducens PCA]
 gi|298506397|gb|ADI85120.1| dTDP-4-dehydrorhamnose reductase [Geobacter sulfurreducens KN400]
          Length = 280

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 112/284 (39%), Positives = 158/284 (55%), Gaps = 15/284 (5%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV+G  G + + L  +   DV  + +   +ID+  P+      L+  P V++N AAYT V
Sbjct: 3   LVVGAKGMLGRDLMRVLPGDVRGVDI--EEIDITSPESVRRVILTLKPRVVVNCAAYTDV 60

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D  E   ++A ++N EG G +A     IG   + +STDYVFDG+  +P  E  P NPL++
Sbjct: 61  DGCETNADLAMAVNGEGVGHLAAVTREIGALLVQMSTDYVFDGVKESPFLEDDPPNPLSV 120

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKL GEE+ A  T +++I+RT W+Y + G NF+ +MLRL+ ER EI+VV DQ G+PT
Sbjct: 121 YGRSKLMGEEQ-ARETPDHLIVRTQWLYGLGGKNFVETMLRLSTERSEIAVVDDQIGSPT 179

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKV 243
             + +A AI      LIEN   + RG +H  A+ G  SW DFA  IF E+    G    V
Sbjct: 180 WTVDLALAI----SELIEN---NCRGTYH-AANRGICSWFDFARAIFAEA----GVEMTV 227

Query: 244 YRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               T Q    A RP YS L C KL     + +  W+E +   L
Sbjct: 228 RPQTTAQLGRPAPRPLYSALCCDKLTRDTGLELEGWREALATYL 271


>gi|188993126|ref|YP_001905136.1| hypothetical protein xccb100_3731 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|14090388|gb|AAK53464.1|AF204145_4 dTDP-4-dehydrorhamnose reductase [Xanthomonas campestris pv.
           campestris]
 gi|167734886|emb|CAP53098.1| rmlD [Xanthomonas campestris pv. campestris]
          Length = 302

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 117/304 (38%), Positives = 157/304 (51%), Gaps = 21/304 (6%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEI---IRVGR-PD------IDLLKPKDFASFFLSFS 50
           M  LV G NGQ+   L      D  +    R GR PD       D   P+   +      
Sbjct: 1   MTTLVFGANGQVGAELLRALAADGAVQATTRSGRLPDGSACETADFDAPETLPALLDRIG 60

Query: 51  PDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT 110
           P +++N AAYTAVD AE +   A   NA+    IA    +  +P ++ STDYVFDG    
Sbjct: 61  PSLVVNAAAYTAVDCAEQDRVSAMRANAQAPLTIAAWCAARDVPLVHYSTDYVFDGQDTA 120

Query: 111 PIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERR 170
           P  E + T+PL +YG++KLAGE  + +    ++ILRTAWVY+  G+NFL +MLR+  ER 
Sbjct: 121 PYLEDAQTSPLGVYGETKLAGENAIRASGAQHLILRTAWVYASHGANFLRTMLRVGAERD 180

Query: 171 EISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
           E+ VV DQ GTPT A  IA     I   L+        G +H+TA  G  SW  FAE IF
Sbjct: 181 ELRVVADQIGTPTPAALIA----DITAQLLRQRTAETSGTWHLTA-AGQTSWHGFAEAIF 235

Query: 231 WESAERG----GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
            E+   G     P  +V  I T  YPT A RPAYS L   KL    +I +  W+ G++ +
Sbjct: 236 EEAVSAGLLPRAP--RVVPITTADYPTPAKRPAYSRLSIEKLQRDFDIVLPEWRPGLQRV 293

Query: 287 LVNI 290
           +  +
Sbjct: 294 IAEV 297


>gi|226290772|gb|ACO40471.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Dakar]
 gi|298353034|gb|ADI77013.1| RmlD [Salmonella enterica]
          Length = 299

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 166/296 (56%), Gaps = 9/296 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ITSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A          ++  + +  G++H+ A GG  +W D+A  +F E+ + 
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVA-GGTTTWHDYAALVFDEARKA 237

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +++  + T  YPT A+RP  S L+  K     ++ +  W+ GV+ +L  +
Sbjct: 238 GITLALTELNAVPTSAYPTPANRPGNSRLNTEKFQRNFDLILPQWELGVKRMLTEM 293


>gi|268593348|ref|ZP_06127569.1| dTDP-4-dehydrorhamnose reductase [Providencia rettgeri DSM 1131]
 gi|291311045|gb|EFE51498.1| dTDP-4-dehydrorhamnose reductase [Providencia rettgeri DSM 1131]
          Length = 290

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 165/289 (57%), Gaps = 7/289 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ LV G+ GQ+   L      + E++ +    +D+            F P++IIN AAY
Sbjct: 1   MRVLVTGSKGQVGHCLEEQLTNETELLALDSTQLDITDKAAVFRIISEFKPNIIINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE E + + +IN +G   +AKAA  IG   ++ISTDYVF G    P  E   TNP
Sbjct: 61  TAVDRAEQEIKQSENINIKGPEYLAKAAHHIGAAILHISTDYVFGGDKELPYTENDITNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YG++KL GE  V +    ++ILRT+WV+S  G+NF+ +ML+LA ER  +S+V DQ+G
Sbjct: 121 KSVYGQTKLNGEVAVINSCPRHIILRTSWVFSQHGNNFVKTMLQLAAERTNLSIVSDQYG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A  IA  +I +A  +  N+     GI+H +  G P VSW +FA+YIF ++  +   
Sbjct: 181 GPTDAADIASTLINLAERIHYNNFEGY-GIYHYS--GFPYVSWYEFAQYIFEQATNKKII 237

Query: 240 YSK--VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
            +K  V  I T  YPT A RP  S LD +K+     I  S W+  ++ I
Sbjct: 238 LTKPLVNAIKTTDYPTAAMRPHNSRLDLTKI-QLLGINASNWQLSLQQI 285


>gi|71907371|ref|YP_284958.1| dTDP-4-dehydrorhamnose reductase [Dechloromonas aromatica RCB]
 gi|71846992|gb|AAZ46488.1| dTDP-4-dehydrorhamnose reductase [Dechloromonas aromatica RCB]
          Length = 320

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 110/297 (37%), Positives = 162/297 (54%), Gaps = 14/297 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L++G +GQ+   L        +++  GR   DL       S      P VI+N  AY
Sbjct: 18  MKILLLGKDGQVGWQLQRSLAPHGDVVACGRAQCDLSDLAQIRSVVRETRPSVIVNATAY 77

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE+A  INA+  G +A+ A  +    ++ STDYV+DG   +   E   T P
Sbjct: 78  TAVDKAESEPELARRINADAPGVLAEEAAQLNALLVHYSTDYVYDGAKASAYLETDVTAP 137

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YG++KLAGEE + +     +I RT+WV+   G NF+ ++LRLA+E+  ++VV DQ G
Sbjct: 138 QSVYGRTKLAGEEAIRAAGGKSLIFRTSWVFGARGGNFVKTILRLAREKESLNVVADQIG 197

Query: 181 TPTSALQIAR----AIIQIAH-NLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           +PT A  IA     A+  + H  L+E S++ L   +H+ A   PVSW DFA  I   + +
Sbjct: 198 SPTPAALIATVTGIALAMLQHGKLLEKSESRL---YHLAAS-RPVSWCDFARTIVGLAGQ 253

Query: 236 RGG-----PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             G         +  I T +YPT A RPA S LDC +L N   +++  W+  +  +L
Sbjct: 254 APGFDLRLKSGAIQAISTAEYPTPACRPANSRLDCGRLENDFGLQMPDWQPYLERML 310


>gi|126741095|ref|ZP_01756777.1| dTDP-4-dehydrorhamnose reductase [Roseobacter sp. SK209-2-6]
 gi|126717859|gb|EBA14579.1| dTDP-4-dehydrorhamnose reductase [Roseobacter sp. SK209-2-6]
          Length = 287

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 118/288 (40%), Positives = 164/288 (56%), Gaps = 13/288 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G  GQ+A+ L++       +  +GR + DL  P   A+   + +P  +IN AAYTAV
Sbjct: 8   LVFGKTGQLARELAAY----DNVTCLGRGEADLTDPAACAAAIKAHAPAAVINAAAYTAV 63

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE+E  +A  IN E  GA+A+A  ++GIP + +STDYVFDG   TP        P+N 
Sbjct: 64  DKAEEEEALATVINGESPGAMAEACAALGIPFVTVSTDYVFDGSGTTPWQAGDAVAPVNA 123

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKLAGEE   +    + ILR +WV S  G NF+ +MLRL  ER  ++++ DQ G PT
Sbjct: 124 YGRSKLAGEEATRAAGGTHAILRCSWVVSCHGGNFVKTMLRLGAEREALTIIADQIGAPT 183

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGPYSK 242
            A  +ARA +++A  L ++   S  G +H+   G P VSWA FA  IF ++         
Sbjct: 184 PARDLARACLEMAGQLQQDPGKS--GTYHL--QGRPEVSWAGFAREIFAQA----NVACT 235

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           V  I T  YPT A RP  S LDC+ L N   I    W++G+  IL ++
Sbjct: 236 VTDIPTTDYPTPAARPLNSRLDCTALENVFGISQPDWRQGLSEILKDL 283


>gi|30249026|ref|NP_841096.1| dTDP-4-dehydrorhamnose reductase [Nitrosomonas europaea ATCC 19718]
 gi|30138643|emb|CAD84934.1| dTDP-4-dehydrorhamnose reductase [Nitrosomonas europaea ATCC 19718]
          Length = 304

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 112/298 (37%), Positives = 163/298 (54%), Gaps = 11/298 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI----DLLKPKDFASFFLSFSPDVIIN 56
           +K L+ G NGQ+   L        E+I   + D+    DL           +  PD+I+N
Sbjct: 8   IKILLFGKNGQVGWELQRSLAPLGELIAPDKQDLRYCGDLADLAGITHTLQTIRPDIIVN 67

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AAYTAVD+AE EPE+AF INAE    +A+ A+ IG   I+ STDYVF+G    P  E  
Sbjct: 68  AAAYTAVDQAESEPELAFRINAEAPELLAQQAEQIGAWLIHYSTDYVFNGNGNCPWQETD 127

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+P+NIYG SKL GEE++      Y+ILRT+WVY+  G NF+ ++LRLA+E+ +++++ 
Sbjct: 128 LTSPINIYGLSKLRGEEQIRKSNCKYMILRTSWVYAARGKNFIKTILRLAREKEQLTIID 187

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G PT A  +A    Q    L+E  D S  G++H+ A    VSW  +A ++   + E 
Sbjct: 188 DQIGAPTGAELLADITAQAIPQLLEYPDKS--GVYHVAA-SEEVSWYSYARFLLDFAREH 244

Query: 237 GGPYS----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             P       V  + ++ + T A RP  S L+  K  NT  + +  W+ GV  +L  I
Sbjct: 245 DIPIKVHPDAVIPVHSEAFVTAARRPLNSRLNTEKFCNTFQLCLPHWQTGVTRVLEEI 302


>gi|183597262|ref|ZP_02958755.1| hypothetical protein PROSTU_00506 [Providencia stuartii ATCC 25827]
 gi|188023577|gb|EDU61617.1| hypothetical protein PROSTU_00506 [Providencia stuartii ATCC 25827]
          Length = 297

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 114/297 (38%), Positives = 166/297 (55%), Gaps = 11/297 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID----LLKPKDFASFFLSFSPDVIIN 56
           MK L++G NGQ+   L    +   E+I + R   D    L K  D A       PDVI+N
Sbjct: 1   MKILLLGKNGQVGWELQRALLPLGELIALDRHSKDYCGDLSKLNDLAETIELLQPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AAYTAVDKAE EP+++  IN+E    +A+ A+ +    I+ STDYVF G      +E  
Sbjct: 61  AAAYTAVDKAESEPDVSKLINSEAVKILAQCAEKVNALLIHYSTDYVFSGEGEHFWNEDD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+ LNIYG++KL GE+ +  Y  N++ILRT+WVYS FG+NF  ++L LAK R ++S++ 
Sbjct: 121 QTSALNIYGQTKLEGEQYIQKYCPNHLILRTSWVYSTFGNNFAKTILNLAKNREKLSIIS 180

Query: 177 DQFGTPTSALQIARAI-IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           DQ+G PTSA  IA    I +   L +       GI+H+ A  G  +W ++A+ I  E+ +
Sbjct: 181 DQYGAPTSAALIADCTAIALVKTLQQKEKC---GIYHLVA-SGETNWYEYAKLITEEAKK 236

Query: 236 RGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                S  ++  I   +YP  A RP  S ++ SK   + NI +  WK GV  ++  I
Sbjct: 237 NNIKLSLNEINPISATEYPLPAKRPYNSRMNSSKFKKSFNIELPDWKIGVIRLIKEI 293


>gi|16611738|gb|AAL27323.1|AF402313_3 dTDP-6-deoxy-L-mannose-dehydrogenase [Shigella boydii]
          Length = 299

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 115/296 (38%), Positives = 163/296 (55%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAK A+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKTANEVGAWVIHYSTDYVFPGTGEIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLNIYG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNIYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F  +
Sbjct: 181 DQFGAPTGAELLADCTAHAIRMALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEAA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RNAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|121606379|ref|YP_983708.1| dTDP-4-dehydrorhamnose reductase [Polaromonas naphthalenivorans
           CJ2]
 gi|120595348|gb|ABM38787.1| dTDP-4-dehydrorhamnose reductase [Polaromonas naphthalenivorans
           CJ2]
          Length = 296

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 107/298 (35%), Positives = 165/298 (55%), Gaps = 11/298 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGR--PDI--DLLKPKDFASFFLSFSPDVIIN 56
           MK L++G NGQI   L        E++ + R   D+  DL      A    +  PDVI+N
Sbjct: 1   MKILLLGKNGQIGWELQRSLAPLGEVVALDRHSQDLCGDLADLPGLARTVQAVRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE E E+  +INA   G +A+ A  +G   ++ STDYVFDG    P  E  
Sbjct: 61  AAAHTAVDRAESESELVRTINALAPGMLAQEASKLGAWLVHYSTDYVFDGSGSRPWVESD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
              PL++YG+SKL GE+ +A +   ++ILRT+WVY+  G NF  +MLRLA+ER  ++V+ 
Sbjct: 121 TPAPLSVYGQSKLEGEQLIAEHCQRHLILRTSWVYAARGGNFAKTMLRLAQERERLTVID 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A          ++    +  G++H+ A  G  +W  +A+++  ++A  
Sbjct: 181 DQWGAPTGAELLADVTAHAIRQALQCPQDA--GLYHLAAS-GETTWNGYAKHVIAQAARA 237

Query: 237 GGPY----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                   + V  + T  +PT A RP  S LDC++L  T  +++  W++GV  +L  I
Sbjct: 238 QTAIKIVANDVAAVPTSAFPTPARRPHNSRLDCTRLQTTFGLKLPPWQQGVDRMLAEI 295


>gi|315921705|ref|ZP_07917945.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313695580|gb|EFS32415.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 283

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 162/286 (56%), Gaps = 12/286 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           +V G NGQ+   +  +  ++ +         ++++   +   ++      ++++N AAYT
Sbjct: 1   MVTGANGQLGNEMQVLAKENPQHTYYFTDVEELNICDKQAVWAYIAEKRIELVVNCAAYT 60

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAED  E+A+ +N E    +A AA   G   I +STDYVFDG + TP  E     P 
Sbjct: 61  AVDKAEDNSELAYQLNCEAPKQLASAAQFNGAAMIQVSTDYVFDGTAHTPYTEDCDPCPD 120

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG +KL GE  V +Y    V++RTAW+YSIFG+NF+ +M+RL KER  + VV DQ GT
Sbjct: 121 SVYGTTKLEGEYDVMNYCEKAVVIRTAWLYSIFGNNFVKTMIRLGKERDSLGVVFDQIGT 180

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A  +ARAI  I +  I      +RGI+H + + G  SW DF   I   +   G    
Sbjct: 181 PTYANDLARAIYTIINKGI------VRGIYHFSNE-GVCSWYDFTVAIHRLA---GITSC 230

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           KV  + T +YP KA+RPAYS LD +K+  T  I I  W+E ++  L
Sbjct: 231 KVKPLHTAEYPAKANRPAYSVLDKTKIKTTFGIEIPHWEESLQRCL 276


>gi|9957846|gb|AAG09523.1|AF279621_2 dTDP-6-deoxy-L-mannose-dehydrogenase [Salmonella enterica]
          Length = 299

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 116/299 (38%), Positives = 167/299 (55%), Gaps = 15/299 (5%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ITSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQ+G PT A  +A      I++A N  E     + G++H+ A GG  +W D+A  +F E+
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVA-GGTTTWHDYAALVFDEA 234

Query: 234 AERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            + G     +++  + T  YPT A RP  S L+  K      + +  W+ GV+ +L  +
Sbjct: 235 RKAGLTLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFGLILPQWELGVKRMLTEM 293


>gi|168481305|gb|ACA24794.1| RmlD [Escherichia coli]
          Length = 299

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 114/296 (38%), Positives = 163/296 (55%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID----LLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L    V    +I +     D       P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALVPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EP+ A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPKFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEED 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCVKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWYDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            +   P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKADIPLALNKLNAVPTTAYPTSARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|294341172|emb|CAZ89573.1| dTDP-4-dehydrorhamnose reductase (dTDP-4-keto-L-rhamnose reductase)
           (dTDP-6-deoxy-L-mannose dehydrogenase) (dTDP-L-rhamnose
           synthetase) [Thiomonas sp. 3As]
          Length = 302

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 110/294 (37%), Positives = 162/294 (55%), Gaps = 9/294 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G +GQ+   L    +   ++  + R   DL       +      P++I+N AAYT
Sbjct: 5   RILLLGADGQVGWELRRALLPLGDVRPLNRTQADLGDLDALRTVLQREQPELIVNAAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTP--IDEFSPTN 119
           AVDKAE +PE+A  INA   G +A  A       ++ STDYVFDG    P    E    N
Sbjct: 65  AVDKAETDPELAQRINAAAPGVLAAWAAEHHAMLVHYSTDYVFDGAKPAPGSYTEADTPN 124

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P + YG+SKLAGE+ + +    ++ILRT+WVY+  G NF  +ML+LA ER  + V+ DQF
Sbjct: 125 PQSAYGRSKLAGEQAITASGCRHLILRTSWVYAARGGNFAKTMLKLATERDSLRVIADQF 184

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLR--GIFHMTADGGPVSWADFAEYIFWESAERG 237
           G PTSA  +A     + H L  +S  + +  G++H+TA G   SW  +A+++   +A RG
Sbjct: 185 GAPTSAELLADVTALMLHRLRTDSALAQQASGLYHLTAQGS-TSWHGYAQFVIARAAARG 243

Query: 238 GPY----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            P      +V  I T  YP  A RPA S LDCSKL  T ++ +  W+  V+ ++
Sbjct: 244 LPLRCAPEQVQAITTADYPLPAPRPANSRLDCSKLQTTFDLFLPPWQTQVQRLI 297


>gi|283785860|ref|YP_003365725.1| dTDP-4-dehydrorhamnose reductase [Citrobacter rodentium ICC168]
 gi|282949314|emb|CBG88925.1| dTDP-4-dehydrorhamnose reductase [Citrobacter rodentium ICC168]
          Length = 299

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 167/294 (56%), Gaps = 11/294 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   + ++  + V   D   D   P+          PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPLGNLIALDVRSTDYCGDFSDPEGVVETVRRIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE E E A  +NA+   AIAKAA  +G   ++ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAETEVEFAQLLNAKSVEAIAKAAQEVGAWVVHYSTDYVFPGTGETPWRETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ + ++ + ++I RT+WVY+  G+NF  +MLRLAKER E+SV+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQTHCSRHLIFRTSWVYAGKGNNFAKTMLRLAKERTEMSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           DQFG PT A  +A      AH + +      + G++H+ A  G  +W D+A +IF E+ +
Sbjct: 181 DQFGAPTGAELLADC---TAHAIRVAMVKPEVAGLYHLVAS-GTTTWYDYASFIFAEARK 236

Query: 236 RGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            G   +   +  + T  YPT A RPA S L+  K   + ++ +  W+ GV+ +L
Sbjct: 237 AGMNLALRDLKAVPTSAYPTPARRPANSRLNTDKFQQSFDLVLPQWEAGVKRML 290


>gi|168229418|ref|ZP_02654476.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168259600|ref|ZP_02681573.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168466246|ref|ZP_02700116.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|194442608|ref|YP_002041366.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194468557|ref|ZP_03074541.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194401271|gb|ACF61493.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194454921|gb|EDX43760.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|195631278|gb|EDX49838.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|205335940|gb|EDZ22704.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205351277|gb|EDZ37908.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 299

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 164/296 (55%), Gaps = 9/296 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A          ++  + +  G++H+ A GG  +W D+A  +F E+ + 
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVA-GGTTTWHDYAALVFDEARKA 237

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +++  + T  YPT A RP  S L+  K      + +  W+ GV+ +L  +
Sbjct: 238 GITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFGLILPQWELGVKRMLTEM 293


>gi|333003380|gb|EGK22924.1| dTDP-4-dehydrorhamnose reductase [Shigella flexneri K-272]
 gi|333017210|gb|EGK36530.1| dTDP-4-dehydrorhamnose reductase [Shigella flexneri K-227]
          Length = 299

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 118/297 (39%), Positives = 165/297 (55%), Gaps = 17/297 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EP  A  +NA    AIAKAA+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPNFAQLLNATCVEAIAKAANEVGAWVIHYSTDYVFPGNGDTPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A GG  +W D+A  +F E 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVAANKPE-----VAGLYHLVA-GGTTTWHDYAALVF-EE 233

Query: 234 AERGG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           A R G     +K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 234 ARRVGINLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|323936934|gb|EGB33217.1| RmlD substrate binding domain-containing protein [Escherichia coli
           E1520]
          Length = 299

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 164/297 (55%), Gaps = 17/297 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    +IAKAA+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVESIAKAANEVGAWVIHYSTDYVFPGTGDTPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVF-EE 233

Query: 234 AERGG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           A + G      K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 234 ARKAGIALALHKLNAVPTSAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|261868368|ref|YP_003256290.1| hypothetical protein D11S_1708 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413700|gb|ACX83071.1| hypothetical protein D11S_1708 [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 294

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 116/290 (40%), Positives = 165/290 (56%), Gaps = 8/290 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQD--VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           + L+ G  GQ+ +SL+ + V +   E++ +   ++D+       S   SF P+VIIN AA
Sbjct: 3   RLLITGAGGQLGRSLAKLLVDNGRYEVLALDFSELDITNKDMVFSIIDSFKPNVIINAAA 62

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT+VD+AE E   A+S+N  G   +A+AA       +++STDYVFDG       E    +
Sbjct: 63  YTSVDQAELEVSSAYSVNVRGVQYLAEAAIRHNSAILHVSTDYVFDGYKSGKYKETDIIH 122

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YGKSK  GE  + + +   +ILRT+W +  +G+NF+ +MLRLAK R  + VV DQ 
Sbjct: 123 PLCVYGKSKAEGERLLLTLSPKSIILRTSWTFGEYGNNFVKTMLRLAKNRDILGVVADQI 182

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG- 237
           G PT +  IA  +IQIA  +I   +T   GI+H T  G P VSW DFA  IF E+  +  
Sbjct: 183 GGPTYSGDIASVLIQIAEKIIVG-ETVKYGIYHFT--GEPCVSWYDFAIAIFDEAVAQKV 239

Query: 238 -GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
                 V  I T  YPT A RPA SCLD +K+     I+ S W+  ++NI
Sbjct: 240 LEDVPLVNAITTADYPTLAKRPANSCLDLTKIQQAFGIQPSDWQRALKNI 289


>gi|9957856|gb|AAG09531.1|AF279623_2 dTDP-6-deoxy-L-mannose-dehydrogenase [Salmonella enterica]
          Length = 299

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 164/296 (55%), Gaps = 9/296 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ITSPLNVYGKTKLAGEKALQDNGPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A          ++  + +  G++H+ A GG  +W D+A  IF E+ + 
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVA-GGTTTWHDYAALIFDEARKA 237

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +++  + T  YPT A RP  S L+  K      + +  W+ GV+ +L  +
Sbjct: 238 GITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFGLILPQWELGVKRMLTEM 293


>gi|207728134|ref|YP_002256528.1| dtdp-4-dehydrorhamnose reductase protein [Ralstonia solanacearum
           MolK2]
 gi|206591379|emb|CAQ56991.1| dtdp-4-dehydrorhamnose reductase protein [Ralstonia solanacearum
           MolK2]
          Length = 305

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 109/295 (36%), Positives = 155/295 (52%), Gaps = 7/295 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + LV G+NGQ+   L        E+I + R   DL +P           PDVI+NPAAYT
Sbjct: 10  RLLVTGSNGQVGFELRRSLAPLGEVIALDRAACDLTQPDALRRLVREHRPDVIVNPAAYT 69

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE + + AF++N   AG +A+ A ++G   ++ STDYVFDG       E    NP 
Sbjct: 70  AVDKAETDADTAFAVNGTAAGVLAEEARALGSLLVHYSTDYVFDGTKAGAYLETDAVNPQ 129

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YGKSKLAGE+ +A+     ++LRT WV    G NF  +ML+L +ER  + V+ DQFG 
Sbjct: 130 SVYGKSKLAGEQAIAASGAAALVLRTCWVAGAHGGNFAKTMLKLGRERDSLRVIADQFGA 189

Query: 182 PTSALQIARAIIQIAHNLIENSDTSL--RGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PT+A  IA    QI      + D +    G++H+ A  G  +W  +A  +   +  RG  
Sbjct: 190 PTTAALIADVTAQIVARFWLSGDRAAFPGGLYHLAAS-GETTWHGYATAVLRYAKARGLE 248

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                 ++  I    YP  A RPA S +   KL  T  I +  W++GV  +L  I
Sbjct: 249 LKVDPERIEAIPATAYPLPAPRPANSRMQTGKLTETFGIHLPDWQQGVHLLLDQI 303


>gi|83944593|ref|ZP_00957043.1| hypothetical protein EE36_00250 [Sulfitobacter sp. EE-36]
 gi|83844570|gb|EAP82457.1| hypothetical protein EE36_00250 [Sulfitobacter sp. EE-36]
          Length = 288

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 118/291 (40%), Positives = 163/291 (56%), Gaps = 9/291 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G++GQ+A  L ++   DV+I  + R D DL  P   A+   + +PD +IN AAY
Sbjct: 1   MKILVFGHSGQVATELRALDGDDVQITALARADADLTDPAACAAAIDARAPDAVINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE + + A  INA+   A+A+A  +  IP + ISTDYVF G   TP      T+P
Sbjct: 61  TAVDKAESDTDTAQIINADAPAAMAQACAAHDIPFVSISTDYVFSGAEDTPWAPADATDP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YG++K  GE  +      Y +LRT+WV S  G+NF+ +MLRL  ER  +++V DQ G
Sbjct: 121 QSVYGRTKRDGEVAIVKAGGRYAVLRTSWVVSAHGNNFVKTMLRLGAEREALTIVADQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A +IA+A + I   LI     S  GI+H +  G P  SWADFA  IF    +    
Sbjct: 181 GPTGAAEIAQACVIIVKTLISQPRKS--GIYHFS--GAPDTSWADFARAIF----DAAKI 232

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V  I +  YPT A RP  S LDC+       I    W+E + +IL+ +
Sbjct: 233 PCAVTDIPSTDYPTPAKRPQNSRLDCTTTDAAFGISRPDWRESLTHILLKL 283


>gi|255263484|ref|ZP_05342826.1| dTDP-4-dehydrorhamnose reductase [Thalassiobium sp. R2A62]
 gi|255105819|gb|EET48493.1| dTDP-4-dehydrorhamnose reductase [Thalassiobium sp. R2A62]
          Length = 293

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 117/293 (39%), Positives = 161/293 (54%), Gaps = 14/293 (4%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + LV G  GQ+A  L      +     +GR D DL  P   A+   +  P  +IN AA+T
Sbjct: 7   RILVFGKTGQVATELRQRAGTNC----LGRADADLSDPAACAATIRAHHPTAVINAAAFT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE E  +A  INAE   A+A A   +GIP ++ISTDYVFDG    P +    T+P 
Sbjct: 63  AVDQAEAEEPLAHVINAEAPSAMALACAELGIPFLHISTDYVFDGSGTAPWNPSDATSPQ 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           N YG++KLAGE  V +    + ILRT+WV+S  G+NF+ +MLRL++ R  ++VV DQ G 
Sbjct: 123 NAYGRTKLAGEVAVRAAGGTHAILRTSWVFSAHGANFVKTMLRLSETRDALNVVHDQIGG 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRG---IFHMTADGGP-VSWADFAEYIFWESAERG 237
           PT A  IA A++ +A  +IE +  +  G    +H    G P  SW +FA  IF  +   G
Sbjct: 183 PTPAADIADALLIMARAMIEGATDATGGTASTYHYA--GNPATSWENFASEIFGTA---G 237

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            P S V  I T  YPT A RP  S LDC+ L     I    W+  + +I+  +
Sbjct: 238 RPVS-VTGIPTADYPTPAARPLNSRLDCASLQADFGISPPDWRAALADIIPTL 289


>gi|300704903|ref|YP_003746506.1| tdp-rhamnose synthetase, NAD(P)-binding [Ralstonia solanacearum
           CFBP2957]
 gi|299072567|emb|CBJ43917.1| TDP-rhamnose synthetase, NAD(P)-binding [Ralstonia solanacearum
           CFBP2957]
          Length = 305

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 109/295 (36%), Positives = 155/295 (52%), Gaps = 7/295 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + LV G+NGQ+   L        E+I + R   DL +P           PDVI+NPAAYT
Sbjct: 10  RLLVTGSNGQVGFELRRSLAPLGEVIALDRAACDLTQPDALRRLVREHRPDVIVNPAAYT 69

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE + + AF++N   AG +A+ A ++G   ++ STDYVFDG       E    NP 
Sbjct: 70  AVDKAETDADTAFAVNGTAAGVLAEEARALGSLLVHYSTDYVFDGTKAGAYVETDTVNPQ 129

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YGKSKLAGE+ +A+     ++LRT WV    G NF  +ML+L +ER  + V+ DQFG 
Sbjct: 130 SVYGKSKLAGEQAIAASGAAALVLRTCWVAGAHGGNFAKTMLKLGRERDSLRVIADQFGA 189

Query: 182 PTSALQIARAIIQIAHNLIENSDTSL--RGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PT+A  IA    QI      + D +    G++H+ A  G  +W  +A  +   +  RG  
Sbjct: 190 PTTAALIADVTAQIVARFWLSGDRAAFPGGLYHLAAS-GETTWHGYATAVLRYAKARGLE 248

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                 ++  I    YP  A RPA S +   KL  T  I +  W++GV  +L  I
Sbjct: 249 LKVDPERIEAIPATAYPLPAPRPANSRMQTGKLTETFGIHLPDWQQGVHLLLDQI 303


>gi|197249923|ref|YP_002147054.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197213626|gb|ACH51023.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
          Length = 299

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 164/296 (55%), Gaps = 9/296 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLISLDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A          ++  + +  G++H+ A GG  +W D+A  +F E+ + 
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVA-GGTTTWHDYAALVFDEARKA 237

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +++  + T  YPT A RP  S L+  K      + +  W+ GV+ +L  +
Sbjct: 238 GITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFGLILPQWELGVKRMLTEM 293


>gi|294644907|ref|ZP_06722643.1| dTDP-4-dehydrorhamnose reductase [Bacteroides ovatus SD CC 2a]
 gi|294808802|ref|ZP_06767532.1| dTDP-4-dehydrorhamnose reductase [Bacteroides xylanisolvens SD CC
           1b]
 gi|292639720|gb|EFF58002.1| dTDP-4-dehydrorhamnose reductase [Bacteroides ovatus SD CC 2a]
 gi|294443974|gb|EFG12711.1| dTDP-4-dehydrorhamnose reductase [Bacteroides xylanisolvens SD CC
           1b]
          Length = 288

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 168/292 (57%), Gaps = 12/292 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ LV G NGQ+   +  +  ++ +         ++D+   +   ++      ++++N A
Sbjct: 1   MRILVTGANGQLGNEMQVLAKENPQHTYYFTDVQELDICDKQAVWTYMAEKQIELVVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED  E+A+ +N E    +A AA + G   I +STDYVFDG   TP  E    
Sbjct: 61  AYTAVDKAEDNQELAYKLNCEAPKQLASAAQANGAAMIQVSTDYVFDGTVHTPYTEDCDP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG +KL GE++V ++    V++RTAW+YS FG+NF+ +M+RL KER  + VV DQ
Sbjct: 121 CPDSVYGTTKLEGEKEVMNHCEQAVVIRTAWLYSTFGNNFVKTMIRLGKERDSLGVVFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +ARAI  I +  I      +RGI+H + + G  SW DF   I   +   G 
Sbjct: 181 IGTPTYANDLARAIYTIINKGI------VRGIYHFSNE-GVCSWYDFTVAIHRLA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              KV  + T +YP KA+RPAYS LD +K+  T +I I  W+E ++  L+ +
Sbjct: 231 TTCKVKPLHTAEYPAKANRPAYSVLDKTKIKTTFDIEIPHWEESLKQCLIKL 282


>gi|304407807|ref|ZP_07389458.1| dTDP-4-dehydrorhamnose reductase [Paenibacillus curdlanolyticus
           YK9]
 gi|304343290|gb|EFM09133.1| dTDP-4-dehydrorhamnose reductase [Paenibacillus curdlanolyticus
           YK9]
          Length = 290

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 105/292 (35%), Positives = 162/292 (55%), Gaps = 15/292 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRV---GRPDIDLLKPKDFASFFLSFSPDVIINP 57
            + LV G NGQ+ + ++     + E + +   GR ++D+       +   +F+P  +I+ 
Sbjct: 8   FRVLVTGANGQLGREIALWATAEAEGLDIRGYGRDELDITDLSQCRAVITAFAPHAVIHC 67

Query: 58  AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSP 117
           AAYTAVD+AE +P+ AF +NA G   IA AA   G    Y+STDYVFDG S  P +E+  
Sbjct: 68  AAYTAVDQAEADPDSAFVVNATGTRNIALAAREAGAKLAYVSTDYVFDGSSAVPYNEYDR 127

Query: 118 TNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD 177
            NP  +YGKSKLAGEE V +  + + ++RT+WVY  +G+NF+ +M+++  ER  + VV D
Sbjct: 128 PNPRTVYGKSKLAGEELVRTLHDRHFVVRTSWVYGAYGANFVKTMIKVGAERGAVKVVHD 187

Query: 178 QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
           Q G+PT    +A  ++++         T   G++H + + G  SW +FA  IF ES    
Sbjct: 188 QIGSPTCTFDLAAMLLELVR-------TDAYGVYHAS-NSGTCSWYEFAVAIFEES---- 235

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           G         T+++P  A RPA+S LD S +       I  W+E +R+ L  
Sbjct: 236 GMQVSTEPCTTEEFPRPAPRPAFSVLDHSAIRTNGLTPIRHWREALRDYLAK 287


>gi|307293849|ref|ZP_07573693.1| dTDP-4-dehydrorhamnose reductase [Sphingobium chlorophenolicum L-1]
 gi|306880000|gb|EFN11217.1| dTDP-4-dehydrorhamnose reductase [Sphingobium chlorophenolicum L-1]
          Length = 285

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 160/292 (54%), Gaps = 13/292 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK +++G  GQ+ +SL++     V ++ + R  +D+       +      PD++ N AAY
Sbjct: 1   MKAVIVGAGGQLGRSLAAHAPSGVTLVALDRAGLDIADEAAVRNRIDKERPDLLFNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   A  INA   G +A AA ++G   I++STD+VFDG S +P    +PTNP
Sbjct: 61  TAVDKAETDEAAARMINARAVGLLADAAQAVGSSFIHVSTDFVFDGKSGSPYLSDAPTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG++KL GE    S     +I+RTAWVY+  G NF+ +MLRL  ER E+ VV DQ G
Sbjct: 121 LGVYGRTKLEGERLAGS---TALIVRTAWVYAPQGGNFVRTMLRLMAERPEVRVVADQIG 177

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPT A  +A A+  +A N +        GI H T D G  SW DFA  I  E+   G   
Sbjct: 178 TPTYAPALASALWHLAQNRV-------FGIHHYT-DAGAASWYDFAVAIQEEALTLGLLQ 229

Query: 241 SKV--YRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           + V    I T ++PT A RP+YS LD              W+E +R +L  I
Sbjct: 230 TAVPIIPIGTDEFPTPARRPSYSVLDKRSTYTHLGKPAPHWRENLRLMLKEI 281


>gi|3132256|dbj|BAA28133.1| dTDP-4-keto-L-rhamnose reductase [Actinobacillus
           actinomycetemcomitans]
          Length = 294

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 116/290 (40%), Positives = 165/290 (56%), Gaps = 8/290 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQD--VEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           + L+ G  GQ+ +SL+ + V +   E++ +   ++D+       S   SF P+VIIN AA
Sbjct: 3   RLLITGAGGQLGRSLAKLLVDNGRYEVLALDFSELDITNKDMVFSIIDSFKPNVIINAAA 62

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT+VD+AE E   A+S+N  G   +A+AA       +++STDYVFDG       E    +
Sbjct: 63  YTSVDQAELEVSSAYSVNVRGVQYLAEAAIRHNSAILHVSTDYVFDGYKSGKYKETDIIH 122

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YGKSK  GE  + + +   +ILRT+W +  +G+NF+ +MLRLAK R  + VV DQ 
Sbjct: 123 PLCVYGKSKAEGERLLLTLSPKSIILRTSWTFGEYGNNFVKTMLRLAKNRDILGVVADQI 182

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG- 237
           G PT +  IA  +IQIA  +I   +T   GI+H T  G P VSW DFA  IF E+  +  
Sbjct: 183 GGPTYSGDIASVLIQIAEKIIV-GETVKYGIYHFT--GEPCVSWYDFAIAIFDEAVAQKV 239

Query: 238 -GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
                 V  I T  YPT A RPA SCLD +K+     I+ S W+  ++NI
Sbjct: 240 LENVPLVNAITTADYPTLAKRPANSCLDLTKIQQAFGIQPSDWQRALKNI 289


>gi|237745880|ref|ZP_04576360.1| dTDP-4-dehydrorhamnose reductase [Oxalobacter formigenes HOxBLS]
 gi|229377231|gb|EEO27322.1| dTDP-4-dehydrorhamnose reductase [Oxalobacter formigenes HOxBLS]
          Length = 279

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 112/287 (39%), Positives = 164/287 (57%), Gaps = 15/287 (5%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G NGQ+   L ++       + + R  +D+       ++  +   D IIN AAYTAV
Sbjct: 3   LVTGANGQLGSELRNLL--GASAVYIDRETLDISDEAAVRNYLKNNCFDCIINCAAYTAV 60

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D+AEDEP  A ++N  G+  +AK    I    I+ISTDYVFDG S  P  E   TNPL+I
Sbjct: 61  DRAEDEPVQANAVNHLGSLWLAKYGKRI----IHISTDYVFDGTSHVPYHEEDKTNPLSI 116

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YGK+KLAGE+ V  Y    V+LRTAWVYS +G+NF+ ++LR+ + R  + VV DQ G+PT
Sbjct: 117 YGKTKLAGEKAVLDYAETAVVLRTAWVYSPYGNNFVKNILRMGRTRESLRVVSDQIGSPT 176

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKV 243
           SA  +A++II+I    ++   T  + ++H T + G  SW D A  +     +  G  + V
Sbjct: 177 SAGDLAKSIIEI----LQQMKTGKKDVYHFTNE-GVCSWYDLAVAVM----DLAGLSTPV 227

Query: 244 YRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             I ++ +PTKA RP YS L   K+   + + I  W+E +  ++  I
Sbjct: 228 IPIESRDFPTKAVRPFYSVLSKRKIKTHYGLGIRHWREALGEVIKKI 274


>gi|204929047|ref|ZP_03220190.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204321591|gb|EDZ06790.1| dTDP-4-dehydrorhamnose reductase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 299

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 164/296 (55%), Gaps = 9/296 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDLPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A          ++  + +  G++H+ A GG  +W D+A  +F E+ + 
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALKKPEVA--GLYHVVA-GGTTTWHDYAALVFDEARKA 237

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +++  + T  YPT A RP  S L+  K      + +  W+ GV+ +L  +
Sbjct: 238 GITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFGLILPQWELGVKRMLTEM 293


>gi|296708|emb|CAA80331.1| OAC2 [Azorhizobium caulinodans ORS 571]
          Length = 296

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 113/282 (40%), Positives = 166/282 (58%), Gaps = 5/282 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+ L++G +GQ+ + L+++ V+  + +  + R   D+  P   A    +  PDV++N AA
Sbjct: 1   MRVLLLGADGQLGRELTALAVERGLALAALNRAATDITDPVAVAKALEAHKPDVVVNAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE EP++A  +NA   G IA+   S G+P I++STDYVFDG       E  P  
Sbjct: 61  YTAVDKAESEPDLAAKVNAVAPGLIAERCASAGVPLIHVSTDYVFDGTKTGAYVESDPLA 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YG++K AGE  + +    ++ILRTAWVY I+G+NFL +MLRLAK+R  +++V DQ 
Sbjct: 121 PLGVYGRTKAAGEAAIRAAGEKHLILRTAWVYGIYGNNFLKTMLRLAKDRDRLTIVADQR 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PT+   IA  I+  A   +  S  +  G +H+    G  +W  FA+ I   +A   G 
Sbjct: 181 GCPTATRDIAEGILAAAAPAVAGS--ARWGTYHLGGT-GVTTWHGFAQAIIDRAATYTG- 236

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKE 281
            S+V  I T +YPT A RPA S LD S    T + R + W++
Sbjct: 237 RSEVAAITTAEYPTPARRPANSELDSSLFERTFHFRAAPWQQ 278


>gi|116071141|ref|ZP_01468410.1| dTDP-4-dehydrorhamnose reductase [Synechococcus sp. BL107]
 gi|116066546|gb|EAU72303.1| dTDP-4-dehydrorhamnose reductase [Synechococcus sp. BL107]
          Length = 294

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 112/295 (37%), Positives = 157/295 (53%), Gaps = 15/295 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G  GQ+ Q+L     + VE+I   R +++L   +   S      PD ++N  AY
Sbjct: 1   MKILLTGAGGQLGQALQDAKPEAVELISTTRQELNLADAEACRSAVQQHQPDWVLNAGAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE+A ++N     A A+  +  G   + +STD+VF+G   TP       NP
Sbjct: 61  TAVDKAESEPELAHAVNGGAPEAFAQELERQGGRLLQVSTDFVFNGTQGTPYQPEQTRNP 120

Query: 121 LNIYGKSKLAGEEKVASY---TNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD 177
           L +YG SK AGEE + S        +ILRT+WV    G NF L+MLRL +ER ++ VV D
Sbjct: 121 LGVYGASKAAGEEAIQSVFGAGGRGLILRTSWVIGPVGKNFALTMLRLHRERDQLGVVAD 180

Query: 178 QFGTPTSALQIARA---IIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
           Q G PTS L +ARA    +QIA       +  +  + H + D G  SW D A  +    A
Sbjct: 181 QVGCPTSTLNLARACWRTLQIA------GERDMPAVMHWS-DNGAASWYDVAVAVGQIGA 233

Query: 235 ERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           E G     +KV  I T  YPT A RP+YS LDC+   +   +    W++ ++ +L
Sbjct: 234 ELGLIDTPAKVQPITTSDYPTPAERPSYSLLDCTSTRSALELDGEHWQQALKAVL 288


>gi|264678896|ref|YP_003278803.1| dTDP-4-dehydrorhamnose reductase [Comamonas testosteroni CNB-2]
 gi|262209409|gb|ACY33507.1| dTDP-4-dehydrorhamnose reductase [Comamonas testosteroni CNB-2]
          Length = 301

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 164/305 (53%), Gaps = 20/305 (6%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI---------DLLKPKDFASFFLSFSP 51
           MK L++G NGQ+   L        E+I + R  +         D+   +  A    S  P
Sbjct: 1   MKLLLLGKNGQVGWELQRSLAPLGEVIALDRQSVNVDGNGLCGDIGDLQTLAQTIRSVRP 60

Query: 52  DVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTP 111
           DVI+N AA+TAVDKAE EP++A  +NAE    +A  A S+G   ++ STDYVFDG     
Sbjct: 61  DVIVNAAAHTAVDKAESEPDLALRLNAEAPEVMALEAKSLGALLVHYSTDYVFDGSGSAA 120

Query: 112 IDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERRE 171
             E   T PL++YG++KL GE+++A+    ++I RT+WVY+  G NF  +MLRLA+ER  
Sbjct: 121 RKEGDATGPLSVYGRTKLEGEQRIAATHCRHLIFRTSWVYAARGGNFAKTMLRLAQEREA 180

Query: 172 ISVVCDQFGTPTSALQIARAIIQ-IAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
           +SV+ DQ+G PT A  IA      + H    + D    G++H+ A  G  +W  +A ++ 
Sbjct: 181 LSVINDQWGAPTGADLIADVTAHAVRHMSAHDGDG---GLYHLVA-AGETNWHAYASHVI 236

Query: 231 WESAERGGP--YSKVYRIF---TKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRN 285
            E A+   P   SKV  I    T  +PT A RP  S LD  KL     + +  W++GV  
Sbjct: 237 -ERAQSLRPDLDSKVQSIAAVPTTAFPTPAARPLNSRLDTQKLQAAMQLHLPAWQQGVER 295

Query: 286 ILVNI 290
           +L  I
Sbjct: 296 MLREI 300


>gi|299532672|ref|ZP_07046060.1| dTDP-4-dehydrorhamnose reductase [Comamonas testosteroni S44]
 gi|298719307|gb|EFI60276.1| dTDP-4-dehydrorhamnose reductase [Comamonas testosteroni S44]
          Length = 301

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 109/304 (35%), Positives = 162/304 (53%), Gaps = 18/304 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI---------DLLKPKDFASFFLSFSP 51
           MK L++G NGQ+   L        E+I + R  +         D+   +  A    S  P
Sbjct: 1   MKLLLLGRNGQVGWELQRSLAPLGEVIALDRQSVNVDGNGLCGDVGDLQTLAQTIRSVRP 60

Query: 52  DVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTP 111
           DVI+N AA+TAVDKAE EP++A  +NAE    +A  A S+G   ++ STDYVFDG     
Sbjct: 61  DVIVNAAAHTAVDKAESEPDLALRLNAEAPEVMALEAKSLGALLVHYSTDYVFDGSGSAA 120

Query: 112 IDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERRE 171
             E   T PL++YG++KL GE+++A+    ++I RT+WVY+  G NF  +MLRLA+ER  
Sbjct: 121 RKEGDATGPLSVYGRTKLEGEQRIAATHCRHLIFRTSWVYAARGGNFAKTMLRLAQEREA 180

Query: 172 ISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFW 231
           +SV+ DQ+G PT A  IA        ++  +      G++H+ A  G  +W  +A ++  
Sbjct: 181 LSVINDQWGAPTGADLIADVTAHAVRHVSAHEGDG--GLYHLVA-AGETNWHAYASHVI- 236

Query: 232 ESAERGGP-----YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
           E A+   P        +  + T  +PT A RP  S LD  KL  T  + +  W++GV  +
Sbjct: 237 ERAQSLRPDLDWKVQSIAAVPTTAFPTPAARPLNSRLDTQKLQATMQLHLPAWQQGVERM 296

Query: 287 LVNI 290
           L  I
Sbjct: 297 LREI 300


>gi|308048797|ref|YP_003912363.1| dTDP-4-dehydrorhamnose reductase [Ferrimonas balearica DSM 9799]
 gi|307630987|gb|ADN75289.1| dTDP-4-dehydrorhamnose reductase [Ferrimonas balearica DSM 9799]
          Length = 303

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 161/296 (54%), Gaps = 10/296 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G  GQ+A  LS    + VE++     ++D+   +   + F    PDV+IN AAY
Sbjct: 1   MKVLVTGKGGQLAYELSQTLPEGVELVSFSAQELDITDREAVIARFEEVQPDVVINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE + ++A+++N  GA  +A A        ++ISTD+VFDG S TP       NP
Sbjct: 61  TAVDKAESDQKMAYAVNESGAENLALACRQWSAKLVHISTDFVFDGRSTTPYQPEDAPNP 120

Query: 121 LNIYGKSKLAGEEKVASYT-NNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           LN+YG SKLAG+ KV+     N VI+RTAWVYS FG+NF+ +M+RL  E+ ++ ++ DQ 
Sbjct: 121 LNVYGASKLAGDNKVSEVLGQNAVIVRTAWVYSCFGNNFVKTMIRLMAEKEQLGIIYDQV 180

Query: 180 GTPTSALQIARAIIQIAHNLI------ENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           GTPT A  +A+   ++A  L       E        + H T D G  SW DFA  I   +
Sbjct: 181 GTPTWAKGLAQLSWRLAEQLASGNLPREEVPEHQALMLHWT-DAGVASWFDFAVAIQELA 239

Query: 234 AERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            E+G       V  I    YPT A RPA+S +D S    T       W+  + N+L
Sbjct: 240 LEKGLLDKSIPVRPIPASAYPTPAKRPAFSVIDKSLTETTTGKCTIHWRAQLSNML 295


>gi|168481377|gb|ACA24860.1| RmlD [Shigella dysenteriae]
          Length = 299

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 115/296 (38%), Positives = 165/296 (55%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGNGDMPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T P N+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPRNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|9957851|gb|AAG09527.1|AF279622_2 dTDP-6-deoxy-L-mannose-dehydrogenase [Salmonella enterica]
          Length = 299

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 164/296 (55%), Gaps = 9/296 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ITSPLNVYGKTKLAGEKALQDSCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A          ++  + +  G++H+ A GG  +W D+A  +F E+ + 
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVA-GGTTTWHDYAALVFDEARKA 237

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +++  + T  YPT A RP  S L+  K      + +  W+ GV+ +L  +
Sbjct: 238 GITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFGLILPQWELGVKRMLTEM 293


>gi|168481317|gb|ACA24805.1| RmlD [Shigella dysenteriae]
 gi|187880616|gb|ACD37122.1| RmlD [Shigella boydii]
          Length = 299

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 114/296 (38%), Positives = 164/296 (55%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    +IAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVESIAKAANEVGAWVIHYSTDYVFPGTGEIPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGMYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  +    YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPATAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|312962411|ref|ZP_07776902.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas fluorescens WH6]
 gi|311283338|gb|EFQ61928.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas fluorescens WH6]
          Length = 298

 Score =  192 bits (487), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 163/299 (54%), Gaps = 13/299 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID----LLKPKDFASFFLSFSPDVIIN 56
           MK L++G NGQ+   L        +++ +     D    L   +  A+    F+PDVI+N
Sbjct: 1   MKILLLGKNGQVGWELQRSLAPLGQVLALDSKSQDYCGDLNDLQGLAATVQRFAPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AAYTAVDKAE EP  A  +NAE    +A     +    ++ STDYVF G   TP  E  
Sbjct: 61  AAAYTAVDKAESEPAQALRVNAEAPAVLAAEVRKLNALLVHYSTDYVFAGDGDTPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           P  PL++YG +KL GE+ + +    ++I RT+WVY+  G+NF  +ML LA+ER  ++V+ 
Sbjct: 121 PVGPLSVYGTTKLQGEQAIQASGCAHLIFRTSWVYAARGNNFAKTMLGLARERDSLNVID 180

Query: 177 DQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           DQFGTPT A  +A      AH +  ++ +  L G++H+ A  G  +W  +A ++  ++  
Sbjct: 181 DQFGTPTGADLLADI---TAHAIRSQHLNPQLSGVYHLAA-AGETTWHRYARFVLEQAQA 236

Query: 236 RGGPYS----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            G   S     V  I T  YPT A RP  S L+  KL N  ++R+  W++GV  +L+ I
Sbjct: 237 AGVQLSVTPANVGAITTAAYPTPAKRPGNSRLNTQKLQNAFSLRLPEWQDGVARMLIEI 295


>gi|315299447|gb|EFU58698.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli MS 16-3]
          Length = 299

 Score =  192 bits (487), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 161/294 (54%), Gaps = 11/294 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGNGDMPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YGK+KLAGE  +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 VTAPLNVYGKTKLAGERALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          ++  + +  G++H+ A+ G  +W D+A  +F E A +
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVAN-GTTTWHDYAALVF-EEARK 236

Query: 237 GG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            G     +K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 237 AGIDLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|157158895|ref|YP_001463391.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli E24377A]
 gi|157080925|gb|ABV20633.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli E24377A]
          Length = 299

 Score =  192 bits (487), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 111/293 (37%), Positives = 161/293 (54%), Gaps = 9/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    +IAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVESIAKAANEVGAWVIHYSTDYVFPGTGEIPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          ++  + +  G++H+ A  G  +W D+A  +F E+ + 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVAS-GTTTWYDYAALVFEEARKA 237

Query: 237 GGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G P +  K   + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 238 GIPLALNKFNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|115345654|ref|YP_771835.1| dTDP-4-dehydrorhamnose reductase [Roseobacter denitrificans OCh
           114]
 gi|115292975|gb|ABI93427.1| dTDP-4-dehydrorhamnose reductase [Roseobacter denitrificans OCh
           114]
          Length = 307

 Score =  192 bits (487), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 164/291 (56%), Gaps = 13/291 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G  GQ+A  L+ +      +  +GR   DL  P    +       D +IN AAY
Sbjct: 27  MKILVFGQTGQVATELAQL----DGVTCLGREQADLSDPGACEAVIAGCDADAVINAAAY 82

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE++ + A  +NA    A+A AA + GIP ++ISTDYVFDG  + P    +PT P
Sbjct: 83  TAVDKAEEDRDTAMIVNAMAPTAMAAAAAARGIPFVHISTDYVFDGSGQRPWQPDAPTGP 142

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG SKL GE+ VA+    + ILRT+WV+S  G+NF+ +M RL  ER  +++V DQ G
Sbjct: 143 LGVYGASKLGGEKGVAAAGGAHAILRTSWVFSAHGANFVKTMRRLGAERDALTIVADQIG 202

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A  IA   ++IA  L +  D S  G +H +  G P +SWADFA  IF +S    G 
Sbjct: 203 GPTPARDIAAVCVEIARALTQ--DPSKSGTYHFS--GAPDISWADFAREIFAQS----GL 254

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V  I T QYPT A RP  S LDCS    T  I    W+ G+  +L ++
Sbjct: 255 SVDVTDIPTSQYPTPAQRPLNSRLDCSTTTATFGIPRPDWRTGLAGVLSDL 305


>gi|307728806|ref|YP_003906030.1| dTDP-4-dehydrorhamnose reductase [Burkholderia sp. CCGE1003]
 gi|307583341|gb|ADN56739.1| dTDP-4-dehydrorhamnose reductase [Burkholderia sp. CCGE1003]
          Length = 297

 Score =  192 bits (487), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 109/285 (38%), Positives = 153/285 (53%), Gaps = 7/285 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L+ G NGQ+   L+        +I     ++DL   +          P +I+NPAAYTAV
Sbjct: 10  LLTGVNGQVGFELARSLQGLGTVIAPRSNELDLSDLEQVRRVVREMKPSLIVNPAAYTAV 69

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE + + A  +NAE    +A+ A  +G   ++ STDYVFDG       E    NP+N+
Sbjct: 70  DKAETDVDAAMRLNAEAPAVLAEEAKRLGAALVHYSTDYVFDGAKDGAYVEGDRVNPINV 129

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKLAGE+ +++    ++I RT+WVY + G NFLL+MLRL  ER E+SVV DQ G PT
Sbjct: 130 YGRSKLAGEQAISAVGGAHLIFRTSWVYGMRGKNFLLTMLRLGAEREELSVVADQLGAPT 189

Query: 184 SALQIARAIIQIAHNLIENSDTSL----RGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
            +  IA +   +    I +   S      G++H+T+ GG  SW  FAE IF  S     P
Sbjct: 190 WSNTIATSTAHVLSQAIASDGESWWREHSGVYHLTS-GGATSWHGFAEAIFEVSNLARKP 248

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
             K   +    YPT A RPA S +   KLA    +R   W+E ++
Sbjct: 249 VVKP--VPASAYPTPASRPANSSMSNDKLAAAFGVRAPDWREALQ 291


>gi|255693796|ref|ZP_05417471.1| dTDP-4-dehydrorhamnose reductase [Bacteroides finegoldii DSM 17565]
 gi|260620419|gb|EEX43290.1| dTDP-4-dehydrorhamnose reductase [Bacteroides finegoldii DSM 17565]
          Length = 286

 Score =  192 bits (487), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 115/289 (39%), Positives = 166/289 (57%), Gaps = 12/289 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ LV G NGQ+   +  +  ++ + +       ++D+   +   S+      DVI+N A
Sbjct: 1   MRILVTGANGQLGNEMQVLAKENPQHLYYFTDVQELDICDKEAVWSYISEKQIDVIVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED  E+A  +N+   G +A+AA +     I +STDYVFDG + TP  E    
Sbjct: 61  AYTAVDKAEDNRELAHKLNSVAPGILARAAQANNAAMIQVSTDYVFDGTAHTPYAEECKP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P +IYG +KL GE++V  +    V++RTAW+YSI+G+NF+ +M+RL KER  + VV DQ
Sbjct: 121 CPDSIYGSTKLEGEQEVMDHCEKAVVIRTAWLYSIYGNNFVKTMIRLGKERDGLGVVFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +ARAI  I +  I      +RGI+H + + G  SW DF   I   +   G 
Sbjct: 181 IGTPTYANDLARAIYTIINKGI------VRGIYHFSNE-GVCSWYDFTVAIHRLA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              KV  + T +YP KA+RPAYS LD +K+  T  I I  W+E +   +
Sbjct: 231 TSCKVKPLHTAEYPAKANRPAYSVLDKTKIKTTFGIEIPHWEESLERCI 279


>gi|331004825|ref|ZP_08328243.1| dTDP-4-dehydrorhamnose reductase [gamma proteobacterium IMCC1989]
 gi|330421356|gb|EGG95604.1| dTDP-4-dehydrorhamnose reductase [gamma proteobacterium IMCC1989]
          Length = 304

 Score =  192 bits (487), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 167/290 (57%), Gaps = 9/290 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLK---PKDFASFFLSF-SPDVII 55
           ++ L++G +GQ+      +  Q    ++ + R ++DL       +     L F +P +++
Sbjct: 6   IRILLLGASGQVGSECKKLFQQVGYTVLCITRKELDLSSISSVDEIVERLLCFQTPSLVV 65

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVDKAE EP +A  +N    G +A+      IP I+ISTDYVFDG + T   E 
Sbjct: 66  NAAAYTAVDKAESEPSLADKVNHTSVGFLAQYCAKGAIPLIHISTDYVFDGTATTAYTES 125

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
              +PL +YG++K  GE+ V S    ++ILRT+WV+ I G+NF+ +MLRL+ +R ++++V
Sbjct: 126 DDVSPLGVYGETKWLGEQAVKSVLAQHIILRTSWVFGISGNNFVKTMLRLSADREQLTIV 185

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
            DQ+G PT A  IARAI+ I          +  G++H   + G VSW +F++ I  E+  
Sbjct: 186 SDQYGCPTYAGDIARAILCIVKRYASGQSLNW-GVYHCVGE-GKVSWYEFSQAILNEAYA 243

Query: 236 RGGPYSK--VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
           RG   +K  +  I +  YPT A RPAYS L   KLA   N  + +W++G+
Sbjct: 244 RGFMPNKPQIIPIPSSAYPTPAARPAYSVLSTDKLAREFNYSVPSWRQGL 293


>gi|218708292|ref|YP_002415913.1| putative dTDP-4-dehydrorhamnose reductase [Vibrio splendidus LGP32]
 gi|218321311|emb|CAV17261.1| putative dTDP-4-dehydrorhamnose reductase (rfbD) [Vibrio splendidus
           LGP32]
          Length = 286

 Score =  192 bits (487), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 110/290 (37%), Positives = 162/290 (55%), Gaps = 10/290 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK ++ G  GQ+A  L  +  Q VE+I VG  + D+        F ++  PD++IN AAY
Sbjct: 1   MKVVITGKGGQLAYELEQLAPQGVEVISVGINEFDITNEILVTEFLINTKPDLVINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE++ + A+++N  G   +A A   I    +++STD+VFDG S  P    S  NP
Sbjct: 61  TAVDKAEEDIDAAYAVNELGTKYLANACKQINARILHVSTDFVFDGTSSAPYQTSSEPNP 120

Query: 121 LNIYGKSKLAGEEKVAS-YTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           +N+YG SKLAGE  +        VI+R+AWVYSI G+NF+ SML L +E++++ ++ DQ 
Sbjct: 121 INVYGASKLAGELVLQEILPEASVIVRSAWVYSINGNNFVKSMLCLMQEKQQLGIIYDQV 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG-- 237
           GTPT A  +A+ +  IA          + GI H T D G  SW DFA  I     E+G  
Sbjct: 181 GTPTWAKGLAQWLWTIADR------PEVTGIHHWT-DAGVASWYDFAIAIQELGVEKGLL 233

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
                ++ I T +YPT A RP +S +D         I+ + W++ +  +L
Sbjct: 234 KEAIPIFPISTSEYPTLAKRPEFSVIDKFSAEEVSGIKTTHWRKQLSEML 283


>gi|152994872|ref|YP_001339707.1| dTDP-4-dehydrorhamnose reductase [Marinomonas sp. MWYL1]
 gi|150835796|gb|ABR69772.1| dTDP-4-dehydrorhamnose reductase [Marinomonas sp. MWYL1]
          Length = 291

 Score =  192 bits (487), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 113/298 (37%), Positives = 167/298 (56%), Gaps = 16/298 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDV------EIIRVGRPDIDLLKPKDFASFFLSFSPDVI 54
           M+ L+ G NGQ+ +     C QD+      E+   G   ++++  +          PD+I
Sbjct: 1   MRILLTGKNGQLGR-----CFQDLLIGANHELYAYGSDSLNIVDAQQVVDVVQHVKPDII 55

Query: 55  INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDE 114
           +N AAYTAVDKAE + + A+ +N+ G   +A  A ++ IP I++STDYVFDG S  P   
Sbjct: 56  VNAAAYTAVDKAESDAKNAYLVNSTGPELLAIQAAALDIPFIHVSTDYVFDGKSVEPYLP 115

Query: 115 FSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISV 174
              TNP  +YG SKLAGE  V +    Y+ILRTAWV+S +GSNF+ +M+RLAK+R E+ V
Sbjct: 116 SDKTNPQGVYGASKLAGERAVTAACEKYIILRTAWVFSEYGSNFVKTMVRLAKDRSELCV 175

Query: 175 VCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
           V DQ+G PT A  +A+AI+ I     +   +   GI+H   D  P SW  FA  IF+ + 
Sbjct: 176 VADQYGCPTYAGDLAKAILHICEQ-CQVGKSLPWGIYHYCGD-TPTSWHGFARAIFYRAE 233

Query: 235 ERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             G      ++  I +  YPT A RP YS +  ++L +   +  S W  G+ ++L  +
Sbjct: 234 ALGVIDKSPQLKAISSDLYPTPAKRPEYSVMS-TELLSRIELDASFWMAGLFSVLSKL 290


>gi|187922883|ref|YP_001894525.1| dTDP-4-dehydrorhamnose reductase [Burkholderia phytofirmans PsJN]
 gi|187714077|gb|ACD15301.1| dTDP-4-dehydrorhamnose reductase [Burkholderia phytofirmans PsJN]
          Length = 298

 Score =  192 bits (487), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 112/285 (39%), Positives = 155/285 (54%), Gaps = 7/285 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G NGQ+   L+        ++ V    +DL  P    +   +  P +I+NPAAYTAV
Sbjct: 11  LVTGVNGQVGFELARTLQGLGTMVAVDHAAMDLSDPDQVRAVVRNIRPTLIVNPAAYTAV 70

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE+E ++A  IN E  G +A+ A  +G   ++ STDYVF+G       E  PT+P N 
Sbjct: 71  DKAEEELDLAMRINGEVPGVLAEEAKKLGAALVHYSTDYVFNGEKDGAYVEDDPTDPQNA 130

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG++KLAGE+ +A+   +++I RT+WVY   G NFLL+MLRL  ER E+SVV DQ G PT
Sbjct: 131 YGRTKLAGEQAIAASGCDHLIFRTSWVYGTRGKNFLLTMLRLGAERDELSVVADQIGAPT 190

Query: 184 SALQI----ARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
            +  I    A  + Q A     +      G++H+TA  G  SW  FAE IF  S     P
Sbjct: 191 WSKTIATLTANVLAQAAAPGQGDWWQQRSGVYHLTA-AGSASWHGFAEAIFELSGLAKTP 249

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
              V  I    YPT A RP  S +   KLA T  ++   W++ ++
Sbjct: 250 --TVKPIPAASYPTPAKRPGNSRMSNDKLARTFGVQAPDWRDALQ 292


>gi|315649764|ref|ZP_07902847.1| dTDP-4-dehydrorhamnose reductase [Paenibacillus vortex V453]
 gi|315274738|gb|EFU38119.1| dTDP-4-dehydrorhamnose reductase [Paenibacillus vortex V453]
          Length = 294

 Score =  191 bits (486), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 175/293 (59%), Gaps = 11/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G NGQ+ Q ++++  +   +II  GR ++D+   +       S +PD II+ AA
Sbjct: 1   MKVLVTGANGQLGQDVTNVLAEAGYQIIGCGRAELDITNMELCEQVISSHNPDFIIHCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVD AE + + A+ +N  G   IA +A+ IG   +YISTDYVF+G S T   E+  T+
Sbjct: 61  YTAVDAAETDTDGAYRVNTLGTRNIAVSAEKIGAAVVYISTDYVFNGTSETAYVEYDDTD 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P  IYG+SKLAGE+ +  + + + I+RT+WV+ + G+NF+ +MLRL +E+ ++ VV DQ 
Sbjct: 121 PQTIYGRSKLAGEQMLRDFCSKWFIVRTSWVFGLHGNNFVKTMLRLGQEKPQLKVVNDQK 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT  + +A+ ++    NLI    T   G++H  ++ G  +W +F + IF E+ E+ G 
Sbjct: 181 GSPTYTVDLAQFLL----NLI---STEKYGLYH-ASNSGSCTWYEFTQAIFEEAREQLGL 232

Query: 240 --YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              +++    T ++P  A RPA S +D   +       +  W+EG++  +V++
Sbjct: 233 EIMAELQPCTTAEFPRPAPRPANSTMDHLAIRLNQLEDLPHWREGLKQFMVDM 285


>gi|94311666|ref|YP_584876.1| dTDP-4-dehydrorhamnose reductase [Cupriavidus metallidurans CH34]
 gi|93355518|gb|ABF09607.1| dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of
           dTDP-L-rhamnose synthase [Cupriavidus metallidurans
           CH34]
          Length = 306

 Score =  191 bits (486), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 118/295 (40%), Positives = 160/295 (54%), Gaps = 8/295 (2%)

Query: 3   CLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
            LV G+NGQ+   L         ++ + R   DL +P        S  PDVI+NPAAYTA
Sbjct: 11  LLVTGSNGQVGFELRRSLAPLGRVVALDRSQFDLTRPDALRELVRSIRPDVIVNPAAYTA 70

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VDKAE E E AF++N    G +A+ A  +G   ++ STDYVFDG       E    NP +
Sbjct: 71  VDKAETEAEAAFAVNGVAPGVLAEEARRLGSLFVHYSTDYVFDGTKDGAYLEGDAVNPQS 130

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YGKSKLAGE+ VA+     ++LRT WV    G NF  +MLRLA+ER  + V+ DQFG P
Sbjct: 131 VYGKSKLAGEQVVAATGAASLVLRTCWVAGAHGGNFAKTMLRLARERDSLRVIADQFGAP 190

Query: 183 TSALQIARAIIQIA--HNLIENSDTSL-RGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           T+A  IA    QI   H L      +   G++H+ A GG  +W  +A ++   +A +G  
Sbjct: 191 TTASLIADVTAQIVARHWLHAPGREAFPTGVYHLAA-GGETTWHGYATHVLSRAAAKGVE 249

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                +++  I   QYP  A RPA S LD  KL +T NI +  W EG+  +L  I
Sbjct: 250 MKVDPTRIEPIPASQYPLPAPRPANSRLDTGKLRDTFNIHLPDWAEGIDLLLDQI 304


>gi|87303235|ref|ZP_01086028.1| dTDP-4-dehydrorhamnose reductase [Synechococcus sp. WH 5701]
 gi|87282130|gb|EAQ74091.1| dTDP-4-dehydrorhamnose reductase [Synechococcus sp. WH 5701]
          Length = 310

 Score =  191 bits (486), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 113/301 (37%), Positives = 158/301 (52%), Gaps = 17/301 (5%)

Query: 3   CLVIGNNGQIAQSLSSMC---VQDVEIIRVGRPDIDLLKPKD-----FASFFLSFSPDVI 54
            LVIG +GQ+A +L  +    +    ++   RP++DL  P                P ++
Sbjct: 7   VLVIGRSGQVASALRRLAPTLLTQRPLLLAARPELDLAAPAPELDATVEQLLEQHQPALV 66

Query: 55  INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDE 114
           +N AAYTAVDKAE EPE+A +IN    G +A+A  +  +P  ++STDYVF G    P  E
Sbjct: 67  LNAAAYTAVDKAESEPELAAAINNAAVGVLARACAARSLPLFHLSTDYVFAGGGERPWRE 126

Query: 115 FSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISV 174
             PT PL +YG SKL GE  + +    +++LR +WV+ + G+NF+ +MLRL  ER  +SV
Sbjct: 127 DDPTGPLGVYGASKLGGEGALRAAGGPHLLLRVSWVFGVEGANFVRTMLRLGAERPALSV 186

Query: 175 VCDQFGTPTSALQIARAIIQIAHNLIENS---DTSLR---GIFHMTADGGPVSWADFAEY 228
           V DQ G PTSA  IA   + +A   I N    D  L    G +H   +   VSW  FAE 
Sbjct: 187 VADQIGGPTSAEAIATTWLSLAEAAIANRSQLDPDLPFPWGTYHYAGEPA-VSWYGFAEA 245

Query: 229 IFWESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
           IF E+   G       +  I T  YPT A RPA S ++ S+     +I    W+E +R  
Sbjct: 246 IFAEAVALGLLARAPDLTPIPTSAYPTPAQRPANSRMETSRFRAAFDIPPPDWREDLRTC 305

Query: 287 L 287
           L
Sbjct: 306 L 306


>gi|209518633|ref|ZP_03267451.1| dTDP-4-dehydrorhamnose reductase [Burkholderia sp. H160]
 gi|209500916|gb|EEA00954.1| dTDP-4-dehydrorhamnose reductase [Burkholderia sp. H160]
          Length = 308

 Score =  191 bits (486), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 153/291 (52%), Gaps = 8/291 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G NGQ+   L+        ++ V R  +DL   +   +      P +I+NPAAYTAV
Sbjct: 11  LVTGVNGQVGYELARTLQGLGNVVAVDRSRLDLSNFEQIRAVVRDLRPALIVNPAAYTAV 70

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE+E ++A  IN E  G +A+ A  +G   I+ STDYVF+G       E  PT+P N+
Sbjct: 71  DKAEEERDLAMRINGEAPGVLAEEAKKLGAALIHYSTDYVFNGTKEGAYVEDDPTDPQNV 130

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKLAGE+ +A+   N+++LRT+WVY   G NFLL+MLRL  +R E+ VV DQFG PT
Sbjct: 131 YGRSKLAGEQAIAATGVNHLVLRTSWVYGTRGKNFLLTMLRLGADRPELKVVADQFGAPT 190

Query: 184 SALQIARAIIQIAHNLIENSD-----TSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
               IA     +        D     +   GI+H+ A G   SW  FA  IF  +     
Sbjct: 191 WCNTIATLTAHLCAQSFAAEDGAKWWSERTGIYHLCA-GDSTSWHGFASAIFELADLPNK 249

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           P      I    YPT A RPA S +   KLA    +    W++ ++  L +
Sbjct: 250 P--NTLPIPAADYPTPATRPANSRMSNEKLARVFGLAAPHWRDALKLCLTD 298


>gi|225376962|ref|ZP_03754183.1| hypothetical protein ROSEINA2194_02604 [Roseburia inulinivorans DSM
           16841]
 gi|225211283|gb|EEG93637.1| hypothetical protein ROSEINA2194_02604 [Roseburia inulinivorans DSM
           16841]
          Length = 307

 Score =  191 bits (486), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 169/293 (57%), Gaps = 24/293 (8%)

Query: 2   KCLVIGNNGQIAQSLS-SMCVQDVEIIRV------GRPDIDLLKPKDFASFFLSFSPDVI 54
           K LV G NGQ+ ++++      DV  I        G   +D+ K +   S   +  P+VI
Sbjct: 20  KILVTGCNGQLGRAINKEYAGSDVTFINTDVAEGEGVTALDITKIEQVLSLVRAEQPEVI 79

Query: 55  INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDE 114
           IN AA+T VD  E + + A+ INA G   ++ AA+++G   I++STDYVF+G    P  E
Sbjct: 80  INCAAHTNVDACEKQWDAAYRINALGPRNLSIAAEAVGAKMIHVSTDYVFEGNGTKPYTE 139

Query: 115 FSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISV 174
           F   NP++ YGK+KL GE+ V  ++N++ I RTAW+Y   G NF+ +ML L++   E+SV
Sbjct: 140 FDAPNPVSAYGKTKLEGEKFVQQFSNHFFIFRTAWLYGD-GKNFVKTMLNLSETHDEVSV 198

Query: 175 VCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
           VCDQ G+PTSA+++A+AI    H+      T   G++H T + G  +WADF E IF    
Sbjct: 199 VCDQLGSPTSAVELAKAI----HHF---EGTENYGLYHATCE-GDTNWADFTEEIF---- 246

Query: 235 ERGGPYSKVYRIFTKQY----PTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
           +R G  +KV  + +KQY    P  A RPAYS LD   +      +++ WK+ +
Sbjct: 247 KRAGKSTKVNHVTSKQYKQMNPAAADRPAYSILDNYMMRLADGYQMADWKDAL 299


>gi|9957861|gb|AAG09535.1|AF279624_2 dTDP-6-deoxy-L-mannose-dehydrogenase [Salmonella enterica]
          Length = 299

 Score =  191 bits (486), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 164/296 (55%), Gaps = 9/296 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ITSPLNVYGKTKLAGEKALQCNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A          ++  + +  G++H+ A GG  +W D+A  +F E+ + 
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVA-GGTTTWHDYAALVFDEARKA 237

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +++  + T  YPT A RP  S L+  K      + +  W+ GV+ +L  +
Sbjct: 238 GITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFGLILPQWELGVKRMLTEM 293


>gi|256017787|ref|ZP_05431652.1| dTDP-4-dehydrorhamnose reductase [Shigella sp. D9]
 gi|332278808|ref|ZP_08391221.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Shigella sp. D9]
 gi|332101160|gb|EGJ04506.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Shigella sp. D9]
          Length = 299

 Score =  191 bits (486), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 166/296 (56%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE E E A  +NA    +IAKAA+ +G   I+ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEAEFAQLLNATSVESIAKAANEVGAWVIHFSTDYVFPGNGDTPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRMALNKPE-----VAGLYHLVAS-GTTTWHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|117618108|ref|YP_857411.1| dTDP-4-dehydrorhamnose reductase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559515|gb|ABK36463.1| dTDP-4-dehydrorhamnose reductase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 295

 Score =  191 bits (486), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 115/297 (38%), Positives = 161/297 (54%), Gaps = 12/297 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID----LLKPKDFASFFLSFSPDVIIN 56
           M  L+ G NGQ+   L         I  V     D      KP   A       PDVI+N
Sbjct: 1   MHILLFGKNGQVGWELQRALAPLGRITAVDFDSTDYCGDFSKPAGVAETVRQVKPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE E E A  +N     AIA+ A+++G   ++ STDYVFDG    P  E  
Sbjct: 61  AAAHTAVDKAESEREFAELLNITSVAAIAREAEALGAWLVHYSTDYVFDGSGERPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+  A+  + ++I RT+WVY+  G+NF  +MLR  KER E+SV+ 
Sbjct: 121 VTAPLNVYGETKLAGEQ-AAALCSRHLIFRTSWVYAARGANFAKTMLRFGKERSEMSVIN 179

Query: 177 DQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           DQFG PT A  +A      AH L +  S   + G++H+ A  G  +W D+A+ +F ++ E
Sbjct: 180 DQFGAPTGAELLADC---TAHVLRVAQSRPEVAGLYHLIAS-GTTTWFDYAQLVFAKARE 235

Query: 236 RGGPY--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            G     +++  + T  +PT A RP  S LD SK   T ++ +  W  GV  +L  I
Sbjct: 236 AGVELAVTQLNAVPTSAFPTPAKRPHNSRLDTSKFQRTFDLVLPDWTVGVERMLTEI 292


>gi|241758736|ref|ZP_04756849.1| dTDP-4-dehydrorhamnose reductase [Neisseria flavescens SK114]
 gi|241320944|gb|EER57157.1| dTDP-4-dehydrorhamnose reductase [Neisseria flavescens SK114]
          Length = 287

 Score =  191 bits (486), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 119/292 (40%), Positives = 166/292 (56%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G  GQ+A+ L     +D E+I      +D+   +       +F PD I+N AAY
Sbjct: 1   MRTLLTGAKGQLARCLRDRLPEDWELIATDSTSLDITDTEAVHHMIKNFQPDAIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE+  E AF+INA     +A AA +     I+ISTDYVFDG  + P  E   TNP
Sbjct: 61  TAVDKAEENAEAAFAINATAVHNLAAAARAAHARFIHISTDYVFDGEGKRPYRETDYTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            + YG+SK+AGE    +      I+RT+W++S +GSNF+ +MLRLAKER  +S+V DQ G
Sbjct: 121 RSTYGQSKVAGELLALAAHPESTIVRTSWLFSEYGSNFVKTMLRLAKERDSLSIVHDQTG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT A  +A AII +         TS RGIFH   +    +W +F + IF  + +    +
Sbjct: 181 CPTYAGDLAHAIISLLQQ-----PTSPRGIFHYCGNKS-ATWYEFTKAIFQTAHQLDDSF 234

Query: 241 S--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              ++  I T QYP  A RPAYS +DCS+L     I+ S W++ +R IL  I
Sbjct: 235 RIPELNAITTDQYPLPAPRPAYSIMDCSRLETKFGIKPSDWQKALREILRTI 286


>gi|237723307|ref|ZP_04553788.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|229447829|gb|EEO53620.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
          Length = 283

 Score =  191 bits (486), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 161/286 (56%), Gaps = 12/286 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           +V G NGQ+   +  +  ++ +         ++++   +   ++      ++++N AAYT
Sbjct: 1   MVTGANGQLGNEMQVLAKENPQHTYYFTDVEELNICDKQAVWAYIAEKRIELVVNCAAYT 60

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAED  E+A+ +N E    +A AA   G   I +STDYVFDG + TP  E     P 
Sbjct: 61  AVDKAEDNSELAYQLNCEAPKQLASAAQFNGAAMIQVSTDYVFDGTAHTPYTEDCDPCPD 120

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG +KL GE  V +Y    V++RTAW+YS FG+NF+ +M+RL KER  + VV DQ GT
Sbjct: 121 SVYGTTKLEGEYDVMNYCEKAVVIRTAWLYSTFGNNFVKTMIRLGKERDSLGVVFDQIGT 180

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A  +ARAI  I +  I      +RGI+H + + G  SW DF   I   +   G    
Sbjct: 181 PTYANDLARAIYTIINKGI------VRGIYHFSNE-GVCSWYDFTVAIHRLA---GITSC 230

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           KV  + T +YP KA+RPAYS LD +K+  T  I I  W+E ++  L
Sbjct: 231 KVKPLHTAEYPAKANRPAYSVLDKTKIKTTFGIEIPHWEESLQRCL 276


>gi|309780787|ref|ZP_07675528.1| dTDP-4-dehydrorhamnose reductase [Ralstonia sp. 5_7_47FAA]
 gi|308920469|gb|EFP66125.1| dTDP-4-dehydrorhamnose reductase [Ralstonia sp. 5_7_47FAA]
          Length = 305

 Score =  191 bits (486), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 105/293 (35%), Positives = 153/293 (52%), Gaps = 7/293 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G+NGQ+   L        ++I + R   DL +P         + PDVI+NPAAYTAV
Sbjct: 12  LVTGSNGQVGFELRRSLAPLGDVIALDRATCDLTRPDMLRKVVREYRPDVIVNPAAYTAV 71

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE + + AF++N+  AG +A+   ++G   ++ STDYVFDG       E  P NP ++
Sbjct: 72  DKAETDAQTAFAVNSTAAGVLAEETRALGSLLVHYSTDYVFDGTKDGAYVETDPVNPQSV 131

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YGKSKLAGEE +A      +++RT WV    G NF  +ML+L +ER  + V+ DQFG PT
Sbjct: 132 YGKSKLAGEEAIAQSGATALVMRTCWVAGAHGGNFAKTMLKLGRERDSLRVIADQFGAPT 191

Query: 184 SALQIARAIIQIAHNLIENSDTSL--RGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           +A  IA    QI        D +    G++H+ A  G  +W  +A  +   +   G    
Sbjct: 192 TAALIADVTAQIVARAWLAGDRAAFPSGVYHLAA-AGETTWHGYATAVLRYAKALGVELK 250

Query: 242 ----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
               ++  I    YP  A RPA S ++  KL  T  + +  W+ G+  +L  I
Sbjct: 251 VDPDRIEAIPATAYPLPAPRPANSRMNTGKLVETFGVHLPDWQRGIHLLLDQI 303


>gi|153864709|ref|ZP_01997517.1| RmlD substrate binding domain [Beggiatoa sp. SS]
 gi|152145797|gb|EDN72484.1| RmlD substrate binding domain [Beggiatoa sp. SS]
          Length = 289

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 158/289 (54%), Gaps = 18/289 (6%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDV-EIIRVGRPD-------IDLLKPKDFASFFLSFSPDV 53
           + L+IG  GQ+   L   CVQ + E+  VGR         IDL  P           P +
Sbjct: 5   RILLIGPTGQVGWELQR-CVQPLGEVFTVGRAPTGVAQAFIDLSDPDSIRRVLREIKPTI 63

Query: 54  IINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPID 113
           I+N AAYTAVDKAE E E+A +IN    G +A+ +  +    I+ STDYVFDG       
Sbjct: 64  ILNAAAYTAVDKAEQESELAHTINGTAPGILAEESLRLKSLLIHYSTDYVFDGSHSQAYT 123

Query: 114 EFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREIS 173
           E    NPL +YG SKLAGE+ + +   +Y I RTAWVY + G NFLL+M RLAKER E+ 
Sbjct: 124 ETDAVNPLCVYGTSKLAGEQAICAVGGHYFIFRTAWVYGLRGKNFLLTMQRLAKERDELK 183

Query: 174 VVCDQFGTPTSALQIARA----IIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYI 229
           +V DQ G PT +  IA+A    + Q+   L  +    L GI+++T+  G  +W +FA+ I
Sbjct: 184 IVADQIGAPTWSQMIAQATALILAQLRSPLYSSDIEGLSGIYNLTS-AGQTNWYEFAKAI 242

Query: 230 FWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRIST 278
             +  ++     ++  I T  YPT A RPAYS    +KLA T  I + T
Sbjct: 243 IAQLDKQ----PRMLPITTADYPTPAKRPAYSVFINTKLAQTFGISLPT 287


>gi|114571005|ref|YP_757685.1| dTDP-4-dehydrorhamnose reductase [Maricaulis maris MCS10]
 gi|114341467|gb|ABI66747.1| dTDP-4-dehydrorhamnose reductase [Maricaulis maris MCS10]
          Length = 287

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 112/288 (38%), Positives = 157/288 (54%), Gaps = 5/288 (1%)

Query: 5   VIGNNGQIAQS-LSSMCVQDVEIIRVGRPDIDLLKPKDF-ASFFLSFSPDVIINPAAYTA 62
           + G  GQ+A+  L S     +++  + R ++DL       A+   +    V++N AAYTA
Sbjct: 1   MFGTTGQVARCVLDSAGNAGLDVTALSRVNVDLADQDAIRAAIMAAPEGSVVVNAAAYTA 60

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VD+AE +     +INA     +A+A    G   ++ISTDYVFDG   TP  E  PTNP  
Sbjct: 61  VDQAESDEASCRAINAVAPTVMAEACHKRGFIFLHISTDYVFDGSKATPYFEGDPTNPQG 120

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YG +KL GE  V    + +VILRTAWVYS +G NFL +MLRL  +R  + VV DQ G P
Sbjct: 121 VYGTTKLEGEAGVREVHDKWVILRTAWVYSRYGKNFLKTMLRLGADRDSLGVVDDQRGCP 180

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
           T A  IA A+I +   L    D    G++H    GG  SWADFA++IF   ++R G    
Sbjct: 181 THAADIATALITLVDQL--RPDDVRFGLYHFCGRGG-ASWADFADHIFAVQSDRWGRRPD 237

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           V R+ +  YPT A RPA S L   + ++       TW E V+ ++  +
Sbjct: 238 VNRVTSADYPTPAKRPANSMLCSDRFSSAFGFTAPTWTESVQTVVEQL 285


>gi|167837610|ref|ZP_02464493.1| dTDP-4-dehydrorhamnose reductase [Burkholderia thailandensis
           MSMB43]
          Length = 298

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 117/293 (39%), Positives = 155/293 (52%), Gaps = 15/293 (5%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L+ G NGQ+   L+        ++   R ++DL             +PD I+NPAAYTAV
Sbjct: 9   LLTGINGQVGHELARSLQGLGRVVAFDRCELDLSDLDATRRVVRDVAPDWIVNPAAYTAV 68

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE +   A  +NAE  G +A+ A  +G   ++ STDYVFDG       E    NP N+
Sbjct: 69  DKAEADVAAAMRLNAEVPGLLAEEAKRLGAALVHYSTDYVFDGTKVGAYVEDDCVNPQNV 128

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YGK KLAGE+ V +   +++I RT+WVY   G NFLL+MLRL  ER E+SVV DQFG PT
Sbjct: 129 YGKGKLAGEQAVVASGCHHLIFRTSWVYGTRGRNFLLTMLRLGAEREELSVVADQFGAPT 188

Query: 184 SALQIARAIIQIAHNLIENSDTSLR---------GIFHMTADGGPVSWADFAEYIFWESA 234
            +  IA      AH L ++  T  +         G++H+TA GG  SW  FAE IF  S 
Sbjct: 189 WSRTIAEL---TAHVLAQSVVTGAQQVDWWRERSGVYHLTA-GGVTSWHAFAEAIFAFSD 244

Query: 235 ERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               P   V  I +  YPT A RP  S L   +LA T  +    W++ +R  L
Sbjct: 245 LMNKPV--VRAILSSSYPTPAVRPLNSQLSNQRLAETFGVSAPDWRDALRLCL 295


>gi|224026507|ref|ZP_03644873.1| hypothetical protein BACCOPRO_03264 [Bacteroides coprophilus DSM
           18228]
 gi|224019743|gb|EEF77741.1| hypothetical protein BACCOPRO_03264 [Bacteroides coprophilus DSM
           18228]
          Length = 288

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 164/292 (56%), Gaps = 16/292 (5%)

Query: 4   LVIGNNGQIAQSLSSMCVQDV--EIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           L+ G NGQ+   +  +  ++           ++D+   K  A++      D+++N AAYT
Sbjct: 7   LITGANGQLGNEMRLLAEKNTGYHYYFTDVAELDICDEKAVAAYIEEHLIDIVVNCAAYT 66

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAED  E+   +N    G +AKA  S G   I +STDYVFDG +  P  E  PT P 
Sbjct: 67  AVDKAEDNVELCDRLNHLAPGYLAKAIQSRGGALIQVSTDYVFDGSAHVPYGEGQPTCPD 126

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG +KLAGE++   Y ++ VI+RTAW+YS FG+NF+ +MLRL KER  + VV DQ GT
Sbjct: 127 SVYGSTKLAGEQEALKYCSSTVIIRTAWLYSAFGNNFVKTMLRLGKERESLGVVFDQVGT 186

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A  +A AI  I    I      + G++H + + G  SW DF + IF  +   G    
Sbjct: 187 PTYARDLAAAIFTILDKGI------VPGVYHFSNE-GVCSWYDFTKMIFRLA---GITSC 236

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTW----KEGVRNILVN 289
           +V  + T +YP KA+RP YS LD + +  T+ + I  W    +E V+ +L +
Sbjct: 237 QVKPLHTCEYPAKANRPHYSVLDKTLIKETYGVEIPYWVDSLQECVQKLLTD 288


>gi|330829237|ref|YP_004392189.1| dTDP-4-dehydrorhamnose reductase subunit [Aeromonas veronii B565]
 gi|328804373|gb|AEB49572.1| dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of
           dTDP-L-rhamnose synthase [Aeromonas veronii B565]
          Length = 295

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 115/300 (38%), Positives = 162/300 (54%), Gaps = 18/300 (6%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID-------LLKPKDFASFFLSFSPDV 53
           M  L+ G NGQ+   L         + R+   D D          P   A       PDV
Sbjct: 1   MHILLFGKNGQVGWELQRALAP---LGRITAVDFDSSDYCGDFSNPAGVAETVRLVKPDV 57

Query: 54  IINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPID 113
           I+N AA+TAVDKAE E E A  +NA    AIAK A+++G   ++ STDYVFDG    P  
Sbjct: 58  IVNAAAHTAVDKAESEREFAELLNATSVAAIAKEAEALGAWLVHYSTDYVFDGRGERPWV 117

Query: 114 EFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREIS 173
           E   T PLN+YG++KLAGE+  AS  + ++I RT+WVY+  G+NF  +MLR  KER E+S
Sbjct: 118 ETDATAPLNVYGETKLAGEQG-ASLCSRHLIFRTSWVYAARGANFAKTMLRFGKERSEMS 176

Query: 174 VVCDQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWE 232
           V+ DQFG PT A  +A      AH + +  S   + G++H+ A  G  +W D+A+ +F +
Sbjct: 177 VINDQFGAPTGAELLADC---TAHAIRVAQSKPEVAGLYHLIAS-GTTTWFDYAQLVFAK 232

Query: 233 SAERGGPY--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           + E G     +++  + T  +PT A RP  S LD  K   T ++ +  W  GV  +L  I
Sbjct: 233 AREAGVELAVTQLNAVPTSAFPTPAKRPHNSRLDTGKFQRTFDLVLPEWTVGVERMLTEI 292


>gi|302382262|ref|YP_003818085.1| dTDP-4-dehydrorhamnose reductase [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192890|gb|ADL00462.1| dTDP-4-dehydrorhamnose reductase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 300

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 155/291 (53%), Gaps = 3/291 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           +  LV G  GQ+ + L+       V +    R ++DL       + F +     +IN  A
Sbjct: 6   VDILVTGGAGQVGRELARTSWPGGVCLYMPTRSELDLGDADAVRALFAATPFKAVINSGA 65

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE E   AF+ NA G   +A+   + GIP + +STDYVFDGL      E  P  
Sbjct: 66  YTAVDKAESEVADAFAANAMGPAILAEVTKAAGIPLVQVSTDYVFDGLGEAHYAESDPVG 125

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YG SKLAGE  V +     V+LRTAWV S   +NFL +MLRLA +R  + VV DQ 
Sbjct: 126 PLGVYGASKLAGEVAVRTGNPRSVVLRTAWVLSPHRANFLKTMLRLAADRPLVRVVDDQT 185

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PTSA  IA  +  I   +I + +    G++H   + G  +WA  A  IF  SA  GGP
Sbjct: 186 GSPTSARDIADTLATITLKMIADPEAPT-GVYHFV-NAGSTTWAGLAREIFTLSAVLGGP 243

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            ++V  I T QYPT A RPA S L   K+   + +    W++ V  I+  +
Sbjct: 244 SAEVEGITTAQYPTPALRPANSRLSTFKITRDYGVTPRPWQDAVAEIVAEL 294


>gi|221065025|ref|ZP_03541130.1| dTDP-4-dehydrorhamnose reductase [Comamonas testosteroni KF-1]
 gi|220710048|gb|EED65416.1| dTDP-4-dehydrorhamnose reductase [Comamonas testosteroni KF-1]
          Length = 301

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 108/304 (35%), Positives = 162/304 (53%), Gaps = 18/304 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDL---------LKPKDFASFFLSFSP 51
           MK L++G NGQ+   L        E+I + R  +++            +  A    S  P
Sbjct: 1   MKLLLLGKNGQVGWELQRSLAPLGEVIALDRQSVNVDGNSLCGNVGDLQTLAQTIRSVCP 60

Query: 52  DVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTP 111
           DVI+N AA+TAVDKAE EP++A  +NAE    +A  A S+G   ++ STDYVFDG     
Sbjct: 61  DVIVNAAAHTAVDKAEGEPDLALRLNAEAPEVMALEAKSLGALLVHYSTDYVFDGSGSAA 120

Query: 112 IDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERRE 171
             E   T PL++YG++KL GE+++A+    ++I RT+WVY+  G NF  +MLRLA+ER  
Sbjct: 121 RKESDATGPLSVYGRTKLEGEQRIAATNCRHLIFRTSWVYAARGGNFAKTMLRLAQEREA 180

Query: 172 ISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFW 231
           +SV+ DQ+G PT A  IA        ++  +      G++H+ A  G  +W  +A ++  
Sbjct: 181 LSVINDQWGAPTGADLIADVTAHAVRHMSAHEGDG--GLYHLVA-AGETNWHAYASHVI- 236

Query: 232 ESAERGGP-----YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
           E A+   P        +  + T  +PT A RP  S LD  KL  T  + +  W++GV  +
Sbjct: 237 ERAQSLRPDLDWKVQSIAAVPTTAFPTPAARPLNSRLDTQKLQATMQLHLPAWQQGVERM 296

Query: 287 LVNI 290
           L  I
Sbjct: 297 LREI 300


>gi|298290102|ref|YP_003692041.1| dTDP-4-dehydrorhamnose reductase [Starkeya novella DSM 506]
 gi|296926613|gb|ADH87422.1| dTDP-4-dehydrorhamnose reductase [Starkeya novella DSM 506]
          Length = 297

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 109/280 (38%), Positives = 151/280 (53%), Gaps = 4/280 (1%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVE-IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + L++G  GQ+ + ++++    VE +  +    +D+       +    + P V+IN AAY
Sbjct: 3   RVLLLGAGGQVGREIAALAPGRVESLTALDHAGLDITDASALKAALEQYRPQVVINAAAY 62

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE A  INA   G IA+A  S G   I+ISTDYVFDG       E  P  P
Sbjct: 63  TAVDKAESEPEKANLINAVAPGLIAQACASHGAGLIHISTDYVFDGTKAGAYVESDPVAP 122

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG SK AGE  V    + ++I+RT+WVY + G+NFL +MLRLA+ R  ++VV DQ G
Sbjct: 123 LGVYGASKEAGERAVRDSLDRHLIVRTSWVYGVHGANFLKTMLRLAETRDRLTVVADQTG 182

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT+   IA  ++  A  L     T   G +H+ A  G  +W  FA  I   +A   G +
Sbjct: 183 CPTATRDIAEGLLTAAMQLATADVTP--GTYHL-AGTGVTTWHGFASVIVAHAARHTGRH 239

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
            +V  I T  YPT A RPA S L  +  A T     + W+
Sbjct: 240 VEVAPITTADYPTPARRPANSELSSALFARTVGYEAAPWQ 279


>gi|33862387|ref|NP_893947.1| putative dTDP-4-dehydrorhamnose reductase [Prochlorococcus marinus
           str. MIT 9313]
 gi|33640500|emb|CAE20289.1| putative dTDP-4-dehydrorhamnose reductase [Prochlorococcus marinus
           str. MIT 9313]
          Length = 301

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 108/301 (35%), Positives = 157/301 (52%), Gaps = 15/301 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFA------SFFLSFSPDVI 54
           +K L+ G  GQ+ Q+L + C   VE++   R    LL+P D A      +      PD +
Sbjct: 3   IKVLLTGAAGQLGQALQASCPSSVELVSTSRMGDGLLQPLDLADAQACRAAVFQHRPDWV 62

Query: 55  INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDE 114
           +N  AYTAVD AE EP++A ++NA    A+A+     G   + +STD+VF+G    P   
Sbjct: 63  LNAGAYTAVDHAEQEPDLALAVNASAPRALAEGLLETGGRMLQVSTDFVFNGAQGHPYRP 122

Query: 115 FSPTNPLNIYGKSKLAGE---EKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERRE 171
             P +PL +YG +K AGE   E++       V LRT+WVY   G NFLL+MLRL +ER +
Sbjct: 123 NQPRDPLGVYGATKAAGEEAVEQILGAQGRAVTLRTSWVYGPVGRNFLLTMLRLHREREQ 182

Query: 172 ISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFW 231
           ++VV DQ G PTS + +A A   +   + E     L  + H   D G  SW DFA  I  
Sbjct: 183 LNVVVDQVGCPTSTITLATACWAL---MKEPQQPYLPPVLHW-CDAGAASWYDFAVAIGE 238

Query: 232 ESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
               +G     + V  I T +YPT A RP+YS LDCS+      +    W+  +  ++ +
Sbjct: 239 LGVAKGLLQRAAVVNPIITAEYPTPAQRPSYSLLDCSETRQLLGLHACHWRVALEQVIAD 298

Query: 290 I 290
           +
Sbjct: 299 V 299


>gi|254804636|ref|YP_003082857.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis alpha14]
 gi|254668178|emb|CBA04874.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis alpha14]
          Length = 287

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 170/292 (58%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+       +   SF PD I+N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   AF++NA     +A AA       I+ISTDY+FDG  + P  E   TNP
Sbjct: 61  TAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDYIFDGKGKRPYQESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YG+SK AGE    S   + +ILRT+W++S +G NF+ +ML LA+ER  +S V +Q G
Sbjct: 121 SNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFVRTMLNLARERSPLSAVHNQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  +A AII++         + +RGI+H  A G  VSW +FA++IF  ++++    
Sbjct: 181 CPTYAGDLAAAIIRLLQQT-----SPVRGIYHY-AGGKSVSWYEFAQHIFQAASQQQTSF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  +  K+YPT A RPAYS LDC K+ N  +I+ S W++ +  ++  +
Sbjct: 235 PVPELTAVSDKEYPTAAPRPAYSILDCRKIENDFSIKPSDWQKALAQVVSKL 286


>gi|29347140|ref|NP_810643.1| putative dTDP-4-dehydrorhamnose reductase [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|253571877|ref|ZP_04849282.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|29339039|gb|AAO76837.1| putative dTDP-4-dehydrorhamnose reductase [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|251838474|gb|EES66560.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 282

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 165/289 (57%), Gaps = 12/289 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ LV G NGQ+   +  +  ++ +         ++D+       ++      ++I+N A
Sbjct: 1   MRILVTGANGQLGNEMQVLAKENPQHTYYFTDVQELDICNKDAVWAYIAEKRIELIVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED+ E+A+ +N+E    +A AA   G   I +STDYVFDG +  P  E    
Sbjct: 61  AYTAVDKAEDDSELAYKLNSEAPKTLACAAQFNGAAMIQVSTDYVFDGTAHIPYTEECDP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG +KL GE +V ++    V++RTAW+YS FG+NF+ +M+RL KER  + V+ DQ
Sbjct: 121 CPNSVYGTTKLEGEYEVLNHCEKSVVIRTAWLYSTFGNNFVKTMIRLGKERDSLGVIFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +A+AI  I +  I      +RG++H + + G  SW DF   I   +   G 
Sbjct: 181 VGTPTYANDLAQAIFAIINKGI------VRGVYHFSNE-GVCSWYDFTVAIHRLA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              KV  + T +YPT+A+RPAYS LD +K+  T  I I  W+E ++  +
Sbjct: 231 TSCKVKPLHTAEYPTRANRPAYSVLDKTKIKTTFGIEIPHWEESLKRCI 279


>gi|221134348|ref|ZP_03560653.1| dTDP-4-dehydrorhamnose reductase [Glaciecola sp. HTCC2999]
          Length = 286

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 164/291 (56%), Gaps = 13/291 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK L+ G NGQ+    S + + Q++E+I  G+  +D+   +     F    PD++IN AA
Sbjct: 1   MKILIAGANGQVGSEFSQLNLDQNIELILCGKDTLDITDKRLTEQLFEHHRPDIVINCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVD AE EPE AF IN  G   +A A     +  I++STDYVFDG    P +     N
Sbjct: 61  YTAVDLAEKEPERAFLINETGCENLAIACVKYDVHLIHLSTDYVFDGTKSLPYESNDIPN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+N+YG+SKLAGE+K+    + Y ILR +WV+  +G+NF+ +MLRLA+    + ++ DQ 
Sbjct: 121 PINVYGQSKLAGEQKIIHLLSRYTILRVSWVFGQYGNNFVKTMLRLAENNTHLEIINDQL 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGG 238
           G PT+A  IA   + IA    +NSD    GI H +  G P VSWA FAE IF  +   G 
Sbjct: 181 GGPTAANDIAMICVNIA----QNSD-RFTGILHFS--GTPFVSWAQFAEAIFRTAHIEGA 233

Query: 239 PYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             S   V  I +  Y +  +RP  S L  S ++ +H  +I  W++ +  I+
Sbjct: 234 IKSVPSVVPIKSIDYKSSTNRPKNSTLKTS-ISLSH-FKIINWQKSMLKIV 282


>gi|56476692|ref|YP_158281.1| putative dTDP-4-keto-L-rhamnose reductase [Aromatoleum aromaticum
           EbN1]
 gi|56312735|emb|CAI07380.1| putative dTDP-4-keto-L-rhamnose reductase [Aromatoleum aromaticum
           EbN1]
          Length = 298

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 116/293 (39%), Positives = 152/293 (51%), Gaps = 7/293 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G NGQ+   L+   +   ++I + R   DL +P   A+      PDVIIN AAY
Sbjct: 1   MKLLVTGANGQVGWELARSLMPLGDVIALDRSRCDLSRPAALAALVDELEPDVIINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE +   A  IN    G +A+ A   G   ++ STDYVFDG    P DE  P  P
Sbjct: 61  TAVDRAESDEAAATLINGVAPGELARVAKRRGALLVHYSTDYVFDGTKSAPYDEDDPVAP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +N YG+SKLAGE  +     +++I RT WV++  G NF+ +MLRL  ER  + VV DQ G
Sbjct: 121 INAYGRSKLAGELAIGESGCDHLIFRTTWVFAARGGNFVRTMLRLGAERDSLHVVADQIG 180

Query: 181 TPTSALQIARAI-IQIAHNLIENSDTSL-RGIFHMTADGGPVSWADFAEYIFWESAER-- 236
            PT A  IA A  + +A    E    S   G+F++ A  G  SW  FAE IF  +  +  
Sbjct: 181 APTWARNIADATALALARAQAERQQRSFSSGVFNL-ASRGETSWHGFAEAIFAGARAQLP 239

Query: 237 --GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             G   + V  I +  YPT A RPA S L   KL     I +  W E +   L
Sbjct: 240 GIGLKVAAVAPIPSSAYPTPAARPANSRLAAGKLQARFGIVMPRWDEALARCL 292


>gi|227887093|ref|ZP_04004898.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli 83972]
 gi|227835443|gb|EEJ45909.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli 83972]
 gi|297499071|gb|ADI43257.1| RmlD [Escherichia coli]
 gi|307554112|gb|ADN46887.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli ABU 83972]
          Length = 299

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 161/293 (54%), Gaps = 9/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGSGDRPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          +   D +  G++H+ A  G  +W D+A  +F E+ + 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPDVA--GLYHLVAS-GTTTWYDYAALVFEEARKA 237

Query: 237 GGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 238 DIPLALNKLNAVPTTAYPTPACRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|2662408|gb|AAC00179.1| putative dTDP-L-rhamnose synthase [Serratia marcescens]
          Length = 288

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 164/294 (55%), Gaps = 13/294 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G  GQ+ + +      +  ++ +    +D+      ++      PD IIN AAY
Sbjct: 1   MRVLLTGAAGQLGRCIIDRFPANWTLVAMDSQQLDIADSAAVSATVEQLVPDAIINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE A +INA G G +A AA  + IP I+ISTDYVFDG S  P  E +P +P
Sbjct: 61  TAVDKAESEPEKARAINAFGPGFLAAAAAKLDIPFIHISTDYVFDGTSSEPYCEETPCSP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YG++KL GE          V++RTAWV+S +G+NF+ +MLR+  +R E+ VV DQ G
Sbjct: 121 KSVYGQTKLEGELAALQANPKTVVIRTAWVFSEYGNNFVKTMLRVGAQRGELGVVSDQLG 180

Query: 181 TPTSALQIARAII-QIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
            PT A  IA  +I  ++H  +        GI+H   D   VSW DF   IF E AE    
Sbjct: 181 CPTYAGDIAATVIAMLSHPQLP------YGIYHYCGDNA-VSWFDFGCAIFRE-AETSTR 232

Query: 240 YSK---VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           Y     V  I T +YPT A RPAYS L  SK+     ++ S W++ ++ ++  I
Sbjct: 233 YPHKVSVKPIATHEYPTPASRPAYSILSTSKICAL-ALKPSPWEQQLKTVIQKI 285


>gi|320185806|gb|EFW60560.1| dTDP-4-dehydrorhamnose reductase [Shigella flexneri CDC 796-83]
          Length = 277

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 151/258 (58%), Gaps = 11/258 (4%)

Query: 35  DLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIP 94
           D   P+  A       PDVI+N AA+TAVDKAE EPE A  +NA    +IAK A+ +G  
Sbjct: 17  DFSNPEGVAETVKRIRPDVIVNAAAHTAVDKAESEPEFAQLLNATSVESIAKEANEVGAW 76

Query: 95  CIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIF 154
            I+ STDYVF G   TP  E   T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  
Sbjct: 77  VIHYSTDYVFPGNGDTPWLETDATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAAK 136

Query: 155 GSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIF 211
           G+NF  +MLRLAKER E++V+ DQFG PT A  +A      I++A N  E     + G++
Sbjct: 137 GNNFAKTMLRLAKEREELAVINDQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLY 191

Query: 212 HMTADGGPVSWADFAEYIFWESAERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLA 269
           H+ A  G  +W D+A  +F E+ + G P +  K+  + T  YPT A RP  S L+  K  
Sbjct: 192 HLVA-SGTTTWHDYAALVFEEARKAGIPLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQ 250

Query: 270 NTHNIRISTWKEGVRNIL 287
               + +  W+ GV+ +L
Sbjct: 251 QNFALVLPDWQVGVKRML 268


>gi|124265820|ref|YP_001019824.1| dTDP-4-dehydrorhamnose reductase [Methylibium petroleiphilum PM1]
 gi|124258595|gb|ABM93589.1| dTDP-4-dehydrorhamnose reductase [Methylibium petroleiphilum PM1]
          Length = 298

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 164/299 (54%), Gaps = 13/299 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI----DLLKPKDFASFFLSFSPDVIIN 56
           M+ L++G NGQ+   L        E++ + R       DL  P+   +      PD+I+N
Sbjct: 1   MRILLLGKNGQVGWELQRALAPLGELLALARDSAPLAADLGCPEALVATVRHVRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AAYTAVD+AE EP +A ++NA     +A+ A  +G   ++ STDYVFDG    P DE +
Sbjct: 61  AAAYTAVDRAEREPALARAVNAIAPAVLAREAAMLGATLVHFSTDYVFDGSGSAPRDESA 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T P+N+YG+SKL GE  + +    ++ILR++WV++  GSNF  ++L LA ER  + +V 
Sbjct: 121 RTAPINVYGESKLEGEMAIRASGCRHLILRSSWVHAARGSNFAKTVLCLAAEREHLEIVD 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIE-NSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           DQ G PT A  +A      AH L     + SL G +H+TA GG  S   +A ++   +  
Sbjct: 181 DQIGAPTGAELLADV---TAHALWSVRQEPSLAGTYHVTA-GGETSRHAYALFVIERARA 236

Query: 236 RGGPYS----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            G P +     V  + T  +PT+A RP  S LD  +L +   +R+  W+EGV  +L+ +
Sbjct: 237 HGHPLNVAADAVRPVPTSVFPTRARRPLNSRLDTGRLQSRFGLRLPPWQEGVERLLIEV 295


>gi|261392875|emb|CAX50456.1| dTDP-4-dehydrorhamnose reductase (dTDP-4-keto-L-rhamnose reductase;
           dTDP-6-deoxy-L-mannose dehydrogenase; dTDP-L-rhamnose
           synthetase) [Neisseria meningitidis 8013]
          Length = 287

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 169/292 (57%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+       +   SF PD I+N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   AF++NA     +A AA       I+ISTDY+FDG  + P  E   TNP
Sbjct: 61  TAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDYIFDGKGKRPYQESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YG+SK AGE    S   + +ILRT+W++S +G NF+ +ML LA+ER  +S V +Q G
Sbjct: 121 SNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFVRTMLNLARERSPLSAVHNQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  +A AII++         + +RGI+H  A G  VSW +FA++IF  ++++    
Sbjct: 181 CPTYAGDLAAAIIRLLQQT-----SPVRGIYHY-AGGKSVSWYEFAQHIFQAASQQQTSF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  +  K+YPT A RPAYS LDC K+ N   I+ S W++ +  ++  +
Sbjct: 235 PVPELTAVSDKEYPTAAPRPAYSILDCRKIENDFGIKPSDWQKALAQVVSKL 286


>gi|121634552|ref|YP_974797.1| putative dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis
           FAM18]
 gi|304387935|ref|ZP_07370108.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis ATCC
           13091]
 gi|120866258|emb|CAM09999.1| putative dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis
           FAM18]
 gi|254671818|emb|CBA03938.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis alpha275]
 gi|304338032|gb|EFM04169.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis ATCC
           13091]
 gi|308388944|gb|ADO31264.1| putative dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis
           alpha710]
 gi|316983741|gb|EFV62722.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis H44/76]
 gi|325197976|gb|ADY93432.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis G2136]
 gi|325200558|gb|ADY96013.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis H44/76]
          Length = 287

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 169/292 (57%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+       +   SF PD I+N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE     AF++NA     +A AA       I+ISTDY+FDG  + P  E   TNP
Sbjct: 61  TAVDKAEGNAAAAFAVNASAVYNLALAAHRAHARFIHISTDYIFDGKGKRPYQESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YG+SK AGE    S   + +ILRT+W++S +G NF+ +ML LA+ER  +S V +Q G
Sbjct: 121 SNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFVRTMLNLARERSPLSAVHNQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  +A AII++         + +RGI+H  A G  VSW +FA++IF  ++++    
Sbjct: 181 CPTYAGDLAAAIIRLLQQT-----SPVRGIYHY-AGGKSVSWYEFAQHIFQAASQQQTSF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  +  K+YPT A RPAYS LDC K+ N  +I+ S W++ +  ++  +
Sbjct: 235 PVPELTAVSDKEYPTAAPRPAYSILDCRKIENDFSIKPSDWQKALAQVVSKL 286


>gi|297569756|ref|YP_003691100.1| dTDP-4-dehydrorhamnose reductase [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925671|gb|ADH86481.1| dTDP-4-dehydrorhamnose reductase [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 296

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 109/292 (37%), Positives = 160/292 (54%), Gaps = 9/292 (3%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           ++ G  GQ+   L    V    ++ +GR  +DL  P    +      P  IIN  A+TAV
Sbjct: 6   IIFGAEGQVGWELQRSLVLLGPLLPLGRGQVDLADPAAVRAAIRDIDPSAIINAGAFTAV 65

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D AE E   A ++N      +A    ++GIP ++ STDYV+DG    P  E  P NP ++
Sbjct: 66  DLAESEEATARAVNEVAPATMAAETRALGIPLVHFSTDYVYDGDQDGPYLETDPPNPRSV 125

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKLAG+E +A+   +Y+ILRT+WV++  G NFL ++LRLA ER  ++VV DQFG PT
Sbjct: 126 YGRSKLAGDEAIAASGADYLILRTSWVFAARGQNFLQTILRLAAERSSLTVVADQFGAPT 185

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG-----G 238
           +A  +A    +    L   + T+  GI+H TA  G  SW D+A +I  E+ + G     G
Sbjct: 186 AAELLADVTARALPAL--QAGTASGGIYHCTA-AGETSWYDYARFIVGEAGKLGASLQLG 242

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  I T +YP  A RPA S LDC +L     + +  W+  V+  L  +
Sbjct: 243 P-EQIKPISTAEYPRPAARPANSRLDCRRLEQAFGLTLPPWQFHVKRALKEL 293


>gi|310814582|ref|YP_003962546.1| dTDP-4-dehydrorhamnose reductase [Ketogulonicigenium vulgare Y25]
 gi|308753317|gb|ADO41246.1| dTDP-4-dehydrorhamnose reductase [Ketogulonicigenium vulgare Y25]
          Length = 283

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 123/288 (42%), Positives = 166/288 (57%), Gaps = 13/288 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G  GQ+A  L S+     E++ + R   DLL P    +      PD IIN AA+
Sbjct: 1   MKILVFGRTGQVATELQSLVP---EVVFLDRTQADLLDPASCVTAINRHRPDAIINAAAW 57

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE E   A  IN +   A+A+AA ++ +P I+ISTDYVF+G   TP     PT P
Sbjct: 58  TAVDKAETEEGSAALINGDAPAAMARAAAALDVPFIHISTDYVFNGGGNTPFKPDDPTAP 117

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L  YG++K  GE  V +    Y ILRT+WV+S  G+NF+ +MLRL  +R  ++VV DQ G
Sbjct: 118 LGAYGRTKRLGEVGVEAAGGRYAILRTSWVFSAHGANFVKTMLRLGAQRDRLNVVADQIG 177

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PTSA  IA+A +++A +L   +  +L GI+H +  G P VSWADFA  I    A    P
Sbjct: 178 GPTSARAIAQACLRMAEHLA--AAPNLSGIYHFS--GTPDVSWADFARAIM---AAAQLP 230

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + ++ I +  YPT A RP  S LDCS LA     R   W++ +  +L
Sbjct: 231 CT-IHDIPSTDYPTPAARPLNSRLDCSSLARFDLTR-PDWQQDLLVVL 276


>gi|265752204|ref|ZP_06087997.1| dTDP-4-dehydrorhamnose reductase [Bacteroides sp. 3_1_33FAA]
 gi|263236996|gb|EEZ22466.1| dTDP-4-dehydrorhamnose reductase [Bacteroides sp. 3_1_33FAA]
          Length = 285

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 112/283 (39%), Positives = 157/283 (55%), Gaps = 12/283 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVE--IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           LV G NGQ+   +  +  +  E         ++D+   +   +F    +  VI+N AAYT
Sbjct: 5   LVTGANGQLGNEMRVLSAEYKEYTCFFTDVAELDICDEQAVMTFVKENNIHVIVNCAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAED+ E+   +N      +AKAA++     I ISTDYVFDG    P DE     P 
Sbjct: 65  AVDKAEDDIELCTKLNKNAVSYLAKAAEANWGEFIQISTDYVFDGTKYLPYDEGDVPCPN 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YGK+KLAGE     Y    +I+RTAW+YS FG+NF+ +M+RL KER  + VV DQ GT
Sbjct: 125 SVYGKTKLAGETNALEYCKKTMIIRTAWLYSTFGNNFVKTMIRLGKEREALGVVFDQIGT 184

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A  +ARAI+   H  +      + G++H + D G  SW DF + I   +   G    
Sbjct: 185 PTYARDLARAILVAIHKGV------VPGVYHFS-DEGVCSWYDFTKAIHRIA---GITTC 234

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           KV  + T +YP KA RP YS LD +K+  T++I I  W+E + 
Sbjct: 235 KVTPLHTNEYPAKAPRPHYSVLDKTKIKTTYDIGIPHWEESLE 277


>gi|282801702|gb|ADB02812.1| RmlD [Escherichia coli]
          Length = 299

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 160/293 (54%), Gaps = 9/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P   A    S  PD+I+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPDGVAETIRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGSGDRPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          +   D +  G++H+ A  G  +W D+A  +F E+ + 
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPDVA--GLYHLVA-SGTTTWYDYAALVFEEARKA 237

Query: 237 GGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 238 DIPLALNKLNAVPTTAYPTPACRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|121592968|ref|YP_984864.1| dTDP-4-dehydrorhamnose reductase [Acidovorax sp. JS42]
 gi|120605048|gb|ABM40788.1| dTDP-4-dehydrorhamnose reductase [Acidovorax sp. JS42]
          Length = 292

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 103/294 (35%), Positives = 158/294 (53%), Gaps = 7/294 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M  L++G NGQ+   L         +  +G  + D  +P+  A    +  P VI+N AA+
Sbjct: 1   MNILLLGKNGQVGWELQRSLSVLGPVTALGHDEADFTQPQAVAQAVRALRPQVIVNAAAH 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE A  +NA   G +A+ A+ +G   ++ STDYVFDG   TP  E     P
Sbjct: 61  TAVDKAESEPERARLLNAATPGVLAQEAERLGALLVHYSTDYVFDGSGDTPWVETDAPAP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L++YG +KL GE  +      ++ILRT+WVY+  G NF  +MLRLA+ER  ++V+ DQ+G
Sbjct: 121 LSVYGATKLEGERLIQQSGCRHLILRTSWVYAARGGNFAKTMLRLAQERERLTVIDDQWG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT A  +A         L    +    G++H  A  G  +W  +A+Y+   +A+     
Sbjct: 181 APTGADLLADVTAHAIRQLQRRPEDG--GLYHCVA-AGETTWHAYAKYVLEHAAQVQAAI 237

Query: 241 S----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                ++  + T  +PT A RP  S LD ++L +T  + + +W++GV  +L  I
Sbjct: 238 EIKAKEIAPVPTSAFPTPAARPHNSRLDTARLRDTFGLTLPSWQQGVARMLTEI 291


>gi|254489469|ref|ZP_05102672.1| dTDP-4-dehydrorhamnose reductase [Roseobacter sp. GAI101]
 gi|214041976|gb|EEB82616.1| dTDP-4-dehydrorhamnose reductase [Roseobacter sp. GAI101]
          Length = 288

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 156/291 (53%), Gaps = 9/291 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G++GQ+A  L ++    + I  + R   DL  P   A+   + +PD +IN AAY
Sbjct: 1   MKILVFGHSGQVATELRALDGNGIRITALDRAAADLTDPAACAAAIDAHAPDAVINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   A  INA+   A+++A  +  IP + ISTDYVF G    P     P +P
Sbjct: 61  TAVDKAESDHATADLINAQAPAAMSRACAARDIPFVSISTDYVFSGEGNAPWKPDDPADP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
             IYG +K  GE  +      Y +LRT+W  S  G+NF+ +MLRL  ER  +++V DQ G
Sbjct: 121 QGIYGGTKRDGEILIEEIGGRYAVLRTSWAVSAHGNNFVKTMLRLGAEREALTIVADQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PT A +IA+A + IA  L+  S+    GI+H +  G P  SWADFA  IF    ++ G 
Sbjct: 181 GPTGAAEIAQACVTIAQTLV--SEPEKAGIYHFS--GTPDTSWADFARAIF----DQAGI 232

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V  I +  YPT A RP  S ++CS       I    W+  +  I+  +
Sbjct: 233 TCAVTDIPSTDYPTPAKRPLNSRMNCSATTVAFGIARPDWRASLSQIIAQL 283


>gi|296313829|ref|ZP_06863770.1| dTDP-4-dehydrorhamnose reductase [Neisseria polysaccharea ATCC
           43768]
 gi|296839557|gb|EFH23495.1| dTDP-4-dehydrorhamnose reductase [Neisseria polysaccharea ATCC
           43768]
          Length = 287

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 173/292 (59%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+       +   SF PD I+N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   AF++NA     +A AA       I+ISTDY+FDG  + P  E   TNP
Sbjct: 61  TAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDYIFDGKGKRPYQESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YG+SK AGE    S   + +ILRT+W++S +G+NF+ +ML LA+ER  +S V +Q G
Sbjct: 121 SNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGNNFVRTMLNLARERSPLSTVHNQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  ++ AII+    L++ S+  +RGI+H  A G  VSW +FA++IF  ++++    
Sbjct: 181 CPTYAGDLSAAIIR----LLQQSN-PVRGIYHY-AGGKSVSWYEFAQHIFQAASQQQTSF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  +  K+YPT A RPAYS LDC K+ N   I+ S W++ +  ++  +
Sbjct: 235 PIPELTAVSDKEYPTAAPRPAYSILDCRKIENDFGIKPSDWQKALAQVVSKL 286


>gi|296136996|ref|YP_003644238.1| dTDP-4-dehydrorhamnose reductase [Thiomonas intermedia K12]
 gi|295797118|gb|ADG31908.1| dTDP-4-dehydrorhamnose reductase [Thiomonas intermedia K12]
          Length = 302

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 111/296 (37%), Positives = 160/296 (54%), Gaps = 13/296 (4%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G +GQ+   L    +   ++  + R   DL       +      P++I+N AAYT
Sbjct: 5   RILLLGADGQVGWELRRALLPLGDVRPLNRTQADLGDLDALRTVLQREQPELIVNAAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTP--IDEFSPTN 119
           AVDKAE +PE+A  INA   G +A  A       ++ STDYVFDG    P    E    N
Sbjct: 65  AVDKAETDPELAQRINAAAPGVLAAWAAEHHAMLVHYSTDYVFDGAKPAPGSYTEADTPN 124

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P + YG+SKLAGE+ + +    ++ILRT+WVY+  G NF  +ML+LA ER  + V+ DQF
Sbjct: 125 PQSAYGRSKLAGEQAITASGCRHLILRTSWVYAARGGNFAKTMLKLAAERDSLRVIADQF 184

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSL----RGIFHMTADGGPVSWADFAEYIFWESAE 235
           G PTSA  IA    Q+   L   +D +L     G++H+TA G   SW  +A+++   +  
Sbjct: 185 GAPTSAELIADVTAQMLQRL--RTDPALAAQASGLYHLTAQGS-TSWHGYAQFVIAAAKA 241

Query: 236 RGGPY----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           RG P       V  I T  YP  A RPA S LDCSKL  T ++ +  W+  V+ ++
Sbjct: 242 RGLPLRCASEHVQAITTADYPLPAPRPANSRLDCSKLQTTFDLFLPPWQTQVQRLI 297


>gi|304310332|ref|YP_003809930.1| dTDP-4-keto-L-rhamnose reductase [gamma proteobacterium HdN1]
 gi|301796065|emb|CBL44269.1| dTDP-4-keto-L-rhamnose reductase [gamma proteobacterium HdN1]
          Length = 301

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 110/295 (37%), Positives = 159/295 (53%), Gaps = 11/295 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI----DLLKPKDFASFFLSFSPDVIIN 56
           MK L+ G NGQ+   L        E+I +G+ +     DL   +   +     +PDVI+N
Sbjct: 1   MKLLIFGKNGQVGWELQRSLAPLGEVIALGQNEANLCGDLSNLEGLRATLQRVAPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVD+AE EP++A+ INAE    +A+ A  +G   ++ STDYV++G       E  
Sbjct: 61  AAAHTAVDRAESEPDLAYRINAEAPSVMAEEAQRLGALLVHYSTDYVYEGSGERFWQESD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
              PLN+YGKSKLAG++ + +    ++I RT+WVY+  G+NF  +ML LA+ R  +SVV 
Sbjct: 121 APAPLNLYGKSKLAGDQAIMASGCRHLIFRTSWVYAARGNNFAKTMLGLARTRNALSVVS 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G PT A  IA    Q  +  +   D   +G++H+ A G   SW D+A  +F  + E 
Sbjct: 181 DQVGAPTGAELIADVTAQAIYQAL--LDPQKQGLYHLVASGS-TSWFDYAREVFSVAREL 237

Query: 237 GGPYS----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G         V  I + +YP  A RP  S L   KL NT  + +  WK GV  +L
Sbjct: 238 GETLQLSDDAVTPIASSEYPKPAQRPLNSRLCTQKLTNTFQLTLPDWKVGVARML 292


>gi|145298429|ref|YP_001141270.1| dTDP-4-dehydrorhamnose reductase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851201|gb|ABO89522.1| dTDP-4-dehydrorhamnose reductase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 295

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 114/297 (38%), Positives = 160/297 (53%), Gaps = 12/297 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G NGQ+   L      +  +  +     D   D   P   A       PDVI+N
Sbjct: 1   MHILLFGKNGQVGWELQRALAPLGSITAVDFDSSDYCGDFSNPAGVAETVRLVKPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE E E A  +NA    AIAK A+++G   ++ STDYVFDG    P  E  
Sbjct: 61  AAAHTAVDKAESEREFAELLNATSVAAIAKEAEALGAWLVHYSTDYVFDGRGERPWVETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+  A     ++I RT+WVY+  G+NF  +MLR  KER E+S++ 
Sbjct: 121 ATAPLNVYGETKLAGEQG-AVLCARHLIFRTSWVYAARGANFAKTMLRFGKERSEMSIIN 179

Query: 177 DQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           DQFG PT A  +A      AH + +  S   + G++H+ A  G  +W D+A  +F ++ E
Sbjct: 180 DQFGAPTGAELLADC---TAHAIRVAQSKPDVAGLYHLIAS-GTTTWFDYARLVFAKARE 235

Query: 236 RGGPY--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            G     +++  + T  +PT A RP  S LD SK   T N+ +  W  GV  +L  I
Sbjct: 236 AGVELAVTQLNAVPTSAFPTPAKRPHNSRLDTSKFQRTFNLVLPDWTVGVERMLTEI 292


>gi|304405206|ref|ZP_07386866.1| dTDP-4-dehydrorhamnose reductase [Paenibacillus curdlanolyticus
           YK9]
 gi|304346085|gb|EFM11919.1| dTDP-4-dehydrorhamnose reductase [Paenibacillus curdlanolyticus
           YK9]
          Length = 299

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 107/291 (36%), Positives = 156/291 (53%), Gaps = 13/291 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
            + +V G NGQ+   L     +   E+  +GR ++D+   +          PDV+I+  A
Sbjct: 4   QRIVVTGANGQLGVDLVKHLEELGHEVHGLGRAELDVTSERQVQHTLRELKPDVVIHSGA 63

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VD+AE EP+ A+ +N  G   IA AA SIG   +Y+STDYVF+G    P DEFSP +
Sbjct: 64  YTKVDQAEAEPDQAYMVNGYGTANIASAAHSIGAKLVYVSTDYVFNGQGFRPYDEFSPID 123

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+N+YGKSK  GE  + +    + I+RT+WVY   G+NF+ +ML+L  ER  +SVV DQ 
Sbjct: 124 PVNVYGKSKWMGERFIETLHARHYIVRTSWVYGAHGANFVKTMLKLGAERGSVSVVNDQV 183

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PT    +A  I Q    LIE   T   G +H++ + G  SW +FAE IF       G 
Sbjct: 184 GCPTFTKDLAACIGQ----LIE---TERYGTYHVS-NSGSCSWHEFAEAIF----RHAGL 231

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             ++  + + Q+   A RP+YS  D   L       +  W+E ++  L  +
Sbjct: 232 QVELTAVTSDQFVRPAKRPSYSVFDHMSLRLGGFPAMRHWEEALKQFLTEL 282


>gi|325129930|gb|EGC52731.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis
           OX99.30304]
 gi|325132009|gb|EGC54708.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis M6190]
 gi|325136020|gb|EGC58630.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis M0579]
 gi|325137840|gb|EGC60415.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis ES14902]
 gi|325202447|gb|ADY97901.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis
           M01-240149]
 gi|325207801|gb|ADZ03253.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis NZ-05/33]
          Length = 287

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 168/292 (57%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+       +   SF PD I+N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE     AF++NA     +A AA       I+ISTDY+FDG  + P  E   TNP
Sbjct: 61  TAVDKAEGNAAAAFAVNASAVYNLALAAHRAHARFIHISTDYIFDGKGKRPYQESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YG+SK AGE    S   + +ILRT+W++S +G NF+ +ML LA+ER  +S V +Q G
Sbjct: 121 SNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFVRTMLNLARERSPLSAVHNQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  +A AII++         + +RGI+H  A G  VSW +FA++IF  ++++    
Sbjct: 181 CPTYAGDLAAAIIRLLQQT-----SPVRGIYHY-AGGKSVSWYEFAQHIFQAASQQQTSF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  +  K+YPT A RPAYS LDC K+ N   I+ S W++ +  ++  +
Sbjct: 235 PVPELTAVSDKEYPTAAPRPAYSILDCRKIENDFGIKPSDWQKALAQVVSKL 286


>gi|325127860|gb|EGC50766.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis N1568]
          Length = 287

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 170/292 (58%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+       +   SF PD I+N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   AF++NA     +A AA       I+ISTDYVFDG  + P  E   TNP
Sbjct: 61  TAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDYVFDGKGKRPYQESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YG+SK AGE    S   + +ILRT+W++S +G+NF+ +ML LA+ER  +S V +Q G
Sbjct: 121 SNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGNNFVRTMLNLARERSPLSAVHNQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  +A AII++         + +RGI+H  A G  VSW +F ++IF  ++++    
Sbjct: 181 CPTYAGDLAAAIIRLLQQT-----SPVRGIYHY-AGGKSVSWYEFVQHIFQAASQQQTSF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  +  K+YPT A RPAYS LDC K+ N  +I+ S W++ +  ++  +
Sbjct: 235 PIPELTAVSDKEYPTAAPRPAYSILDCRKIENDFSIKPSDWQKALAQVVSKL 286


>gi|295098218|emb|CBK87308.1| dTDP-4-dehydrorhamnose reductase [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 299

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 113/297 (38%), Positives = 160/297 (53%), Gaps = 11/297 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    +  PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSKDYCGDFSNPEGIAETVRNIKPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EP+ A  +NA    AIAK A  IG   ++ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEPDFAQLLNATSVEAIAKEAAKIGAWVVHYSTDYVFPGDGETPWSETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KL GE+ +     N++I RT+WVY+  G+NF  +MLRLAKER+E+SV+ 
Sbjct: 121 ATAPLNVYGQTKLNGEKALQDNCPNHLIFRTSWVYAGKGNNFAKTMLRLAKERKELSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G PT A  +A          + N + +  G++H+ A     SW D+A  +F E A++
Sbjct: 181 DQVGAPTGAELLADCTAHAIRVAMVNPEVA--GLYHLVAS-ETTSWYDYAALVF-EEAQK 236

Query: 237 GG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            G      K+  + T  YPT A RP  S L+  K     N+ +  W  GV+ +L  +
Sbjct: 237 AGIELAIEKLNAVPTTAYPTPARRPHNSRLNTMKFQQNFNLVLPAWHVGVKRMLAEL 293


>gi|261400440|ref|ZP_05986565.1| dTDP-4-dehydrorhamnose reductase [Neisseria lactamica ATCC 23970]
 gi|269209890|gb|EEZ76345.1| dTDP-4-dehydrorhamnose reductase [Neisseria lactamica ATCC 23970]
          Length = 287

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 164/292 (56%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+           +F PD ++N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRIPEDWETIATDSASLDITDADAVCRMIQNFQPDAVVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +    F++NA     +A AA       I+ISTDYVFDG +  P  E   TNP
Sbjct: 61  TAVDKAEGDAAATFAVNASAVYNLASAAHRAHARFIHISTDYVFDGQADKPYLESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            NIYGKSK AGE    S   + +ILRT+W++S +G NF+ +ML  A ER  + VV +Q G
Sbjct: 121 PNIYGKSKAAGELLALSANPDSLILRTSWLFSEYGDNFVRTMLNRADERSSLPVVSNQTG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  +A AII+    L++ S + +RGI+H  A G  VSW +FA +IF  +  +    
Sbjct: 181 CPTYAGDLAAAIIR----LLQQS-SPVRGIYHF-AGGKSVSWYEFARHIFQTALRQDASF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  +  ++YP  A RP YS LDC K+ +   I+ S W++ +  +++ +
Sbjct: 235 PIPELKAVSDEEYPAAASRPPYSILDCRKIESGFGIKPSDWQKALSQVVLKL 286


>gi|189500819|ref|YP_001960289.1| dTDP-4-dehydrorhamnose reductase [Chlorobium phaeobacteroides BS1]
 gi|189496260|gb|ACE04808.1| dTDP-4-dehydrorhamnose reductase [Chlorobium phaeobacteroides BS1]
          Length = 286

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 111/290 (38%), Positives = 162/290 (55%), Gaps = 11/290 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFL---SFSPDVIINP 57
           M  LV G NGQ+   L  +  +  E +     D+ LL   D A         + D I+N 
Sbjct: 1   MNILVTGGNGQLGSELKELAARH-EGMTFFFYDLPLLDITDRAMVHRVCGEHAVDAIVNC 59

Query: 58  AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSP 117
           AAYTAVD+AEDEPE A+ +N +G   +A+AA       +++STDYVF+G S TP  E   
Sbjct: 60  AAYTAVDRAEDEPEAAYRVNRDGPEVLAEAAKERHALLVHVSTDYVFNGESCTPYHEGDA 119

Query: 118 TNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD 177
            +PL +YG+SK  GEEK+ +   +Y+I+RT+W+YS  G NF+ +MLRL  ER E+ VV D
Sbjct: 120 VSPLGVYGQSKWEGEEKIRAIAPSYMIVRTSWLYSSHGRNFVKTMLRLGSERDELKVVFD 179

Query: 178 QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
           Q GTPT A  +A A++ +      + + +    +H + + G  SW DFA  +      R 
Sbjct: 180 QAGTPTLAADLAEALVSMLSRY--DREHTYAETYHYSNE-GVCSWYDFARAVM---RARQ 233

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            P  +V  + + +YPTKA RP YS LD  K+    N+ I  W++ +  +L
Sbjct: 234 LP-CRVLPVGSGEYPTKAKRPHYSVLDKGKIKEHWNLEIPHWQDSLERML 282


>gi|261364731|ref|ZP_05977614.1| dTDP-4-dehydrorhamnose reductase [Neisseria mucosa ATCC 25996]
 gi|288567031|gb|EFC88591.1| dTDP-4-dehydrorhamnose reductase [Neisseria mucosa ATCC 25996]
          Length = 287

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 169/289 (58%), Gaps = 8/289 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+ GQ+A         + E+I      +D+       +   SF PD I+N AAY
Sbjct: 1   MRTLLTGSKGQLAHCFRDRLPDNWELIATDSSSLDITDADAVRNMVQSFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE     AF++NA     +A AA S+    I+ISTDYVFDG S+TP  E   TNP
Sbjct: 61  TAVDRAETNVPAAFAVNAAAVHNLADAARSVHARFIHISTDYVFDGTSKTPYREHDYTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YG++K AGE    +      I+RT+W++S +G+NF+ +MLRLAKER  +SVV DQ G
Sbjct: 121 QSVYGRTKAAGELLALAANPESTIIRTSWLFSEYGNNFVKTMLRLAKERDSLSVVNDQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT A  +A+AII     L+++   S +GI+H   +   V+W +F++ IF  + +    +
Sbjct: 181 CPTYAGDLAQAII----TLLQHPSPS-KGIYHFGGNKS-VTWYEFSQAIFQTALKHDNNF 234

Query: 241 S--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              K+  I T QYP  A RP YS +DC K+ N + I+ S W++ + +I+
Sbjct: 235 KMPKLTPITTDQYPLPAPRPEYSIMDCRKIENDYGIKPSDWQKALNDII 283


>gi|189092402|gb|ACD75802.1| dTDP-6-deoxy-D-glucose-3,5 epimerase [Escherichia coli]
 gi|288816210|gb|ADC54933.1| RmlD [Escherichia coli]
 gi|315285653|gb|EFU45095.1| dTDP-4-dehydrorhamnose reductase [Escherichia coli MS 110-3]
 gi|323956210|gb|EGB51961.1| RmlD substrate binding domain-containing protein [Escherichia coli
           H263]
          Length = 299

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 110/294 (37%), Positives = 158/294 (53%), Gaps = 11/294 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI----DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L         +I +         D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTNYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EP+ A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPDFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGSGDAPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          ++  + +  G++H+ A  G  +W D+A  +F E A +
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVAS-GTTTWHDYAALVF-EEARK 236

Query: 237 GG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            G     +K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 237 AGINLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|217978849|ref|YP_002362996.1| dTDP-4-dehydrorhamnose reductase [Methylocella silvestris BL2]
 gi|217504225|gb|ACK51634.1| dTDP-4-dehydrorhamnose reductase [Methylocella silvestris BL2]
          Length = 291

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 146/279 (52%), Gaps = 4/279 (1%)

Query: 4   LVIGNNGQIAQSLSSMCV-QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
           L+ G  GQ+ Q L      + V    +   ++D+    D A  F    P +++N AAYT 
Sbjct: 3   LIFGAGGQVGQELQRAAFGKGVACRALSHAEVDIADAADVARAFDETRPTLVVNAAAYTK 62

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VD AE E + A   N  G G + KA  +   P I+ISTDYVFDG    P  E  P  PL 
Sbjct: 63  VDLAETEVDAAQRANEIGPGVVGKACAARETPLIHISTDYVFDGTKTGPYVESDPLAPLG 122

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YG++K AGE         +VILRT+WVY  FG+NFL +MLRLA++R E+ VV DQ G P
Sbjct: 123 VYGRTKAAGEAAARDAAPRHVILRTSWVYGEFGNNFLKTMLRLARDRDELRVVADQHGCP 182

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
           TS   IA AI++IA  L  +SD  L G++H  A  G  +W  FA  I    A   G    
Sbjct: 183 TSTRDIAAAILRIAPRLETSSD--LYGLYHF-AGVGATNWHGFASRIVEAQANITGRRPT 239

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKE 281
           V  I T  YPT A RPA S LDCS    +       W E
Sbjct: 240 VAAITTADYPTPARRPANSVLDCSLFEKSFGFSAHNWGE 278


>gi|325133730|gb|EGC56386.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis M13399]
          Length = 287

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 172/292 (58%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+       +   SF PD I+N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   AF++NA     +A AA       I+ISTDY+FDG  ++P  E   TNP
Sbjct: 61  TAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDYIFDGKGKSPYQESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YG+SK AGE    S   + +ILRT+W++S +G NF+ +ML LA+ER  +S V +Q G
Sbjct: 121 SNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFVRTMLNLARERSPLSAVHNQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  ++ AII+    L++ S+  +RGI+H    G  VSW +FA++IF  ++++    
Sbjct: 181 CPTYAGDLSAAIIR----LLQQSN-PVRGIYHYVG-GKSVSWYEFAQHIFQAASQQQTSF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  +  K+YPT A RPAYS LDC K+ N   I+ S W++ +  ++  +
Sbjct: 235 PIPELTAVSDKEYPTAAPRPAYSILDCRKIENDFGIKPSDWQKALAQVVSKL 286


>gi|295675699|ref|YP_003604223.1| dTDP-4-dehydrorhamnose reductase [Burkholderia sp. CCGE1002]
 gi|295435542|gb|ADG14712.1| dTDP-4-dehydrorhamnose reductase [Burkholderia sp. CCGE1002]
          Length = 308

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 150/291 (51%), Gaps = 8/291 (2%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G NGQ+   L+        +I V R  +DL              P +I+NPAAYTAV
Sbjct: 11  LVTGVNGQVGYELARTLQGLGNVIAVDRSRVDLSNLDQIREVVRDVHPALIVNPAAYTAV 70

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE+E ++A  IN E  G +A+ A  +G   I+ STDYVF+G       E  PT+P N+
Sbjct: 71  DKAEEERDLAMRINGEAPGVLAEEAKKLGAALIHYSTDYVFNGTKEGAYVEDDPTDPQNV 130

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG SKLAGE+ +A+   N+++LRT+WVY   G NFLL+MLRL  +R E+ VV DQ G PT
Sbjct: 131 YGASKLAGEQAIAASGANHLVLRTSWVYGTRGKNFLLTMLRLGADRPELKVVADQIGAPT 190

Query: 184 SALQIARAIIQIAHNLIENSDTS-----LRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
               IA     +        D++       GI+H+ A G   SW  FA  IF  +     
Sbjct: 191 WCNTIATLTAHLCAQSFAADDSAKWWNERSGIYHLCA-GDSTSWHGFASAIFELADLPNK 249

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           P      I    YPT A RPA S +   KLA    +    W++ ++  L +
Sbjct: 250 P--NTLPIPAADYPTPAKRPANSRMSNDKLARVFGLAAPHWRDALKLCLTD 298


>gi|86130452|ref|ZP_01049052.1| dTDP-4-dehydrorhamnose reductase [Dokdonia donghaensis MED134]
 gi|85819127|gb|EAQ40286.1| dTDP-4-dehydrorhamnose reductase [Dokdonia donghaensis MED134]
          Length = 291

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 114/298 (38%), Positives = 170/298 (57%), Gaps = 22/298 (7%)

Query: 1   MKCLVIGNNGQIAQSLSS--MCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           ++ L+ G  GQ+AQ+++      ++V  I + + ++D+              PDVIIN A
Sbjct: 8   IRLLITGGGGQVAQAINEEEATFENVTSIHLSKSELDITSTSSIKKAIDLHQPDVIINTA 67

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD AE++ E AF +N  G   +A+A    GI  I+ISTDYVFDG       E    
Sbjct: 68  AYTAVDAAEEDKEKAFLVNEIGVKNLAQACKDNGIKLIHISTDYVFDGEKPEEYTEEDIP 127

Query: 119 NPLNIYGKSKLAGEEKVA-SYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD 177
           NP  +YGKSKLAGE+ +  S   +Y I+RT+WVYS++GSNF+ +MLRL   + EISVV D
Sbjct: 128 NPTTVYGKSKLAGEQAIINSGLLDYAIIRTSWVYSVYGSNFVKTMLRLGNVKDEISVVND 187

Query: 178 QFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           Q+G+PT A  +A  I+Q+++ L I+N+     G++H T + G  +W  FA+ +F      
Sbjct: 188 QYGSPTLANNLASVILQLSNVLTIQNA-----GVYHYTNE-GVTTWYAFAKAVF------ 235

Query: 237 GGPYSK----VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              Y K    V  + + ++ TKA RP  S L+ SK+     I    W+E +  +LV +
Sbjct: 236 --SYKKMSINVLPVSSDRFVTKATRPKNSKLESSKIITLLGIENVPWEESLEKMLVKL 291


>gi|313683245|ref|YP_004060983.1| dtdp-4-dehydrorhamnose reductase [Sulfuricurvum kujiense DSM 16994]
 gi|313156105|gb|ADR34783.1| dTDP-4-dehydrorhamnose reductase [Sulfuricurvum kujiense DSM 16994]
          Length = 289

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 156/283 (55%), Gaps = 12/283 (4%)

Query: 4   LVIGNNGQIAQSLS--SMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           LV G NGQ+   +   S      E    GR  +DL        +F     D IIN  AYT
Sbjct: 5   LVTGANGQLGSEIKKLSRLYPQYEFTFSGRETLDLGNLCKMEDYFDGKRFDAIINCGAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE EPE+A +IN      +AK A       I+ISTDYVFDG +  P  E  PT+P 
Sbjct: 65  AVDKAESEPELADTINHRFVSMLAKIAKIKKSALIHISTDYVFDGQNYRPYVETDPTDPQ 124

Query: 122 NIYGKSKLAGEEKV-ASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            +YG++K   E  + A+   N +I+RT+WVYS FG+NF+ +MLRL KER  + V+ DQ G
Sbjct: 125 GVYGRTKQKAENAILATAPANTLIIRTSWVYSSFGTNFVKTMLRLGKERDTLGVIYDQVG 184

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPT A  +AR ++++   +   S      I+H + +G  +SW DF++ IF    E  G  
Sbjct: 185 TPTYAEDLARTVLELLPKISNESPE----IYHYSNEGA-ISWYDFSKTIF----ELSGIV 235

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
             V  + + QYPT+A RP YS L+ SK+ N   I I  WK+ +
Sbjct: 236 CDVKALTSDQYPTQAKRPHYSLLNKSKIKNDFGITIPYWKDSL 278


>gi|189460858|ref|ZP_03009643.1| hypothetical protein BACCOP_01505 [Bacteroides coprocola DSM 17136]
 gi|189432432|gb|EDV01417.1| hypothetical protein BACCOP_01505 [Bacteroides coprocola DSM 17136]
          Length = 286

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 162/286 (56%), Gaps = 12/286 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           L+ G NGQ+   +  +   + E         ++D+   +   +F      D+I+N AAYT
Sbjct: 5   LITGANGQLGNEMRLLAEVNKEYTYFFTDVAELDICDEQAVMNFVTDHQIDIIVNCAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAED+ E+   +N    G +AKA  S G   + +STDYVFDG +  P  E   T P 
Sbjct: 65  AVDKAEDDRELCDKLNHFAPGYLAKAIQSRGGYLVQVSTDYVFDGTAHIPYKEEQATCPD 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG +KLAGE++   Y +N +I+RTAW+YS FG+NF+ +M+RL KE+  + V+ DQ GT
Sbjct: 125 SVYGTTKLAGEQEAMKYCSNTMIIRTAWLYSTFGNNFVKTMIRLGKEKEALGVIFDQIGT 184

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A  +A AI    +  I      + GI+H + + G  SW DF + I   +   G    
Sbjct: 185 PTYARDLAVAIFAAINKGI------VPGIYHYSNE-GVCSWYDFTQMIHHLA---GIGTC 234

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           K+  + T++YPTKA+RP YS LD +K+  T+ I I  W + ++  +
Sbjct: 235 KLRPLHTEEYPTKANRPHYSVLDKTKIKETYGIEIPYWVDSLKECI 280


>gi|78188493|ref|YP_378831.1| dTDP-4-dehydrorhamnose reductase [Chlorobium chlorochromatii CaD3]
 gi|78170692|gb|ABB27788.1| dTDP-4-dehydrorhamnose reductase [Chlorobium chlorochromatii CaD3]
          Length = 291

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 159/289 (55%), Gaps = 9/289 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M  LV G+ GQ+   L ++ V+           P++D+   +       +   +VIIN A
Sbjct: 1   MNILVTGSRGQLGSELQALSVRYPQHSFFFYDLPELDITNSEQINHICNAHHIEVIINAA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAE + E AF +N++GA  +A  A       ++ISTDYVFDG S  P  E  P 
Sbjct: 61  AYTAVDKAESDAETAFRVNSDGAALLATYAKENHALLLHISTDYVFDGTSSVPYKESDPA 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            PL +YG+SK  GEE++ +   +++I+RT+W+YS++G+NF+ +MLRL  ER E+ VV DQ
Sbjct: 121 TPLGVYGRSKWEGEERIRAINPSHLIIRTSWLYSMYGANFIKTMLRLGGERSEVRVVFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +A A++ +  ++ +    S    +H + + G  SW D A  +     E   
Sbjct: 181 VGTPTWAADLAEALLSMLSSIYKGKHYS--ATYHYSNE-GVASWYDVASAVM----EMSN 233

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              KV  I +  YP  A RP YS  + + L +  NI IS W+  +  +L
Sbjct: 234 LSCKVLPIESHDYPVPAPRPHYSVFNKAALKSDWNISISHWRTSLAAML 282


>gi|50882469|gb|AAT85648.1| RmlD [Escherichia coli]
          Length = 299

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 160/294 (54%), Gaps = 11/294 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  VAAHTAVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGNGDMPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YGK+KLAGE  +  +   ++I RT+WVY+  G+NF  +MLR AKER E++V+ 
Sbjct: 121 VTAPLNVYGKTKLAGERALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRQAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A          ++  + +  G++H+ A+ G  +W D+A  +F E A +
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALKKPEVA--GLYHLVAN-GTTTWHDYAALVF-EEARK 236

Query: 237 GG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            G     +K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 237 AGIDLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|207744131|ref|YP_002260523.1| dtdp-4-dehydrorhamnose reductase protein [Ralstonia solanacearum
           IPO1609]
 gi|206595535|emb|CAQ62462.1| dtdp-4-dehydrorhamnose reductase protein [Ralstonia solanacearum
           IPO1609]
          Length = 305

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 108/295 (36%), Positives = 154/295 (52%), Gaps = 7/295 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + LV G+NGQ+   L        E+I + R   DL +P           PDVI+NPAAYT
Sbjct: 10  RLLVTGSNGQVGFELRRSLAPLGEVIALDRAACDLTQPDALRRLVREHRPDVIVNPAAYT 69

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE + + AF++N   AG +A+ A ++G   ++ STDYVFDG       E    NP 
Sbjct: 70  AVDKAETDADTAFAVNGTAAGVLAEEARALGSLLVHYSTDYVFDGTKAGAYLETDAVNPQ 129

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YGKSKLAGE+ +A+     ++LRT WV    G NF  +ML+L +ER  + V+ DQFG 
Sbjct: 130 SVYGKSKLAGEQAIAASGAAALVLRTCWVAGAHGGNFAKTMLKLGRERDSLRVIADQFGA 189

Query: 182 PTSALQIARAIIQIAHNLIENSDTSL--RGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PT+A  IA    QI      + D +    G++H+ A  G  +W  +A  +   +   G  
Sbjct: 190 PTTAALIADVTAQIVARFWLSGDRAAFPGGLYHLAAS-GETTWHGYATAVLRYAKACGLE 248

Query: 240 YS----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                 ++  I    YP  A RPA S +   KL  T  I +  W++GV  +L  I
Sbjct: 249 LKVDPERIEAIPATAYPLPAPRPANSRMQTGKLTETFGIHLPDWQQGVHLLLDQI 303


>gi|255020602|ref|ZP_05292665.1| dTDP-4-dehydrorhamnose reductase [Acidithiobacillus caldus ATCC
           51756]
 gi|254969987|gb|EET27486.1| dTDP-4-dehydrorhamnose reductase [Acidithiobacillus caldus ATCC
           51756]
          Length = 302

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 111/269 (41%), Positives = 155/269 (57%), Gaps = 10/269 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + LV G  GQ+ ++L+     +V+ + + R  +D+      A    +  P VIIN AAYT
Sbjct: 13  RVLVTGAGGQVGRALAQTVPAEVDAVFLHRQALDVADAGSVAKALAAHRPQVIINAAAYT 72

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE E + A++INA+G   +A+AA  +G   ++ISTD+VF G    P     PT P+
Sbjct: 73  AVDRAESEADQAYAINAQGPAHLARAARELGAELLHISTDFVFSGSQGQPYRPEDPTAPI 132

Query: 122 NIYGKSKLAGEEKVAS-YTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           N YG SK+AGEE +A+      +ILRT+WVY+ +G NFL +MLRL + R  + VVCDQ G
Sbjct: 133 NAYGASKVAGEEAIAAILGEQALILRTSWVYAPWGQNFLQTMLRLMENRPLLRVVCDQVG 192

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PTSA  +A A+ +     +   D   RGI H T D G  SW DFA  I  E+   G   
Sbjct: 193 SPTSAHSLAGALWRA----LARPD--FRGIQHWT-DAGVASWYDFAVAIQEEALALGLLS 245

Query: 241 SK--VYRIFTKQYPTKAHRPAYSCLDCSK 267
            +  +  I +  YPT A RPA S LD S+
Sbjct: 246 RRIPIEAIPSSAYPTPARRPANSQLDKSR 274


>gi|150002683|ref|YP_001297427.1| putative dTDP-4-dehydrorhamnose reductase [Bacteroides vulgatus
           ATCC 8482]
 gi|254882184|ref|ZP_05254894.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|319643256|ref|ZP_07997884.1| dTDP-4-dehydrorhamnose reductase [Bacteroides sp. 3_1_40A]
 gi|149931107|gb|ABR37805.1| putative dTDP-4-dehydrorhamnose reductase [Bacteroides vulgatus
           ATCC 8482]
 gi|254834977|gb|EET15286.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|317385160|gb|EFV66111.1| dTDP-4-dehydrorhamnose reductase [Bacteroides sp. 3_1_40A]
          Length = 285

 Score =  188 bits (478), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 156/283 (55%), Gaps = 12/283 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVE--IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           LV G NGQ+   +  +  +  E         ++D+   +   +F    +  VI+N AAYT
Sbjct: 5   LVTGANGQLGNEMRVLSAEYKEYTCFFTDVAELDICDEQAVMTFVKENNIHVIVNCAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAED+ E+   +N      +AKAA++     I ISTDYVFDG    P +E     P 
Sbjct: 65  AVDKAEDDIELCTKLNKNAVSYLAKAAEANWGEFIQISTDYVFDGTKHLPYNEGDVPCPN 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YGK+KLAGE     Y    +I+RTAW+YS FG+NF+ +MLRL KE+  + VV DQ GT
Sbjct: 125 SVYGKTKLAGETNALEYCKKTMIIRTAWLYSTFGNNFVKTMLRLGKEKETLGVVFDQIGT 184

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A  +ARAI    +  +      + G++H  +D G  SW DF + I   +   G    
Sbjct: 185 PTYARDLARAIFTAIYKGV------VPGVYHF-SDEGVCSWYDFTKAIHRIA---GITTC 234

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           KV  + T +YP KA RP YS LD +K+  T+NI I  W+E + 
Sbjct: 235 KVSPLHTNEYPAKAPRPHYSVLDKTKIKTTYNIEIPHWEESLE 277


>gi|161869700|ref|YP_001598867.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis 053442]
 gi|161595253|gb|ABX72913.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis 053442]
          Length = 291

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 172/292 (58%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+       +   SF PD I+N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   AF++NA     +A AA       I+ISTDY+FDG  + P  E   TNP
Sbjct: 61  TAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDYIFDGKGKRPYQESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YG+SK AGE    S   + +ILRT+W++S +G NF+ +ML LA+ER  +S V +Q G
Sbjct: 121 SNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFVRTMLNLARERSPLSAVHNQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  ++ AII+    L++ S+  +RGI+H    G  VSW +FA++IF  ++++    
Sbjct: 181 CPTYAGDLSAAIIR----LLQQSN-PVRGIYHYVG-GKSVSWYEFAQHIFQAASQQQTSF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  +  K+YPT A RPAYS LDC K+ N  +I+ S W++ +  ++  +
Sbjct: 235 PVPELTAVSDKEYPTAAPRPAYSILDCRKIENDFSIKPSDWQKALAQVVSKL 286


>gi|16357462|gb|AAL18014.1| dTDP-dehydrorhamnose reductase [Aneurinibacillus thermoaerophilus]
          Length = 282

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 161/292 (55%), Gaps = 15/292 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDV--EIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           MK LV G  GQ    ++ M +Q     +   GR ++D+   K          PDV+I+ A
Sbjct: 1   MKVLVTGGKGQFGYDVTQM-LQGAGHRVFSYGREELDITDQKQVQYTMEEVQPDVVIHAA 59

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYT VD AE E   A+ +NA G   +A AA++     +YISTDYVFDG +  P  EF+PT
Sbjct: 60  AYTKVDLAETEVNTAYKVNALGTRNVAVAAEACRAKLVYISTDYVFDGQAAGPYHEFAPT 119

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           NP +IYGKSKLAGE  V    + + I+RT+WVY  +G NF+ +MLRLA ER E++VV DQ
Sbjct: 120 NPQSIYGKSKLAGESFVQQLCSRFFIVRTSWVYGKYGHNFVKTMLRLAGERDELNVVHDQ 179

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            G PT  + +A  ++    NLIE   T   GI+H  ++ G  SW +FA  IF E+  +  
Sbjct: 180 VGCPTYTVDLAAFVL----NLIE---TEAYGIYH-ASNTGSCSWYEFACAIFEEAEIK-- 229

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              KV  I T +YP  A RPA S  +   +       +  W+  ++  + +I
Sbjct: 230 --IKVNPIPTSEYPLPAPRPANSVFEHMMIRLQEMKPLRPWRIALQEFIQDI 279


>gi|218767877|ref|YP_002342389.1| putative dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis
           Z2491]
 gi|121051885|emb|CAM08191.1| putative dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis
           Z2491]
 gi|254669729|emb|CBA03900.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis alpha153]
 gi|319410124|emb|CBY90460.1| dTDP-4-dehydrorhamnose reductase (dTDP-4-keto-L-rhamnose reductase;
           dTDP-6-deoxy-L-mannose dehydrogenase; dTDP-L-rhamnose
           synthetase) [Neisseria meningitidis WUE 2594]
          Length = 287

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 172/292 (58%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+       +   SF PD I+N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   AF++NA     +A AA       I+ISTDY+FDG  + P  E   TNP
Sbjct: 61  TAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDYIFDGKGKRPYQESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YG+SK AGE    S   + +ILRT+W++S +G NF+ +ML LA+ER  +S V +Q G
Sbjct: 121 SNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFVRTMLNLARERSPLSAVHNQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  ++ AII+    L++ S+  +RGI+H    G  VSW +FA++IF  ++++    
Sbjct: 181 CPTYAGDLSAAIIR----LLQQSN-PVRGIYHYVG-GKSVSWYEFAQHIFQAASQQQTSF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  +  K+YPT A RPAYS LDC K+ N  +I+ S W++ +  ++  +
Sbjct: 235 PVPELTAVSDKEYPTAAPRPAYSILDCRKIENDFSIKPSDWQKALAQVVSKL 286


>gi|294776938|ref|ZP_06742399.1| dTDP-4-dehydrorhamnose reductase [Bacteroides vulgatus PC510]
 gi|294449186|gb|EFG17725.1| dTDP-4-dehydrorhamnose reductase [Bacteroides vulgatus PC510]
          Length = 285

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 156/283 (55%), Gaps = 12/283 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVE--IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           LV G NGQ+   +  +  +  E         ++D+   +   +F    +  VI+N AAYT
Sbjct: 5   LVTGANGQLGNEMRVLSAEYKEYTCFFTDVAELDICDEQAVMTFVKENNIHVIVNCAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAED+ E+   +N      +AKAA++     I ISTDYVFDG    P +E     P 
Sbjct: 65  AVDKAEDDIELCTKLNKNAVSYLAKAAEANWGEFIQISTDYVFDGTKHLPYNEGDIPCPN 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YGK+KLAGE     Y    +I+RTAW+YS FG+NF+ +MLRL KE+  + VV DQ GT
Sbjct: 125 SVYGKTKLAGETNALEYCKKTMIIRTAWLYSTFGNNFVKTMLRLGKEKETLGVVFDQIGT 184

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A  +ARAI    +  +      + G++H  +D G  SW DF + I   +   G    
Sbjct: 185 PTYARDLARAIFTAIYKGV------VPGVYHF-SDEGVCSWYDFTKAIHRIA---GITTC 234

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           KV  + T +YP KA RP YS LD +K+  T+NI I  W+E + 
Sbjct: 235 KVSPLHTNEYPAKAPRPHYSVLDKTKIKTTYNIEIPHWEESLE 277


>gi|319761362|ref|YP_004125299.1| dtdp-4-dehydrorhamnose reductase [Alicycliphilus denitrificans BC]
 gi|330823237|ref|YP_004386540.1| dTDP-4-dehydrorhamnose reductase [Alicycliphilus denitrificans
           K601]
 gi|317115923|gb|ADU98411.1| dTDP-4-dehydrorhamnose reductase [Alicycliphilus denitrificans BC]
 gi|329308609|gb|AEB83024.1| dTDP-4-dehydrorhamnose reductase [Alicycliphilus denitrificans
           K601]
          Length = 292

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 106/295 (35%), Positives = 157/295 (53%), Gaps = 9/295 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M  L++G NGQ+   L        E+  +G  + D  +P+  A    +  PDVI+N AA+
Sbjct: 1   MNILLLGKNGQVGWELQRSLAVLGEVTALGHDEADFTQPQAVAQAVRALCPDVIVNAAAH 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE EPE A  +NA   G +A+ A  +G   ++ STDYVFDG    P  E     P
Sbjct: 61  TAVDKAESEPERARLLNATTPGVLAEEAVRLGAWLVHYSTDYVFDGSGSRPWRETDAPAP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L++YG +KL GE  +      ++ILRT+WVY+  G NF  +MLRLA+ER  ++V+ DQ+G
Sbjct: 121 LSVYGATKLEGERLIQQSGCRHLILRTSWVYAARGGNFAKTMLRLAQERERLTVIDDQWG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP- 239
            PT A  +A        +L +       G++H  A GG  +W  +A+Y+  E A +    
Sbjct: 181 APTGADLLADVTAHAIRHLQQRPQDG--GLYHCVA-GGETTWHSYAKYVV-EHARQAQSA 236

Query: 240 ----YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                 ++  + T  + T A RP  S LD +KL     +R+  W++GV  +L  I
Sbjct: 237 INIIAKEIAPVPTSAFLTPARRPHNSRLDNAKLQAAFGLRLPPWQQGVARMLTEI 291


>gi|322433402|ref|YP_004210619.1| dTDP-4-dehydrorhamnose reductase [Acidobacterium sp. MP5ACTX9]
 gi|321165791|gb|ADW71492.1| dTDP-4-dehydrorhamnose reductase [Acidobacterium sp. MP5ACTX9]
          Length = 304

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 163/300 (54%), Gaps = 14/300 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPD---IDLLKPKDFASFFLSFSPDVIINPAAY 60
           L+ G+ GQ+   L  +       + V  PD   +DL  P        +  P  IINPAAY
Sbjct: 5   LITGSTGQVGGELVRLFRSQNPSLEVHAPDRSQLDLRDPASIRDVVRTLLPQWIINPAAY 64

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE + E AF++NAE    + + A  IG P ++ STDYVF G +  P +E     P
Sbjct: 65  TAVDRAESDQEDAFAVNAEAPRILGEEAAVIGAPVLHFSTDYVFAGDAERPYEETDLAKP 124

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG SKLAGE  +A+    ++I RT+WVY   G NFL ++LR+A+++ ++ +V DQ G
Sbjct: 125 LGVYGLSKLAGERNLAASGAAHLIFRTSWVYGATGKNFLRTILRVARQQPQMRIVADQHG 184

Query: 181 TPTSALQIARAIIQIAHNLIENSDT--------SLRGIFHMTADGGPVSWADFAEYI--F 230
            PT+A  +A+    I   L E +          S++GI++ T + G  +W  FAE     
Sbjct: 185 APTAARDLAQMTATIVAQLEETAGAGDLAEAIRSIQGIYNAT-NSGDTTWFGFAEEALRL 243

Query: 231 WESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             +AE    ++++  I T +YPT A RPA S L C KL+ T  I++  W+  +  +L  I
Sbjct: 244 RRAAEPCISFAELIPIPTAEYPTPARRPASSRLSCVKLSRTFVIQMRPWQTALGEVLKEI 303


>gi|110833772|ref|YP_692631.1| dTDP-4-dehydrorhamnose reductase [Alcanivorax borkumensis SK2]
 gi|110646883|emb|CAL16359.1| dTDP-4-dehydrorhamnose reductase [Alcanivorax borkumensis SK2]
          Length = 304

 Score =  188 bits (477), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 157/294 (53%), Gaps = 10/294 (3%)

Query: 4   LVIGNNGQIAQSLSSMCV---QDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIINPA 58
           L++G NGQ+   L        Q + + R G+     D+              PDV++N A
Sbjct: 11  LLLGKNGQVGWELQRALAPFGQLIALDRAGQNGWCGDIGNLDGLRETIEHIKPDVLVNAA 70

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
            YTAVD+A+ EPE+A  +N +    +A+   + G   ++ STDYVFDG    P  E    
Sbjct: 71  GYTAVDQAQSEPELAERLNHQAPALMAELMKAHGGWLVHYSTDYVFDGSGNQPWKETDSA 130

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            PLN+YG +KLAGE+ + +    ++I RT+WVY+  G+NF  +MLRLAKER  ++V+ DQ
Sbjct: 131 GPLNVYGATKLAGEQAIQASGCQHLIFRTSWVYASRGNNFAKTMLRLAKERDTLNVIDDQ 190

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            G PT A  IA           +  D S  G++H+ A  G  SW D+A Y+F  +   G 
Sbjct: 191 IGAPTGAELIADVTAHALRQWQQQPDVS--GLYHLAAS-GETSWYDYACYVFGWAQNEGL 247

Query: 239 PYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P +   V  I ++ YP  A RP  S LD  KL  T N+++  WK+GV +++  +
Sbjct: 248 PLAIQSVNPILSEDYPVPAIRPKNSRLDGQKLETTFNLQLPEWKQGVEHMMSEV 301


>gi|225075232|ref|ZP_03718431.1| hypothetical protein NEIFLAOT_00232 [Neisseria flavescens
           NRL30031/H210]
 gi|224953407|gb|EEG34616.1| hypothetical protein NEIFLAOT_00232 [Neisseria flavescens
           NRL30031/H210]
          Length = 287

 Score =  188 bits (477), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 165/289 (57%), Gaps = 8/289 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G  GQ+A+ L     +D E+I      +D+   +       +F PD I+N AAY
Sbjct: 1   MRTLLTGAKGQLARCLRDRLPEDWELIATDSTSLDITDTEAVHHMIKNFQPDAIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE+  E AF++NA     +A AA +     I+ISTDYVFDG  + P  E   TNP
Sbjct: 61  TAVDKAEENAEAAFAVNATAVHNLAAAARAAHARFIHISTDYVFDGEGKRPYRETDYTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            + YG+SK+AGE    +      I+RT+W++S +GSNF+ +MLRLAKER  +S+V DQ G
Sbjct: 121 RSTYGQSKVAGELLALAAHPESTIVRTSWLFSEYGSNFVKTMLRLAKERDSLSIVHDQTG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT A  +A AII +         TS RGIFH   +    +W +F + IF  + +    +
Sbjct: 181 CPTYAGDLAHAIISLLQQ-----PTSPRGIFHYCGNKS-ATWYEFTKAIFQTAHQLDDSF 234

Query: 241 S--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              ++  I T +YP  A RPAYS +DCS+L     I+ S W++ +R IL
Sbjct: 235 RIPELNAITTDKYPLPAPRPAYSIMDCSRLETEFGIKPSDWQKALREIL 283


>gi|78184212|ref|YP_376647.1| dTDP-4-dehydrorhamnose reductase [Synechococcus sp. CC9902]
 gi|78168506|gb|ABB25603.1| dTDP-4-dehydrorhamnose reductase [Synechococcus sp. CC9902]
          Length = 295

 Score =  188 bits (477), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 155/296 (52%), Gaps = 10/296 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G  GQ+ Q+L       VE+I   R ++DL   +        + PD ++N  AY
Sbjct: 1   MKILLTGTGGQLGQALLDSKPDAVELISTTRQELDLSNAEACRLAVQKYQPDWVLNAGAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE EPE+A +INA    A A+  D  G   + +STD+VFDG   +P     PT P
Sbjct: 61  TAVDQAESEPELAHAINAGAPEAFAQELDRQGGRLLQVSTDFVFDGQQGSPYRVDQPTTP 120

Query: 121 LNIYGKSKLAGEEKV----ASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           + +YG SK AGE+ +     +     VILRT+WV    G NF  +MLRL +ER ++SVV 
Sbjct: 121 IGVYGTSKAAGEQAIHRIFGANNPQGVILRTSWVMGPVGRNFARTMLRLHRERDQLSVVA 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G P+S L +A A       + + S T+L  I H + D G  SW D A  I       
Sbjct: 181 DQVGCPSSTLNLATACWT---TITQGSQTNLPPIMHWS-DAGAASWYDVAVAIGELGHSL 236

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +KV  I T  YPT A RP YS LDC+       +    W+E ++ +L+ +
Sbjct: 237 GLVDTPAKVNPITTADYPTPASRPNYSLLDCTTTRAALQLDGQHWQEALKQLLLRV 292


>gi|261380167|ref|ZP_05984740.1| dTDP-4-dehydrorhamnose reductase [Neisseria subflava NJ9703]
 gi|284797009|gb|EFC52356.1| dTDP-4-dehydrorhamnose reductase [Neisseria subflava NJ9703]
          Length = 287

 Score =  188 bits (477), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 116/292 (39%), Positives = 166/292 (56%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G  GQ+A+ L     +D E+I      +D+   +       +F PD I+N AAY
Sbjct: 1   MRTLLTGAKGQLARCLRDRLPEDWELIATDSTSLDITDTEAVHHMIKNFQPDAIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE+  E AF++NA     +A AA +     I+ISTDYVFDG  + P  E   TNP
Sbjct: 61  TAVDKAEENAEAAFAVNATAVHNLAAAARAAHARFIHISTDYVFDGEGKRPYRETDYTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            + YG+SK+AGE    +      I+RT+W++S +G+NF+ +ML LAKER  +S+V DQ G
Sbjct: 121 RSTYGQSKVAGELLALAAHPESTIVRTSWLFSEYGNNFVKTMLHLAKERDSLSIVHDQTG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT A  +A AII +         TS RGIFH   +    +W +F + IF  + +    +
Sbjct: 181 CPTYAGDLAHAIISLLQQ-----PTSPRGIFHYCGNKS-ATWYEFTKAIFQTAHQLDDSF 234

Query: 241 S--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              ++  I T+QYP  A RPAYS +DCS+L     I+ S W++ +R IL  I
Sbjct: 235 RIPELNAITTEQYPLPAPRPAYSIMDCSRLETEFGIKPSDWQKALREILRKI 286


>gi|34499466|ref|NP_903681.1| dTDP-4-dehydrorhamnose reductase [Chromobacterium violaceum ATCC
           12472]
 gi|34105318|gb|AAQ61673.1| dTDP-4-dehydrorhamnose reductase [Chromobacterium violaceum ATCC
           12472]
          Length = 310

 Score =  188 bits (477), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 149/294 (50%), Gaps = 6/294 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLL-KPKDFASFFLSFSPDVIINPAAY 60
           + L+ G NGQ+   L        E+I   R ++DL               PD+I+NPAAY
Sbjct: 6   RILITGKNGQVGHELLRALAPLGELIATDRRELDLTWDDARIEQALDQHGPDIIVNPAAY 65

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   A ++NA   G IA+     G   ++ STDYVF G    P  E   T P
Sbjct: 66  TAVDKAESDEATAHAVNACAVGVIARWTARHGALLVHYSTDYVFSGDGERPWREDDATGP 125

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YG+SKLAGEE +      ++ILRT+WV+   G+NFL +ML+L +ER  + VV DQ G
Sbjct: 126 QSVYGRSKLAGEEAIRHAAPRHLILRTSWVFGAHGANFLKTMLKLGQERDSLKVVNDQIG 185

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            P SA  IA    ++    +        G +H+ A  G  SW  +A Y+   +A  G P 
Sbjct: 186 APASAAMIADVSAELIRRYLAAPSGFAFGTYHL-APRGETSWHGYASYLLQRAASYGLPL 244

Query: 241 ----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
               + +  I +  YP  A RPA S L C KL +   I +  W+ GV  +L  +
Sbjct: 245 KIDPANIQGIPSSDYPLPAKRPANSRLSCDKLKSAFGIELPEWRSGVDQVLAQL 298


>gi|332293420|ref|YP_004432029.1| dTDP-4-dehydrorhamnose reductase [Krokinobacter diaphorus 4H-3-7-5]
 gi|332171506|gb|AEE20761.1| dTDP-4-dehydrorhamnose reductase [Krokinobacter diaphorus 4H-3-7-5]
          Length = 297

 Score =  188 bits (477), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 156/289 (53%), Gaps = 12/289 (4%)

Query: 2   KCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           K +V G  GQ+  +L   S    D E I + R D+D+    + +       PDV+IN AA
Sbjct: 14  KIVVTGALGQLGMALLEQSKHHADFEYIFLSRKDLDITSRDNISIVLDKHQPDVVINTAA 73

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVD AED+ + AF IN    G +A+         I+ISTDYVFDG   T   E    N
Sbjct: 74  YTAVDAAEDDKDQAFLINEAAVGYLAEECKKRKCALIHISTDYVFDGDKSTAYVESDKPN 133

Query: 120 PLNIYGKSKLAGEEKV-ASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           P  +YG SKL GE+ + AS    Y I+RT+WVYS++G NF+ +MLRL +ER ++SVV DQ
Sbjct: 134 PQTVYGASKLGGEQLIEASNITKYAIIRTSWVYSVYGHNFVKTMLRLGEERGQLSVVNDQ 193

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            G PT A  +A  I+ +A  L E+S     G++H  ++ G ++W DFA+ IF    E   
Sbjct: 194 LGCPTWANDLADTILTVARELKEDS----FGVYHF-SNKGSITWYDFAKAIF----EHAQ 244

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               +  + +  +PTK  RP  S LD  K+     +    W   ++ +L
Sbjct: 245 IDVLITPVTSDLFPTKTKRPKNSVLDTHKIEKQFKVDTPEWSSSLQKML 293


>gi|325142007|gb|EGC64440.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis 961-5945]
          Length = 278

 Score =  188 bits (477), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 114/284 (40%), Positives = 165/284 (58%), Gaps = 8/284 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+       +   SF PD I+N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE     AF++NA     +A AA       I+ISTDY+FDG  + P  E   TNP
Sbjct: 61  TAVDKAEGNAAAAFAVNASAVYNLALAAHRAHARFIHISTDYIFDGKGKRPYQESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YG+SK AGE    S   + +ILRT+W++S +G NF+ +ML LA+ER  +S V +Q G
Sbjct: 121 SNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFVRTMLNLARERSPLSAVHNQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  +A AII++         + +RGI+H  A G  VSW +FA++IF  ++++    
Sbjct: 181 CPTYAGDLAAAIIRLLQQT-----SPVRGIYHY-AGGKSVSWYEFAQHIFQAASQQQTSF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEG 282
           P  ++  +  K+YPT A RPAYS LDC K+ N  +I+ S W++ 
Sbjct: 235 PVPELTAVSDKEYPTAAPRPAYSILDCRKIENDFSIKPSDWQKA 278


>gi|224184716|gb|ACN39589.1| putative dTDP-4-dehydrorhamnose reductase [Capnocytophaga
           canimorsus]
          Length = 284

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 157/282 (55%), Gaps = 10/282 (3%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G NGQ+   + ++  +       G  D+D+   +  + F    +  +++N A YT V
Sbjct: 10  LVTGANGQLGSEIQNIQGKTKNYFFTGASDLDITDRQAISDFVKKNNIQIVVNCAGYTNV 69

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAED+ + A  IN    G +A+         I+ISTDYVF G   TP  E  PT PL I
Sbjct: 70  DKAEDDIQTANLINNIAVGYLAEVCKENNASLIHISTDYVFGGTKNTPYSEADPTEPLGI 129

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSI-FGSNFLLSMLRLAKERREISVVCDQFGTP 182
           YG++KL GE+ + +   +Y+I+RT+W+YS+ FG+NF+ ++ RL+ ER E+ VV DQ GTP
Sbjct: 130 YGRTKLEGEKAIQNADIDYLIIRTSWLYSLSFGNNFVKTIQRLSSERNELKVVFDQVGTP 189

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
           T+A  +A  I+ I    IE      R ++H + + G  SW DFA  I   S    G    
Sbjct: 190 TNARDLAAFIVHI----IEKDLYKRREVYHFSNE-GVCSWFDFAAEIVRMS----GNDCL 240

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           V    + ++P+K  RP+YS LD SKL N  N  IS WKE ++
Sbjct: 241 VKPCLSSEFPSKVKRPSYSVLDKSKLKNDFNYTISHWKEALK 282


>gi|254253074|ref|ZP_04946392.1| dTDP-4-dehydrorhamnose reductase [Burkholderia dolosa AUO158]
 gi|124895683|gb|EAY69563.1| dTDP-4-dehydrorhamnose reductase [Burkholderia dolosa AUO158]
          Length = 297

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 115/288 (39%), Positives = 149/288 (51%), Gaps = 9/288 (3%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G  GQ+   L         ++   R  +DL       +F     P +I+NPAAYTAV
Sbjct: 13  LVTGVTGQVGFELLRALQGLGRVVPCDRSMLDLSDLDRVRAFVRDLKPSLIVNPAAYTAV 72

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE E E+A  +N +     A+ A   G   I+ STDYVFDG    P  E   TNPLN 
Sbjct: 73  DKAESEIELARRLNVDVPRVFAEEAARSGSTLIHYSTDYVFDGTKAEPYVETDATNPLNA 132

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG +KL GE  +A+    ++ILRT+WVY   G NFLL+ML+L  ER E+ VV DQ G PT
Sbjct: 133 YGATKLDGEHAIAATGCAHLILRTSWVYGRRGRNFLLTMLKLGAERPELRVVADQIGAPT 192

Query: 184 SALQIARAIIQIAHNLIENSDTSL----RGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
            A  IA A   I      ++DT       G++H+TA  G  SW  FAE IF  +  R   
Sbjct: 193 WARTIAAATSHIVAQRAASADTDWWARRSGVYHLTA-AGATSWCGFAEAIFAMAPHR--- 248

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              V  I +  YPT A RPA S L   KL  T  +++  W+  ++  L
Sbjct: 249 -PSVVPISSDDYPTPAKRPANSRLALEKLTETFGLQMPDWRSALQLCL 295


>gi|313203691|ref|YP_004042348.1| dtdp-4-dehydrorhamnose reductase [Paludibacter propionicigenes WB4]
 gi|312443007|gb|ADQ79363.1| dTDP-4-dehydrorhamnose reductase [Paludibacter propionicigenes WB4]
          Length = 286

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 105/286 (36%), Positives = 160/286 (55%), Gaps = 12/286 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           L+ G++GQ+   +     +      I     ++D+       +F  + + +VI+N AAYT
Sbjct: 5   LITGSHGQLGNEMQQAAARFPAFRFIYTDVEELDICDKAALDAFVKANAVNVIVNCAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAED+ E+ + INAE    I + A   G+  +++STDYVFDG +  P  E    +P 
Sbjct: 65  AVDKAEDDVELCYKINAEAVRNIGEVAHQNGLKVVHVSTDYVFDGTNYMPYSEDQAVSPN 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
            +YGKSKLAGE+ +       VILRTAW+YS FG+NF+ +M++L  ER  ++V+ DQ G+
Sbjct: 125 TVYGKSKLAGEQALMETCEQAVILRTAWLYSSFGNNFVKTMIKLGTERDSLNVIFDQIGS 184

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A  +A AI+++  + +      + GI+H + D G  SW DF + I        G   
Sbjct: 185 PTYAADLADAILKLLSHPV-----FVPGIYHFS-DEGVCSWYDFTKTIH----RIAGITC 234

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            V+ I TK YP +  RP YS L+ SK+  T+ I I  W+E +   +
Sbjct: 235 DVHPIETKDYPARTPRPHYSVLNKSKIKTTYGIVIPHWEESLERCM 280


>gi|317968491|ref|ZP_07969881.1| dTDP-4-dehydrorhamnose reductase [Synechococcus sp. CB0205]
          Length = 294

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 114/296 (38%), Positives = 160/296 (54%), Gaps = 17/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G  GQ+ Q+L + C + +E+I  GR ++DL           +  PD +IN  AY
Sbjct: 1   MKVLLTGAAGQLGQALMAACPEGIELIACGRQELDLADQAACRRIAQAHQPDWVINAGAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE EPE+A ++NA    A+A+A    G   + +STD+VF+G   +P        P
Sbjct: 61  TAVDRAESEPELAQAVNALAPAALAQAQADHGGRLLQLSTDFVFNGQQGSPYRPEQAAEP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L +YG +K AGE  V  Y+   V LRT+WVY   GSNF  +MLRL  ER ++ VV DQ G
Sbjct: 121 LGVYGSTKAAGEAAVLEYSCARV-LRTSWVYGPVGSNFCRTMLRLLAEREQLGVVADQVG 179

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PTS L +A+A  ++    +   D  L+ I H + D G  SW DFA  I    AE G  +
Sbjct: 180 CPTSTLGLAQACWRV----LALEDGVLQ-ILHWS-DAGAASWYDFAVAI----AELGVTH 229

Query: 241 SKVYRIF------TKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             + R+       T  YPT A RPAYS LDC       +++   W+  +  +L+ I
Sbjct: 230 GLLTRVAQVKPIPTADYPTPAQRPAYSLLDCKATREALSLQPQHWRAALEQVLLRI 285


>gi|255321116|ref|ZP_05362282.1| dTDP-4-dehydrorhamnose reductase [Acinetobacter radioresistens
           SK82]
 gi|255301670|gb|EET80921.1| dTDP-4-dehydrorhamnose reductase [Acinetobacter radioresistens
           SK82]
          Length = 297

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 110/301 (36%), Positives = 162/301 (53%), Gaps = 18/301 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI-----DLLKPKDFASFFLSFSPDVII 55
           MK L++G NGQ+   L        E++ + R  +     D+ +P       ++  PDV++
Sbjct: 1   MKILLLGKNGQVGWELQRALAPLGEVVALDRHGLNGLSGDMTQPSAIFDTIVALKPDVVV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N +AYTAVD AE E + A  +N +   AIA A   I    ++ STDYVFDG   T   E 
Sbjct: 61  NASAYTAVDLAETEQDSADLVNHQTVKAIADACLQIKALFVHYSTDYVFDGAGETAFVET 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
               PLN+YGK+K  GE+ +      ++I RT+WVY+  G NFL +ML LA++R E+S++
Sbjct: 121 DAIAPLNVYGKTKALGEQAIVESGCQHLIFRTSWVYASKGKNFLKTMLNLAQQREELSII 180

Query: 176 CDQFGTPTSALQI----ARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFW 231
            DQ G PTSA  I    A AI Q+       +D S  G++H+ A  G  SW  +A Y+F 
Sbjct: 181 DDQIGAPTSAELIADITAHAIPQVV------ADVSKAGVYHLVA-SGETSWFGYASYVFE 233

Query: 232 ESAERGGPY--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           ++   G      KV  I TK YPT A RP  S L+  K+ +   + +  W++GV+  +V 
Sbjct: 234 QARSLGQALIVQKVNPIPTKAYPTPATRPHNSRLNNQKIQHVFKLCLPNWQDGVKRTIVE 293

Query: 290 I 290
           +
Sbjct: 294 L 294


>gi|261349841|ref|ZP_05975258.1| dTDP-4-dehydrorhamnose reductase [Methanobrevibacter smithii DSM
           2374]
 gi|288860625|gb|EFC92923.1| dTDP-4-dehydrorhamnose reductase [Methanobrevibacter smithii DSM
           2374]
          Length = 280

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 108/287 (37%), Positives = 160/287 (55%), Gaps = 12/287 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G+NG +   L+ +     E+I      +D+   +    F     PD++IN AAY
Sbjct: 1   MKVLITGSNGMLGHDLTDVLNDKHELILTTSKTLDITDKEHTVEFIKENKPDIVINSAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD  E+  E+AFS+N EG   +A        P ++ISTDY+F+G + TP  E     P
Sbjct: 61  TNVDGCEENQELAFSVNGEGVRNLAIGCREADCPLVHISTDYIFNGKNDTPWVEDDEIGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +++YGKSKL GEE +    + + I+RTAW+Y I G NF  +ML LAK   E++VV D+ G
Sbjct: 121 ISVYGKSKLEGEEAIQEILDKFFIVRTAWLYGINGGNFPKTMLELAKTHDELTVVYDEVG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPT  L +A AI +    LIE   T   GI+H+T + G  SW +FA+YIF E AE     
Sbjct: 181 TPTYTLDLAEAIGK----LIE---TDYYGIYHIT-NSGSCSWCEFAKYIF-EVAEVD--- 228

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            KV  +   ++   A RP+YS L+  +  +     + ++KE +++ L
Sbjct: 229 VKVTPVTASEFARPAPRPSYSVLNNKRWVDNGFEPLRSYKEAIKDYL 275


>gi|209967308|ref|YP_002300223.1| dTDP-4-dehydrorhamnose reductase, putative [Rhodospirillum centenum
           SW]
 gi|209960774|gb|ACJ01411.1| dTDP-4-dehydrorhamnose reductase, putative [Rhodospirillum centenum
           SW]
          Length = 299

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 118/298 (39%), Positives = 162/298 (54%), Gaps = 21/298 (7%)

Query: 2   KCLVIGNNGQIAQSLS--------SMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDV 53
           + L++G  GQ+  +L         S+   +  ++ +   D D L+    A+       D+
Sbjct: 5   RLLLLGGTGQVGTALRRLAPERGWSVSAPERSVLDLATADRDSLRQAVAAA-------DL 57

Query: 54  IINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPID 113
           ++N AAYT VD+AE E + A + NA G G +A+       P +++STDYVFDG    P  
Sbjct: 58  VVNAAAYTRVDQAETERDAAIAANATGPGLLARVCAEAERPLLHLSTDYVFDGSGTRPYR 117

Query: 114 EFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREIS 173
           E  P  PL +YG SK AGE  V      +VILRTAWV+S  G+NFL +MLRL +ER E+ 
Sbjct: 118 EDDPVAPLGVYGASKAAGEAAVREAGPRHVILRTAWVFSPDGNNFLRTMLRLGRERPEVR 177

Query: 174 VVCDQFGTPTSALQIARAIIQIAHNLIEN--SDTS-LRGIFHMTADGGP-VSWADFAEYI 229
           VV DQ G PT+A  IA A + IA  L  +   D S L G FH+   G P  +W  FA  I
Sbjct: 178 VVDDQRGCPTAADDIAAACLGIADRLAADRPDDASPLWGTFHVA--GTPATTWHGFAAAI 235

Query: 230 FWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           F E+  RG P  ++  I T  YPT   RPA+S LDC+++   + I    W+ GVR  L
Sbjct: 236 FAEAERRGLPVPRLLPITTADYPTPTRRPAFSVLDCTRIGTVYGIAAPDWRAGVRRCL 293


>gi|320107885|ref|YP_004183475.1| dTDP-4-dehydrorhamnose reductase [Terriglobus saanensis SP1PR4]
 gi|319926406|gb|ADV83481.1| dTDP-4-dehydrorhamnose reductase [Terriglobus saanensis SP1PR4]
          Length = 308

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 102/298 (34%), Positives = 161/298 (54%), Gaps = 11/298 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L+ G+ GQ+  +L  +      ++   R ++DL          L+  P  +++P AYT
Sbjct: 6   RILLTGSTGQLGAALQPLLASLGTVVAPTRSELDLSDAASIRRTMLAVRPRWVVHPGAYT 65

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE EPEIA ++NA   G   + A  IG   I  STDYVFDG    P  E   T PL
Sbjct: 66  AVDRAETEPEIAHAVNAVAPGVFGEEAKRIGAAVIAFSTDYVFDGSGSAPWKETDSTGPL 125

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           N+YG++KL GE  +A+    ++I RT+WVYS  G +FL ++ +LA+E+ ++S++ DQ G 
Sbjct: 126 NVYGQTKLDGERALAASGAAHLIFRTSWVYSAQGRSFLGTIAKLAREKEKLSIINDQHGA 185

Query: 182 PTSALQIARAIIQIAHNLIENSD--------TSLRGIFHMTADGGPVSWADFAEYI--FW 231
           PTSA  +A     +   L +  +         +  G++H  A  G  +W DFA++I  F 
Sbjct: 186 PTSASDLAEMTAYLVRQLEDGGEGRRAEDLVRTQSGVYH-AAGTGEATWFDFAKHIVAFG 244

Query: 232 ESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           +++     ++++  I T +YPT A RP  S LDC+KL +     +  W + V   L +
Sbjct: 245 KASYPDQTFAEILPIPTAEYPTPAKRPLNSRLDCTKLWDIFGWTMPLWTKSVDEALAS 302


>gi|152985433|ref|YP_001351218.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa PA7]
 gi|150960591|gb|ABR82616.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa PA7]
          Length = 302

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 108/285 (37%), Positives = 153/285 (53%), Gaps = 7/285 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G NGQ+   L        E++   R   DL  P+  A    +  P  I+N  AYT
Sbjct: 3   RILLLGANGQVGWELQRALAPLGELLVCDRRRADLADPEGLARLVRAERPQFIVNAGAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE + + A  INA     +A+ A + G   ++ STDYVFDG    P  E +PT PL
Sbjct: 63  AVDKAESDADNARLINARAVAVLAEEAAACGAWLVHYSTDYVFDGAGSAPFAEDAPTGPL 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG++KL GE+ + +    ++I RT+WVY+  G NF  +MLRLA +R E+ VV DQFG 
Sbjct: 123 SVYGQTKLEGEQAIRASGCRHLIFRTSWVYAARGGNFARTMLRLAGQRDELKVVADQFGA 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLR--GIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PTSA  IA    Q    L  ++D + R  G +H+ A  G  SW  +A ++  ++ ERG  
Sbjct: 183 PTSAELIADVTAQALQRLRWDADLATRASGTYHLVAS-GETSWHLYARFVIEQALERGWE 241

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
                 +V  I T  YP  A RPA S LD  KL     + +  W+
Sbjct: 242 LKTEPQRVLPITTADYPVPAKRPANSRLDNRKLQQVFGLVLPDWR 286


>gi|307825028|ref|ZP_07655250.1| dTDP-4-dehydrorhamnose reductase [Methylobacter tundripaludum SV96]
 gi|307734075|gb|EFO04930.1| dTDP-4-dehydrorhamnose reductase [Methylobacter tundripaludum SV96]
          Length = 300

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/298 (36%), Positives = 158/298 (53%), Gaps = 13/298 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI----DLLKPKDFASFFLSFSPDVIIN 56
           MK L+ G  GQ+   L        E++ +G        D   P+  A    + +PD+I+N
Sbjct: 1   MKILLFGKGGQVGWELQRSLAPLGELVALGTDSQTLCGDFTNPEGIAQVVRAVAPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE E E+  +INA     +A+ A   G   ++ STDYVFDG    P  E  
Sbjct: 61  AAAHTAVDKAESELELCRTINATTPCVLAQEAKRSGAWLVHYSTDYVFDGSGDKPWLETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PL++YGK+KL GEE + +    ++I RT+WVY+  G NF  +MLRLA+ER  ++V+ 
Sbjct: 121 ATGPLSVYGKTKLEGEEAIRATGCQHLIFRTSWVYAARGGNFAKTMLRLARERDSLTVID 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G PT A  +A        + ++  D S  G++H+ + GG  SW D+A ++  ESA +
Sbjct: 181 DQIGAPTGADLLADVTAHAIRSALQRPDVS--GLYHLVS-GGQTSWYDYAGFVI-ESARQ 236

Query: 237 GGPYSKV-----YRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
            G   KV       + T  +P  A RP  S LD  KL NT  + +  W  G+  +L  
Sbjct: 237 AGIDIKVAPEAIQPVPTSAFPLPAPRPKNSRLDTRKLQNTFGLNLPHWHSGITRMLTE 294


>gi|254432333|ref|ZP_05046036.1| dTDP-4-dehydrorhamnose reductase [Cyanobium sp. PCC 7001]
 gi|197626786|gb|EDY39345.1| dTDP-4-dehydrorhamnose reductase [Cyanobium sp. PCC 7001]
          Length = 298

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 156/293 (53%), Gaps = 11/293 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           +  L+ G  GQ+ Q L + C   V +I  GR ++DL   +      L   PD ++N  AY
Sbjct: 6   LTVLLTGAGGQLGQELVAQCPAGVTLIATGRSELDLADAQACRQLVLERRPDWVLNAGAY 65

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE EPE+A ++NA    A+A A    G   +++STD+VFDG   +P       +P
Sbjct: 66  TAVDRAESEPELAEAVNAGAPQALAAALAGTGGRLLHLSTDFVFDGRQGSPYATDQLRSP 125

Query: 121 LNIYGKSKLAGEEKVASYT----NNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           L +YG SK AGEE + + +        +LRT+WVY   G NF L+MLRL  E+ EI VV 
Sbjct: 126 LGVYGASKAAGEEALLASSLLADGRVHVLRTSWVYGPVGRNFCLTMLRLHGEKEEIGVVA 185

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G PT+   +A A  +    LIE ++  L  I H + D G  SW DFA  I     E 
Sbjct: 186 DQVGCPTATPTLAAACWR----LIERAEVGLPDILHWS-DAGAASWYDFAVAIGELGVEL 240

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           G     ++V  I T  YPT A RP+YS LDC+       +    W+E +R +L
Sbjct: 241 GLLQRQARVKPITTADYPTPARRPSYSLLDCTASRTALGLEPLHWREALRQVL 293


>gi|94264208|ref|ZP_01288004.1| dTDP-4-dehydrorhamnose reductase [delta proteobacterium MLMS-1]
 gi|93455383|gb|EAT05584.1| dTDP-4-dehydrorhamnose reductase [delta proteobacterium MLMS-1]
          Length = 290

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/281 (38%), Positives = 163/281 (58%), Gaps = 9/281 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L+ G  GQ+ + L++      E + VGR ++D++      +FF +  P  ++N AAYT
Sbjct: 3   RVLITGAGGQLGRELAARL--GPEQLAVGRQELDIVDGLAVKAFFKAHHPVAVVNCAAYT 60

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE EPE AF +N +GA  +A AA+S+ IP I+ISTD+VF G   +P  E     PL
Sbjct: 61  AVDRAESEPEDAFLVNEQGAVNLAMAAESLDIPLIHISTDFVFAGRKSSPYVESDRPAPL 120

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG+SKLAGE  V +     +++RT W+Y++ G NF+ ++L  A+ER ++ VV DQ G+
Sbjct: 121 SVYGRSKLAGERGVLAACPRSLVIRTGWLYAVHGRNFVNTVLYYARERGQLRVVADQVGS 180

Query: 182 PTSALQIARAIIQI--AHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PT    +A  I +I  A  L  N   +   IFH  A+ G  +W DFA  I     E    
Sbjct: 181 PTYTGDLAAVIAKILAARGLDGNKRMATSRIFHY-ANEGVATWYDFACAII----EISNL 235

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
              V  + T++YPT A RP YS L+ SK+ +T  + I  W+
Sbjct: 236 PCIVEPVSTQEYPTVARRPPYSVLNKSKIKDTLGLVIPGWR 276


>gi|307340807|gb|ADN43867.1| RmlD [Escherichia coli]
          Length = 299

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 158/296 (53%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI-------DLLKPKDFASFFLSFSPDV 53
           M  L+ G  G++   L         +I     DI       D   P+  A       PDV
Sbjct: 1   MNILLFGKTGRVGWELQRALAPLGNLIAF---DIHSTDYCGDFSNPEGVAETVKRIRPDV 57

Query: 54  IINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPID 113
           I+N AA+TAVDKAE EPE A  +NA    +IAKAA+ +G   I+ STDYVF G   TP  
Sbjct: 58  IVNAAAHTAVDKAESEPEFAQLLNATSVESIAKAANEVGAWVIHYSTDYVFPGNGDTPWL 117

Query: 114 EFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREIS 173
           E   T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E+ 
Sbjct: 118 ETDATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELE 177

Query: 174 VVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           V+ DQFG PT A  +A          +   D +  G++H+ A  G  +W D+A  +F E+
Sbjct: 178 VINDQFGAPTGAELLADCTAHAIRVALNKPDVA--GLYHLVAS-GTTTWYDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  Y T A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLNAVPTTAYLTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 290


>gi|15895582|ref|NP_348931.1| dTDP-4-dehydrorhamnose reductase, rfbD ortholog [Clostridium
           acetobutylicum ATCC 824]
 gi|15025322|gb|AAK80271.1|AE007732_5 DTDP-4-dehydrorhamnose reductase, rfbD ortholog [Clostridium
           acetobutylicum ATCC 824]
 gi|325509731|gb|ADZ21367.1| DTDP-4-dehydrorhamnose reductase [Clostridium acetobutylicum EA
           2018]
          Length = 280

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 113/285 (39%), Positives = 156/285 (54%), Gaps = 14/285 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK L+ G NGQ+ + +      ++VE+I     D+D+        FF    P+V+IN AA
Sbjct: 1   MKILITGANGQLGREIQKQLKGKNVEVIPTDVQDLDITNVLAVNKFFNEKKPNVVINCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           +TAVDK E++ ++A+ INA G   +A AA S+G   + ISTDYVFDG ++ PI EF   N
Sbjct: 61  HTAVDKCEEQYDLAYKINAIGPKNLAAAAYSVGAEIVQISTDYVFDGEAKEPITEFDEVN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P + YGK+KL GE  V +    Y I+RTAW+Y   G+NF+ +M+ L K   E+ VV DQ 
Sbjct: 121 PQSAYGKTKLEGENFVKALNPKYYIVRTAWLYGD-GNNFVKTMINLGKTHDELKVVHDQV 179

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           GTPTS + +AR ++++        D    G FH T   G  SW DFA  IF       G 
Sbjct: 180 GTPTSTVDLARVVLKVI-------DEKNYGTFHCTCK-GICSWYDFAVEIF----RLTGI 227

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
             KV    T+++P  A RP YS L    L  T       WKE ++
Sbjct: 228 DVKVTPCTTEEFPRPAKRPKYSVLRNYMLELTTGDITREWKESLK 272


>gi|325144206|gb|EGC66513.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis
           M01-240013]
 gi|325203843|gb|ADY99296.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis
           M01-240355]
 gi|325206402|gb|ADZ01855.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis
           M04-240196]
          Length = 287

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 171/292 (58%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+       +   SF PD I+N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   AF++NA     +A AA       I+ISTDYVFDG  + P  E   TNP
Sbjct: 61  TAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDYVFDGKGKRPYQESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YG+SK AGE    S   + +ILRT+W++S +G NF+ +ML LA+ER  +S V +Q G
Sbjct: 121 SNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFVRTMLNLARERSPLSAVHNQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  ++  II+    L+++S+  +RGI+H  A G  VSW +F ++IF  ++++    
Sbjct: 181 CPTYAGDLSATIIR----LLQHSN-PVRGIYHY-AGGKSVSWYEFVQHIFQAASQQQTSF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  +  K+YPT A RPAYS LDC K+ N   I+ S W++ +  ++  +
Sbjct: 235 PIPELTAVSDKEYPTAAPRPAYSILDCRKIENDFGIKPSDWQKALAQVVSKL 286


>gi|77460278|ref|YP_349785.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas fluorescens Pf0-1]
 gi|77384281|gb|ABA75794.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas fluorescens Pf0-1]
          Length = 297

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 110/298 (36%), Positives = 162/298 (54%), Gaps = 12/298 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI-----DLLKPKDFASFFLSFSPDVII 55
           M+ L++G NGQ+   L        E++ + R  +     DL   +   +   +  PDVI+
Sbjct: 1   MRILLLGKNGQVGWELQRSLAPLGELLSLDRQTVGGLCGDLTDLEGLRATIRTVRPDVIV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVDKAE E E+   +N +   A+A+ A S+G   ++ STDYVF G   TP  E 
Sbjct: 61  NAAAYTAVDKAESERELVDLVNVKAVQALAEEALSLGAWLVHYSTDYVFSGEGTTPWLED 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
           +   P+N YG SK AGEE V +    Y+I R +W+YS  G+NF  +MLRLA+ER E++V+
Sbjct: 121 AAVAPVNHYGASKFAGEEAVVASGCKYLIFRPSWIYSARGNNFAKTMLRLAREREELNVI 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
            DQ G PT A  IA         +++  D  L G++H+ A  G VSW  +A+++  E A+
Sbjct: 181 NDQIGAPTGADLIADVTAHAIRQVLQRPD--LAGVYHLAA-AGEVSWHGYAQHVV-EVAK 236

Query: 236 RGGPYSKVYR---IFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             G    V     I T  Y T A RP  S L+  KL +  ++ +  W+ GV  +L+ +
Sbjct: 237 AHGETLAVMSINPIETAAYSTPARRPRNSRLNTRKLRDNFSLHLPDWQSGVTRMLMEV 294


>gi|219670471|ref|YP_002460906.1| dTDP-4-dehydrorhamnose reductase [Desulfitobacterium hafniense
           DCB-2]
 gi|219540731|gb|ACL22470.1| dTDP-4-dehydrorhamnose reductase [Desulfitobacterium hafniense
           DCB-2]
          Length = 287

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 111/288 (38%), Positives = 158/288 (54%), Gaps = 13/288 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G NGQ+   +  +  +  +E   V   D D+   +    + + + PD +I+ +A
Sbjct: 1   MKILVTGVNGQLGYDVCKVLTERGLEHCGVDITDFDITDERAVKDYLIDYHPDAVIHCSA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           +TAVD AED+PE A +IN  G   IA A   +G   +YISTDYVF G      +    T 
Sbjct: 61  WTAVDAAEDQPEKAVAINVGGVRNIASACKVLGAKLVYISTDYVFSGFGDHFYEVDDETG 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL++YGK+KL GE  V    + Y I+R +W + + G+NF+ +MLRLA+ + E+SVVCDQF
Sbjct: 121 PLSVYGKTKLDGEMAVKELLSCYFIVRISWAFGVNGNNFVKTMLRLAERQDEVSVVCDQF 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT    +A  +     ++IE   TS  G +H T + G  SWA+FA  IF    +  G 
Sbjct: 181 GSPTYTADLAPLLC----DMIE---TSHFGTYHATNE-GICSWAEFAAEIF----KLAGR 228

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             KV  I T  YPTKA RP  S L   KL      R+  W+E + + +
Sbjct: 229 AVKVNEIMTCNYPTKAVRPLNSRLSKDKLVEAGFSRLPHWREALSDYM 276


>gi|163754601|ref|ZP_02161723.1| putative dTDP-dehydrorhamnose reductase [Kordia algicida OT-1]
 gi|161325542|gb|EDP96869.1| putative dTDP-dehydrorhamnose reductase [Kordia algicida OT-1]
          Length = 284

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 164/291 (56%), Gaps = 18/291 (6%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEI---IRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           LV G NGQ+ Q +  +  Q  +I    +  R D+D+   K    +F +   D  +N AAY
Sbjct: 5   LVTGANGQLGQCIQKIQPQHAKINFHFKSSR-DLDITNVKAVNDYFSNHDFDYCVNCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T V+ AE E E A+ +NAE A  +A+A     +  I+ISTDYVFDG  +TP  E   TNP
Sbjct: 64  TNVELAESEEEKAYLVNAEAAKYLAEACAENNVTLIHISTDYVFDGTKKTPYVETDTTNP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +++YG SKL GE+ +    NNY I+RT+W+Y+ FG NF  ++LR A+E+  +++  +Q G
Sbjct: 124 ISVYGASKLKGEQNIQEIFNNYFIIRTSWLYAEFGKNFYKTILRKAEEKANLTITTEQKG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF--WESAERGG 238
           TPT+A  +A  I++I      N++    GI+H + + G  +W DF + I      AE   
Sbjct: 184 TPTNANDLAELIVEII-----NTENKNYGIYHFSNE-GEATWYDFTKEIIQNLNLAEAEK 237

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           P  K        Y TKA RP YS LD +K+ N   I+  +W+E ++ ++ N
Sbjct: 238 PSLKP----IASYKTKAARPVYSVLDKTKVRNI--IQTISWQESLQQLMKN 282


>gi|194337310|ref|YP_002019104.1| dTDP-4-dehydrorhamnose reductase [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194309787|gb|ACF44487.1| dTDP-4-dehydrorhamnose reductase [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 292

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 160/289 (55%), Gaps = 9/289 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M  LV G+ GQ+   L  +  +  +        PD+D+  P+  A        +VIIN A
Sbjct: 1   MNILVTGSRGQLGSELQELSTRSDNHRFFFYDLPDLDITSPERVAELCREHEIEVIINCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAE + + AF +N +GA  +A  A       ++ISTDYVF+G S  P  E  P 
Sbjct: 61  AYTAVDKAESDVDAAFRVNRDGAAVLAACAKERNALLVHISTDYVFNGKSHIPYRETDPA 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            PL +YG SK  GEE++     ++ I+RT+W+YSI+G+NF+ +MLRL  ER  ++VV DQ
Sbjct: 121 TPLGVYGVSKWEGEERIRDIAPSHWIIRTSWLYSIYGANFVKTMLRLGAERSTLNVVADQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +A A++ +     +N+  +  G +H + + G  SW DFA+ I  E AE   
Sbjct: 181 IGTPTWAADLAGALVSMLERYDKNNHYA--GRYHYSNE-GVCSWYDFAQAIM-ELAELP- 235

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              +V  + + QYP  A RP YS L+ S + +   + I  W+  +  +L
Sbjct: 236 --CRVVPVESSQYPQIAERPHYSVLNKSAIKDEWKLEIPYWRVSLAAML 282


>gi|9957835|gb|AAG09514.1|AF279619_2 dTDP-6-deoxy-L-mannose-dehydrogenase [Salmonella enterica]
          Length = 299

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 159/296 (53%), Gaps = 9/296 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIR--VGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G NGQ+   L        +II   V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKNGQVGWELQRSLAPLGKIIALDVHSKDYCGDFSNPEGVAETIRRIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE E E A  +NA    AIAKAA   G   ++ STDYVF G   TP  E  
Sbjct: 61  AAAHTAVDKAESEVEFATLLNARSVEAIAKAASETGAWVVHYSTDYVFPGTGETPWCEDD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KL GE+ +      ++I RT+WVY+  G+NF  +MLR AKER E+SV+ 
Sbjct: 121 ATAPLNVYGETKLTGEKALQDNCARHLIFRTSWVYAGKGNNFAKTMLRFAKEREEMSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A          ++  + +  G++H+ A GG  +W ++A  +F E+ + 
Sbjct: 181 DQYGAPTGAELLADCTAHAIRVALKQPEVA--GLYHLVA-GGTTTWYEYAALVFDEARKA 237

Query: 237 GGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G   +  K+  + T  YPT A RP  S L+  K     ++ +  W+ GVR +L  +
Sbjct: 238 GIELAINKLNAVPTSAYPTPARRPNNSRLNTDKFQKKFDLVLPEWEIGVRRMLAEL 293


>gi|325140090|gb|EGC62619.1| dTDP-4-dehydrorhamnose reductase [Neisseria meningitidis CU385]
          Length = 287

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 171/292 (58%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+       +   SF PD I+N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   AF++NA     +A AA       I+ISTDYVFDG  + P  E   TNP
Sbjct: 61  TAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDYVFDGKGKRPYQESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YG+SK AGE    S   + +ILRT+W++S +G NF+ +ML LA+ER  +S V +Q G
Sbjct: 121 SNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFIRTMLNLARERSPLSAVHNQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  ++  II+    L+++S+  +RGI+H  A    VSW +FA++IF  ++++    
Sbjct: 181 CPTYAGDLSATIIR----LLQHSN-PVRGIYHY-AGSKSVSWYEFAQHIFQAASQQQTSF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  +  K+YPT A RPAYS LDC K+ N   I+ S W++ +  ++  +
Sbjct: 235 PVPELTAVSDKEYPTAAPRPAYSILDCRKIENDFGIKPSDWQKALAQVVSKL 286


>gi|212691001|ref|ZP_03299129.1| hypothetical protein BACDOR_00491 [Bacteroides dorei DSM 17855]
 gi|237712510|ref|ZP_04542991.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|237726686|ref|ZP_04557167.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|212666233|gb|EEB26805.1| hypothetical protein BACDOR_00491 [Bacteroides dorei DSM 17855]
 gi|229435212|gb|EEO45289.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
 gi|229453831|gb|EEO59552.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
          Length = 285

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 110/283 (38%), Positives = 156/283 (55%), Gaps = 12/283 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVE--IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           LV G NGQ+   +  +  +  E         ++D+   +   +F    +  VI+N AAYT
Sbjct: 5   LVTGANGQLGNEMRVLSAEYKEYTCFFTDVAELDICDEQAVMTFVKENNIHVIVNCAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAED+ E+   +N      +AKAA++     I ISTDYVFDG    P +E     P 
Sbjct: 65  AVDKAEDDIELCTKLNKNAVSYLAKAAEANWGEFIQISTDYVFDGTKYLPYNEGDVPCPN 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YGK+KLAGE     Y    +I+RTAW+YS FG+NF+ +M+RL KE+  + VV DQ GT
Sbjct: 125 SVYGKTKLAGETNALEYCKKTMIIRTAWLYSTFGNNFVKTMIRLGKEKETLGVVFDQIGT 184

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A  +AR I    +  +      + G++H + D G  SW DFA+ I   +   G    
Sbjct: 185 PTYARDLARVIFTAIYKGV------VPGVYHFS-DEGVCSWYDFAKAIHRIA---GITTC 234

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           KV  + T +YP KA RP YS LD +K+  T+NI I  W+E + 
Sbjct: 235 KVSPLHTNEYPAKAPRPHYSVLDKTKVKTTYNIEIPHWEESLE 277


>gi|119898167|ref|YP_933380.1| dTDP-4-dehydrorhamnose reductase [Azoarcus sp. BH72]
 gi|119670580|emb|CAL94493.1| dTDP-4-dehydrorhamnose reductase [Azoarcus sp. BH72]
          Length = 296

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 111/295 (37%), Positives = 159/295 (53%), Gaps = 11/295 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID-----LLKPKDFASFFLSFSPDVII 55
           MK L++G NGQ+   L        E++ + R   D     L +P++      + +P VI+
Sbjct: 1   MKILLLGKNGQVGWELQRALAPLGEVLALDRHGSDGLCGDLSRPEELGDTVRAVAPQVIV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
             AAYTAVDKAE +  +A  INA+    +A+ A  +G   ++ STDYVFDG   TP  E 
Sbjct: 61  IAAAYTAVDKAESDAALAQRINADAVAELARQATQLGALLVHYSTDYVFDGSGSTPWRED 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
           +P  PL++YG +KLAGE  + +    ++I RT+WVY+  G NF  +MLRLA ER  + VV
Sbjct: 121 APVAPLSVYGTTKLAGETAIRASGCRHLIFRTSWVYAARGGNFAKTMLRLAAERDTLKVV 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
            DQ G PT A  IA          I +++  L G +H+ A  G  SW  +A ++  ++A 
Sbjct: 181 ADQIGAPTGADLIADVTAHAIRACIPSAN-DLSGTYHLAA-AGETSWHGYACHVI-DTAR 237

Query: 236 RGGPYSKVYRI---FTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           R G   KV  I    +  YPT A RPA S LD + L  T  + +  W+ GV  +L
Sbjct: 238 RLGHPLKVGLIEPLASADYPTPARRPANSRLDTALLRTTFALNLPDWRSGVDRML 292


>gi|148643364|ref|YP_001273877.1| dTDP-4-dehydrorhamnose reductase, RfbD [Methanobrevibacter smithii
           ATCC 35061]
 gi|148552381|gb|ABQ87509.1| dTDP-4-dehydrorhamnose reductase, RfbD [Methanobrevibacter smithii
           ATCC 35061]
          Length = 280

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 108/287 (37%), Positives = 160/287 (55%), Gaps = 12/287 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G+NG +   L+ +     E+I      +D+   +    F     PD++IN AAY
Sbjct: 1   MKVLITGSNGMLGHDLTDVLNDKHELILTTSKTLDITDKEHTVEFIKENKPDIVINSAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD  E+  ++AFS+N EG   +A        P ++ISTDYVF+G + TP  E     P
Sbjct: 61  TNVDGCEENQKLAFSVNGEGVRNLAIGCREADCPLVHISTDYVFNGKNDTPWVEDDEIGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +++YGKSKL GEE +    + + I+RTAW+Y I G NF  +ML LAK   E++VV D+ G
Sbjct: 121 ISVYGKSKLEGEEAIQEILDKFFIVRTAWLYGINGGNFPKTMLELAKTHDELTVVYDEVG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPT  L +A AI +    LIE   T   GI+H+T + G  SW +FA+YIF E AE     
Sbjct: 181 TPTYTLDLAEAIGK----LIE---TDYYGIYHIT-NSGSCSWCEFAKYIF-EVAEVD--- 228

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            KV  +   ++   A RP+YS L+  +  +     + ++KE +++ L
Sbjct: 229 VKVTPVTASEFARPAPRPSYSVLNNKRWVDNGFEPLRSYKEAIKDYL 275


>gi|317403268|gb|EFV83786.1| dTDP-4-dehydrorhamnose reductase [Achromobacter xylosoxidans C54]
          Length = 304

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 160/296 (54%), Gaps = 9/296 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K LVIG +GQ+   L         +  VGR D DL  P   A       PDVI+N AA+T
Sbjct: 4   KILVIGRDGQLGFELRRSLAPLGVVTAVGRADCDLTYPLQIARLVRREKPDVIVNAAAFT 63

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AV++A+++   A  INAE AG ++  A   G   ++ S+DYVFDG      DE     PL
Sbjct: 64  AVERAQEDGVRAMRINAEAAGELSALAAERGALIVHYSSDYVFDGAKPGAYDERDTPAPL 123

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           N+YG+SKLAGE+ V +    +++ RT+WVY +FG++FL +ML   ++   + VV DQ G 
Sbjct: 124 NVYGRSKLAGEQAVRAMNPAHLVFRTSWVYGVFGNSFLKTMLMALRQPETLRVVSDQRGA 183

Query: 182 PTSALQIARAI-IQIAHNLIENSDTSLR-GIFHMTADGGPVSWADFAEYIFWESAERGG- 238
           PT A  IA A  + +A  L   +D +   G++H+ A G   SW ++A +I  + A R G 
Sbjct: 184 PTGAAYIADATALVLARYLARPADEAFPFGLYHLAATGD-ASWHEYACFIA-QQARRAGL 241

Query: 239 ----PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                 + +  + + QYPT A RP  S LD   L  T  IR   W++GV + L  I
Sbjct: 242 AVTLTPADIRAVPSDQYPTTARRPLNSRLDSRLLERTFGIRAPHWEDGVTHALAAI 297


>gi|222054967|ref|YP_002537329.1| dTDP-4-dehydrorhamnose reductase [Geobacter sp. FRC-32]
 gi|221564256|gb|ACM20228.1| dTDP-4-dehydrorhamnose reductase [Geobacter sp. FRC-32]
          Length = 276

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 112/284 (39%), Positives = 154/284 (54%), Gaps = 15/284 (5%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L++G  G + Q L ++       + +   DID+   +       +  P V+IN AAYT V
Sbjct: 3   LIVGAKGMLGQDLMALFGPGARGVDL--EDIDITSLESVQKVLFTIRPRVVINAAAYTDV 60

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D  E   E A  +N EG   +A A   IG   + +STDYVFDG   +P  E  PT PL++
Sbjct: 61  DGCETNQEPAMQVNGEGVAHLALATSEIGAKLVQVSTDYVFDGGKGSPYLEDEPTAPLSV 120

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKLAGE   A +  ++VI+RT W+Y I G NF+ +MLRLA E+RE++VV DQ G+PT
Sbjct: 121 YGESKLAGEMN-ARFNPDHVIVRTQWLYGINGKNFVETMLRLATEKRELAVVDDQIGSPT 179

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKV 243
             + +A AI      L+E      RGI+H  A+ G  SW +FA  IF ES    G    V
Sbjct: 180 WTVDLALAI----KALVEK---DCRGIYH-AANAGFCSWNEFARAIFAES----GLDVTV 227

Query: 244 YRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             + TK     A RP YS LDC KL      +   W+E +++ L
Sbjct: 228 NPMSTKDLGRPAPRPLYSTLDCGKLTRDTGFQPQPWREALKHYL 271


>gi|257792903|gb|ACV67280.1| RmlD [Escherichia coli]
          Length = 299

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 114/296 (38%), Positives = 165/296 (55%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A    S  PD+I+N
Sbjct: 1   MNILLFGKIGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EP+ A  +NA    AIAKAA+ +G   I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPKFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQEED 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +  D+A  +F E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GIHNLHDYAALVFEEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G P +  K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 235 RKAGIPLALNKLSAVPTTAYPTPARRPHNSRLNTEKYQQNFALVLPDWQVGVKRML 290


>gi|329113804|ref|ZP_08242575.1| Putative dTDP-4-dehydrorhamnose reductase [Acetobacter pomorum
           DM001]
 gi|326696814|gb|EGE48484.1| Putative dTDP-4-dehydrorhamnose reductase [Acetobacter pomorum
           DM001]
          Length = 312

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 154/288 (53%), Gaps = 4/288 (1%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G  GQ+A SL ++    +    VGRPD D  +P+   +   +  P  ++N AA+TAV
Sbjct: 23  LVTGGKGQLATSLVNLGGPRIRC--VGRPDFDFDRPETLKATLDAIKPVAVVNAAAWTAV 80

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D AE EPE A   N  G   +A+     GIP I++STDYVF G    P  E  P +P  +
Sbjct: 81  DLAESEPEAAARANTTGPELLARLCAERGIPFIHVSTDYVFAGDKGAPYVETDPVSPQTV 140

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG +K  GE+++ +     +ILRT+WVYS  G NF+ +ML +  +   + VV DQ G PT
Sbjct: 141 YGSTKAEGEQRILAADPRSIILRTSWVYSAHGKNFVRTMLNVGAKNPALKVVGDQRGNPT 200

Query: 184 SALQIARAIIQIAHNLIENS-DTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
            +  +A+AI+ I   + +        GI+H     G  +W   AE    ++AE G     
Sbjct: 201 CSDDLAQAILSILATIEKTGWKDEYAGIYHACGT-GETTWHGLAEAALQKAAEYGQAKPT 259

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           +  I T+ +PT A RPA S +D SKLA+   I++  W+E V  ++  I
Sbjct: 260 ITAIRTEDWPTPAKRPADSRMDNSKLAHVFGIQMPQWQESVNKVVHQI 307


>gi|296392017|ref|ZP_06881492.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa PAb1]
          Length = 302

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 107/285 (37%), Positives = 154/285 (54%), Gaps = 7/285 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G NGQ+   L        E++   R   DL  P+  A    +  P  I+N  AYT
Sbjct: 3   RILLLGANGQVGWELQRALAPLGELLVCDRRRADLADPEGLARLIRAERPQFIVNAGAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE + + A  INA     +A+ A + G   ++ STDYVFDG    P  E +PT PL
Sbjct: 63  AVDKAESDADNARLINARAVAVLAEEAAACGAWLVHYSTDYVFDGAGSAPFAEDAPTGPL 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG++KL GE+ + +    ++I RT+WVY+  G NF  +MLRLA +R E+ VV DQFG 
Sbjct: 123 SVYGQTKLEGEQAIRASGCRHLIFRTSWVYAARGGNFAKTMLRLAGQRDELKVVADQFGA 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLR--GIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PTSA  IA    Q    L  +++ + R  G +H+ A  G  SW  +A ++  ++ ERG  
Sbjct: 183 PTSAELIADVTAQALQRLRWDAELAARASGTYHLVAS-GETSWHLYARFVIEQALERGWE 241

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
                 +V  I T+ YP  A RPA S LD  KL     + +  W+
Sbjct: 242 LQATPQRVLPIATEDYPVPAKRPANSRLDNHKLQQVFGLVLPDWR 286


>gi|254243957|ref|ZP_04937279.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa 2192]
 gi|126197335|gb|EAZ61398.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa 2192]
          Length = 302

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 107/285 (37%), Positives = 154/285 (54%), Gaps = 7/285 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G NGQ+   L        E++   R   DL  P+  A    +  P  I+N  AYT
Sbjct: 3   RILLLGANGQVGWELQRALAPLGELLVCDRRRADLADPEGLARLVRAERPQFIVNAGAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE + + A  INA     +A+ A + G   ++ STDYVFDG    P  E +PT PL
Sbjct: 63  AVDKAESDADNARLINARAVAVLAEEAAACGAWLVHYSTDYVFDGAGSAPFAEDAPTGPL 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG++KL GE+ + +    ++I RT+WVY+  G NF  +MLRLA +R E+ VV DQFG 
Sbjct: 123 SVYGQTKLEGEQAIRASGCRHLIFRTSWVYAARGGNFAKTMLRLAGQRDELKVVADQFGA 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLR--GIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PTSA  IA    Q    L  +++ + R  G +H+ A  G  SW  +A ++  ++ ERG  
Sbjct: 183 PTSAELIADVTAQALQRLRWDAELAARASGTYHLVAS-GETSWHLYARFVIEQALERGWE 241

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
                 +V  I T+ YP  A RPA S LD  KL     + +  W+
Sbjct: 242 LQATPQRVLPITTEDYPVPAKRPANSRLDNRKLQQVFGLVLPDWR 286


>gi|313110225|ref|ZP_07796121.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa 39016]
 gi|310882623|gb|EFQ41217.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa 39016]
          Length = 302

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 107/285 (37%), Positives = 154/285 (54%), Gaps = 7/285 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G NGQ+   L        E++   R   DL  P+  A    +  P  I+N  AYT
Sbjct: 3   RILLLGANGQVGWELQRALAPLGELLVCDRRRADLADPEGLARLVRAERPQFIVNAGAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE + + A  INA     +A+ A + G   ++ STDYVFDG    P  E +PT PL
Sbjct: 63  AVDKAESDADNARLINARAVAVLAEEAAACGAWLVHYSTDYVFDGAGSAPFAEDAPTGPL 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG++KL GE+ + +    ++I RT+WVY+  G NF  +MLRLA +R E+ VV DQFG 
Sbjct: 123 SVYGQTKLEGEQAIRASGCRHLIFRTSWVYAARGGNFAKTMLRLAGQRDELKVVADQFGA 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLR--GIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PTSA  IA    Q    L  +++ + R  G +H+ A  G  SW  +A ++  ++ ERG  
Sbjct: 183 PTSAELIADVTAQALQRLRWDAELAARASGTYHLVAS-GETSWHLYARFVIEQALERGWE 241

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
                 +V  I T+ YP  A RPA S LD  KL     + +  W+
Sbjct: 242 LQATPQRVLPITTEDYPVPAKRPANSRLDNHKLQQVFGLVLPDWR 286


>gi|160896723|ref|YP_001562305.1| dTDP-4-dehydrorhamnose reductase [Delftia acidovorans SPH-1]
 gi|160362307|gb|ABX33920.1| dTDP-4-dehydrorhamnose reductase [Delftia acidovorans SPH-1]
          Length = 300

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 107/302 (35%), Positives = 159/302 (52%), Gaps = 15/302 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI--------DLLKPKDFASFFLSFSPD 52
           MK L++G NGQ+   L        E+I + R           DL +  + A    +  PD
Sbjct: 1   MKLLLLGRNGQVGWELQRSLAPLGELIALDRQGDAGGQGLCGDLSRLDELARTVRALRPD 60

Query: 53  VIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPI 112
           VI+N AA+TAVDKAE EP+ A  +NA     +A+ A  IG   ++ STDYVFDG      
Sbjct: 61  VIVNAAAHTAVDKAESEPDQARLLNALAPQVLAREAAQIGALLVHYSTDYVFDGSGSAAR 120

Query: 113 DEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREI 172
            E   T PL++YG SKL GE+ + +    ++I RT+WVY+  G NF  +MLRLA+ER  +
Sbjct: 121 TETEATAPLSVYGSSKLEGEQLIQASGCRHLIFRTSWVYAARGGNFAKTMLRLAQEREAL 180

Query: 173 SVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWE 232
           SV+ DQ+G PT A  IA         L        +G++H+ A GG  +W  +A+++  +
Sbjct: 181 SVIDDQWGAPTGADLIADVTAHAIRQLQRQPGD--QGLYHLVA-GGETTWHAYADHVIAK 237

Query: 233 SAERGGPY----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
           + E    +     ++  + T  +PT A RP  S L+  +L  T  +R+  W+ GV  +L 
Sbjct: 238 ARELAPEHPWMVQRIAAVPTSAFPTPAQRPHNSRLNTERLQQTFGLRLPHWQAGVDRMLQ 297

Query: 289 NI 290
            I
Sbjct: 298 EI 299


>gi|116053309|ref|YP_793633.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115588530|gb|ABJ14545.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 302

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 107/285 (37%), Positives = 154/285 (54%), Gaps = 7/285 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G NGQ+   L        E++   R   DL  P+  A    +  P  I+N  AYT
Sbjct: 3   RILLLGANGQVGWELQRALAPLGELLVCDRRRADLADPEGLARLVRAERPQFIVNAGAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE + + A  INA     +A+ A + G   ++ STDYVFDG    P  E +PT PL
Sbjct: 63  AVDKAESDADNARLINARAVAVLAEEAAACGAWLVHYSTDYVFDGAGSAPFAEDAPTGPL 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG++KL GE+ + +    ++I RT+WVY+  G NF  +MLRLA +R E+ VV DQFG 
Sbjct: 123 SVYGQTKLEGEQAIRASGCRHLIFRTSWVYAARGGNFAKTMLRLAGQRDELKVVADQFGA 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLR--GIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PTSA  IA    Q    L  +++ + R  G +H+ A  G  SW  +A ++  ++ ERG  
Sbjct: 183 PTSAELIADVTAQALQRLRWDAELAARASGTYHLVAS-GETSWHLYARFVIEQALERGWE 241

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
                 +V  I T+ YP  A RPA S LD  KL     + +  W+
Sbjct: 242 LQATPQRVLPIATEDYPVPAKRPANSRLDNHKLQQVFGLVLPDWR 286


>gi|83950200|ref|ZP_00958933.1| dTDP-4-dehydrorhamnose reductase [Roseovarius nubinhibens ISM]
 gi|83838099|gb|EAP77395.1| dTDP-4-dehydrorhamnose reductase [Roseovarius nubinhibens ISM]
          Length = 277

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 106/280 (37%), Positives = 155/280 (55%), Gaps = 9/280 (3%)

Query: 12  IAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPE 71
           +A+ + +   +  EI+ +GR   D   P    +      P+ +IN  AYTAVD+AE++  
Sbjct: 1   MAREVQARAPEGWEIVALGRDAADFTNPLATLAALKRARPEAVINAVAYTAVDRAEEDEA 60

Query: 72  IAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAG 131
           +A  +N    G +A    ++G+P +++STDYVF G    P      T P N YG+SKLAG
Sbjct: 61  LAQQVNGATPGLLAAECAAMGVPFVHLSTDYVFAGSGVAPYAPADATAPQNAYGRSKLAG 120

Query: 132 EEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARA 191
           EE V +    +VILRT+WV+S  G+NF+ +MLRL  ER  +++V DQ G PT A  IA A
Sbjct: 121 EEAVRAAGGPHVILRTSWVFSSHGANFVKTMLRLGAERDRLTIVADQIGGPTPARAIAAA 180

Query: 192 IIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGPYSKVYRIFTKQ 250
            ++IA  L +++  S  G +H +  G P VSWA+FA  IF ++    G   +V  I T  
Sbjct: 181 CLRIAERLYKDAGQS--GTYHFS--GIPEVSWAEFAREIFAQA----GISCEVVDIPTSD 232

Query: 251 YPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           YPT A RP  S LDC        I    W+ G+  +L ++
Sbjct: 233 YPTPAQRPLNSRLDCRATETVFGIARPDWRVGLAEVLDDL 272


>gi|154493894|ref|ZP_02033214.1| hypothetical protein PARMER_03238 [Parabacteroides merdae ATCC
           43184]
 gi|154086154|gb|EDN85199.1| hypothetical protein PARMER_03238 [Parabacteroides merdae ATCC
           43184]
          Length = 288

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 111/290 (38%), Positives = 161/290 (55%), Gaps = 11/290 (3%)

Query: 4   LVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           LV G NGQ+  S+  +         +      +D+   +   +F      D IIN AAYT
Sbjct: 5   LVTGANGQLGNSIRRLAAGYPQYAFVFTDVDTLDICDAQAVNAFVKEKQVDYIINCAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAED+  +   IN +    + +AA   G   I++STDYVFDG +  P  E   T P 
Sbjct: 65  AVDKAEDDEALCLRINRDAVRNLGEAARMAGARVIHVSTDYVFDGTNHLPYVETDNTCPA 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG++KLAGE+ +     + VI+RTAW+YS FG+NF+ +MLRL  ER ++SVV DQ G+
Sbjct: 125 SVYGRTKLAGEQALQEVCPDAVIIRTAWLYSEFGNNFVKTMLRLGNEREQLSVVFDQIGS 184

Query: 182 PTSALQIARAIIQIAHNLIE-NSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           PT A  +A AI  +   L++  +D  + GI+H + + G  SW DFA  I     E G   
Sbjct: 185 PTYAGDLAAAIFAV---LVQAEADAFVPGIYHYSNE-GVCSWYDFAVKIM----ELGNAP 236

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            +V  I +K YP KA RP +S L+ +K+   + I IS W+  +R  +  I
Sbjct: 237 CRVLPIESKDYPAKAARPHFSVLNKAKIKTIYKISISHWEASLRECMKRI 286


>gi|91789861|ref|YP_550813.1| dTDP-4-dehydrorhamnose reductase [Polaromonas sp. JS666]
 gi|91699086|gb|ABE45915.1| dTDP-4-dehydrorhamnose reductase [Polaromonas sp. JS666]
          Length = 308

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 106/303 (34%), Positives = 160/303 (52%), Gaps = 17/303 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKP----KDFASFFLSFSPDVIIN 56
           MK L+ G NGQ+   L        E+  + R   DL       +  A+      PDVI+N
Sbjct: 1   MKILLFGKNGQVGWELQRSLAPLGELTALDRHSTDLCGDLGNLQGLAATVQQLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EP +A ++NA     +A+ A  +G   ++ STDYVFDG    P  E  
Sbjct: 61  AAAHTAVDKAESEPALARTLNALAPSVLAQEAARLGSLLVHYSTDYVFDGSGTRPWTEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
              PL++YG+SKL GE+ + + +  ++I RT+WVY+  G NF  +MLRLA+ER  + V+ 
Sbjct: 121 TPAPLSVYGQSKLEGEQLIQAASPRHLIFRTSWVYAARGGNFAKTMLRLAQERERLIVID 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG PT A  +A         +++    +  G++H+ A  G  SW  +A+Y+  + AER
Sbjct: 181 DQFGAPTGAELLADVSAHAIRQVLQRPADA--GLYHLVAS-GETSWHGYAKYVLAQ-AER 236

Query: 237 GGPYSKVY---------RIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
                +V           + T  +PT A RP  S LD ++L  T  + +  W++GV  +L
Sbjct: 237 SQEQGRVAIKIIAKAVDPVPTSAFPTPAKRPHNSRLDTTRLQTTFGLTLPPWQQGVDRML 296

Query: 288 VNI 290
             +
Sbjct: 297 EEV 299


>gi|89056333|ref|YP_511784.1| dTDP-4-dehydrorhamnose reductase [Jannaschia sp. CCS1]
 gi|88865882|gb|ABD56759.1| dTDP-4-dehydrorhamnose reductase [Jannaschia sp. CCS1]
          Length = 281

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 115/291 (39%), Positives = 159/291 (54%), Gaps = 14/291 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M  L  G  GQ+AQ L+ + V+      +GR + DL  P+  A    +     IIN AAY
Sbjct: 1   MSLLAFGQTGQVAQELARLGVR-----TLGRAEADLSNPQACADVIAASDATAIINAAAY 55

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE+E  +A +INA+   A+A A  +  IP ++ISTDYVFDG          P  P
Sbjct: 56  TAVDRAEEEEALAHTINADAPAAMAVACKAKNIPLVHISTDYVFDGQGTQSFRPSDPVAP 115

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L  YG++KLAGE+ V +    Y +LRT+WV+S  G+NF+ +MLRL  +R  +++V DQ G
Sbjct: 116 LGAYGRTKLAGEDAVRASGATYGVLRTSWVFSAHGANFVKTMLRLGADRDALTIVADQVG 175

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERGGP 239
            PTSA  IA A + +A  L    + S  G +H +  G P VSWADFA  IF E+      
Sbjct: 176 GPTSARAIAWACVTVADALQGAPEKS--GTYHFS--GAPDVSWADFARAIFAEADLN--- 228

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              V  I +  YPT A RP  S LDC+       +    W+  + + L +I
Sbjct: 229 -VAVTDIPSSDYPTPAVRPLNSRLDCAATEAAFGVPRPDWRADLGDALADI 278


>gi|157376143|ref|YP_001474743.1| dTDP-4-dehydrorhamnose reductase [Shewanella sediminis HAW-EB3]
 gi|157318517|gb|ABV37615.1| dTDP-4-dehydrorhamnose reductase [Shewanella sediminis HAW-EB3]
          Length = 303

 Score =  186 bits (471), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 112/297 (37%), Positives = 159/297 (53%), Gaps = 11/297 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G  GQ+A  L       +EII     ++D+          ++ SPD+IIN AAY
Sbjct: 1   MKVLVTGKGGQLAWELEQTTPSYIEIISFSANELDITNQAQVNEVVIAHSPDIIINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE + E A+++N +G+  +A     I    I+ISTD+VFDGL  TP       NP
Sbjct: 61  TAVDKAETDKETAYAVNEKGSEYLALICKEISAKLIHISTDFVFDGLKNTPYQTDDTPNP 120

Query: 121 LNIYGKSKLAGEEKVASYTN-NYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           +N+YG SKL G+ KV +      +I+RT W+YS  G+NF+ +MLRL  E+ ++ ++ DQ 
Sbjct: 121 VNVYGDSKLQGDIKVNNLLGCQAIIIRTGWMYSENGNNFVKTMLRLMVEKEQLGIIYDQV 180

Query: 180 GTPTSALQIARAIIQI--AHNLIENSD-----TSLRGIFHMTADGGPVSWADFAEYIFWE 232
           GTPT A  +A  I  +   H+ IE  D     TS   I+H T D G  SW DFA  I   
Sbjct: 181 GTPTWAKGLAEMIWALISRHSGIEERDIRNLSTSSAQIYHWT-DAGVASWYDFAVAIQEL 239

Query: 233 SAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           + E+G       V  I    YPT A RP++S +D +       +    W++ +  +L
Sbjct: 240 AIEKGMLDKAIPVRPIPASAYPTPAQRPSFSVIDKTTAEQASRVETKHWRKQLSAML 296


>gi|96667|pir||S23348 hypothetical protein 5.2 - Salmonella choleraesuis
 gi|431939|emb|CAA43073.1| dTDP-6-deoxy-L-mannose dehydrogenase [Salmonella enterica]
          Length = 248

 Score =  186 bits (471), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 103/247 (41%), Positives = 149/247 (60%), Gaps = 11/247 (4%)

Query: 49  FSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLS 108
             PDVI+N AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G  
Sbjct: 2   LRPDVIVNAAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTG 61

Query: 109 RTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKE 168
             P  E   T+PLN+YGK+KLAGE+ +      ++I RT+WVY+  G+NF  +MLRLAKE
Sbjct: 62  DIPWQETDATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKE 121

Query: 169 RREISVVCDQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADF 225
           R+ +SV+ DQ+G PT A  +A      I++A N  E     + G++H+ A GG  +W D+
Sbjct: 122 RQTLSVINDQYGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVA-GGTTTWHDY 175

Query: 226 AEYIFWESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
           A  +F E+ + G     +++  + T  YPT A RP  S L+  K     ++ +  W+ GV
Sbjct: 176 AALVFDEARKAGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFDLILPQWELGV 235

Query: 284 RNILVNI 290
           + +L  +
Sbjct: 236 KRMLTEM 242


>gi|255533798|ref|YP_003094170.1| dTDP-4-dehydrorhamnose reductase [Pedobacter heparinus DSM 2366]
 gi|255346782|gb|ACU06108.1| dTDP-4-dehydrorhamnose reductase [Pedobacter heparinus DSM 2366]
          Length = 284

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 112/287 (39%), Positives = 162/287 (56%), Gaps = 14/287 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPD---IDLLKPKDFASFFLSFSPDVIINP 57
           MK LV+G +GQ+ Q L  +  +   I  +  PD    ++L      + F    P  +IN 
Sbjct: 1   MKILVLGASGQLGQCLKKVAAER-NISNISFPDESKANILDTALLQTLFTEEMPTHVINC 59

Query: 58  AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSP 117
           AAYTAVDKAED+ E+   IN +GA  IA          I++STD+VF G     + E   
Sbjct: 60  AAYTAVDKAEDDVELCRKINKDGALNIAGLCKENKATLIHVSTDFVFKGDKPELLKEDDL 119

Query: 118 TNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD 177
             P+NIYG +KL GE+ V +    + ILRT+W+YS + +NF+ +MLRL  +R  ++V+ D
Sbjct: 120 AEPINIYGLTKLEGEQDVINNLKEHFILRTSWLYSEYANNFVKTMLRLGADRDVLNVIAD 179

Query: 178 QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
           Q GTPT A+ +A AI+ I    IE+      G++H + + G  SW DFA  IF    E G
Sbjct: 180 QIGTPTYAIDLAGAILSI----IESGQKDY-GVYHYSNE-GVTSWYDFAVGIF----ELG 229

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           G   KV  I T QYPTKA RP +S +D +K+ +T  + I  W++ ++
Sbjct: 230 GTKIKVKPISTSQYPTKAIRPKFSVMDKTKIKSTFGLEIPYWRDSLQ 276


>gi|226941909|ref|YP_002796983.1| DTDP-4-dehydrorhamnose reductase [Laribacter hongkongensis HLHK9]
 gi|226716836|gb|ACO75974.1| DTDP-4-dehydrorhamnose reductase [Laribacter hongkongensis HLHK9]
          Length = 294

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 105/293 (35%), Positives = 156/293 (53%), Gaps = 10/293 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L+ G NGQ+   L        E++ + R + DL +P        +F P +I+N AA+T
Sbjct: 5   RILLTGANGQVGFELRRALAPLGEVLAITRHEADLQQPSSILPLLDAFRPRLIVNAAAWT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD AE +P+ A+ +NA   G +A+ A       ++ STDYVFDGL+  P DE  P +PL
Sbjct: 65  AVDLAEQQPDAAWQVNAVLPGVLAQWAADRQARLVHYSTDYVFDGLASRPYDETDPAHPL 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG+SK AGEE V       VI+RT+WV+   G NFL ++LRLA ER ++++V DQ G 
Sbjct: 125 SVYGQSKWAGEEAVRVAGGAPVIVRTSWVFGAHGHNFLKTVLRLAAEREQLAIVADQTGA 184

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG---- 237
           PT A  IA     +  +  +   T     +H+ A  G  SW  +A  +   +   G    
Sbjct: 185 PTPASLIADVTAHLVRHWPDEGAT-----YHL-AGQGETSWHGYACEVVRIARALGWSLR 238

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              + +  I T  YP  A RPA S LDC K+     + +  W+ GVR +L ++
Sbjct: 239 ATETAIRPIATSDYPLPAVRPANSRLDCRKIQADLQLWLPDWQSGVRQVLASL 291


>gi|312115796|ref|YP_004013392.1| dTDP-4-dehydrorhamnose reductase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220925|gb|ADP72293.1| dTDP-4-dehydrorhamnose reductase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 299

 Score =  185 bits (470), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 109/281 (38%), Positives = 155/281 (55%), Gaps = 3/281 (1%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRV-GRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
           L+ G +GQ+   L+ +   D   +R   R ++DL   +   ++  +  P  IIN   YT 
Sbjct: 7   LITGGSGQLGLELARLPWPDGLRLRTPDRSELDLSSTESITAYIDACRPLAIINAGGYTQ 66

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VD AE +P  AF +NA G  AIA+AA   G   I+ISTDYVFDG      DE    +PL 
Sbjct: 67  VDGAESDPLTAFCLNAMGPAAIAEAARRHGSRLIHISTDYVFDGSRHGFYDESDAVSPLG 126

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YG SK AGE+ V +     VI+RTAW++S + +NF+ +MLR+ +ER  + +V DQFG P
Sbjct: 127 VYGASKEAGEQAVRAILPGSVIVRTAWLFSPYRTNFVKTMLRIGRERPSVRIVADQFGCP 186

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
           T+A  +ARA+  IA  L+E+   +  G FH   +GG  +W   A   F ++   G     
Sbjct: 187 TAASDLARALQTIAMRLVEDP-AAPTGTFHFV-NGGEATWYALACEAFAQATRYGYTAPA 244

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
           V  I T +YPT A RPA S L  ++L  ++ I    WK  V
Sbjct: 245 VAPISTAEYPTPARRPANSRLSVARLTESYAITPRPWKLAV 285


>gi|107104263|ref|ZP_01368181.1| hypothetical protein PaerPA_01005337 [Pseudomonas aeruginosa PACS2]
 gi|218894262|ref|YP_002443132.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa LESB58]
 gi|218774491|emb|CAW30308.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa LESB58]
          Length = 302

 Score =  185 bits (470), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 107/285 (37%), Positives = 152/285 (53%), Gaps = 7/285 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G NGQ+   L        E++   R   DL  P+  A    +  P  I+N  AYT
Sbjct: 3   RILLLGANGQVGWELQRALAPLGELLVCDRRRADLADPEGLARLVRAERPQFIVNAGAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE + + A  INA     +A+ A   G   ++ STDYVFDG    P  E +PT PL
Sbjct: 63  AVDKAESDADNARLINARAVAVLAEEAAGCGAWLVHYSTDYVFDGAGSVPFAEDAPTGPL 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG++KL GE+ + +    ++I RT+WVY+  G NF  +MLRLA +R E+ VV DQFG 
Sbjct: 123 SVYGQTKLEGEQAIRASGCRHLIFRTSWVYAARGGNFAKTMLRLAGQRDELKVVADQFGA 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLR--GIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PTSA  IA    Q    L  + + + R  G +H+ A  G  SW  +A ++  ++ ERG  
Sbjct: 183 PTSAELIADVTAQALQRLRWDVELAARASGTYHLVAS-GETSWHLYARFVIEQALERGWE 241

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
                 +V  I T+ YP  A RPA S LD  KL     + +  W+
Sbjct: 242 LQATPQRVLPIATEDYPVPAKRPANSRLDNRKLQQVFGLVLPDWR 286


>gi|295110611|emb|CBL24564.1| dTDP-4-dehydrorhamnose reductase [Ruminococcus obeum A2-162]
          Length = 282

 Score =  185 bits (470), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 105/292 (35%), Positives = 154/292 (52%), Gaps = 13/292 (4%)

Query: 1   MKCLVIGNNGQIAQS-LSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G  GQ+    ++ +  +  E + V   ++D+              PD +++ AA
Sbjct: 1   MKVLVTGVKGQLGYDVMNELAKRGYEGVGVDVAEMDITDSAAVEKVMTEVHPDKVVHCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT- 118
           +TAVD AED  E+   +N +G   IAK    + IP +YISTDYVFDG    P +   P  
Sbjct: 61  WTAVDAAEDNQEVCHRVNVDGTANIAKMCGKLDIPMVYISTDYVFDGQGTRPWEPDDPVV 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            PLN+YG SK  GE  V  Y  +Y I+R AWV+ + G NF+ +ML L K    ++VV DQ
Sbjct: 121 EPLNVYGHSKYEGEVAVEKYAPHYYIVRIAWVFGLNGKNFIKTMLNLGKTHDTLTVVDDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT    +AR ++    +++E  +    G +H T +GG +SW DFA+ IF     + G
Sbjct: 181 IGTPTYTYDLARLLV----DMLEKEE---YGKYHATNEGGYISWCDFAKEIF----RQAG 229

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              KV  + + +YP KA RP+ S ++  KL      R+  WK+ +   L  I
Sbjct: 230 MDVKVMPVSSAEYPAKAKRPSNSRMEKKKLEEHGFTRLPDWKDALGRYLKEI 281


>gi|15600355|ref|NP_253849.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa PAO1]
 gi|9951464|gb|AAG08547.1|AE004929_2 dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa PAO1]
 gi|27262964|emb|CAC82200.1| dTDP-4-keto-L-rhamnose reductase [Pseudomonas aeruginosa]
          Length = 302

 Score =  185 bits (470), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 107/285 (37%), Positives = 153/285 (53%), Gaps = 7/285 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G NGQ+   L        E++   R   DL  P+  A    +  P  I+N  AYT
Sbjct: 3   RILLLGANGQVGWELQRALAPLGELLVCDRRRADLADPEGLARLVRAERPQFIVNAGAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE + + A  INA     +A+ A + G   ++ STDYVFDG    P  E +PT PL
Sbjct: 63  AVDKAESDADNARLINARAVAVLAEEAAACGAWLVHYSTDYVFDGAGSVPFAEDAPTGPL 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG++KL GE+ + +    ++I RT+WVY+  G NF  +MLRLA +R E+ VV DQFG 
Sbjct: 123 SVYGQTKLEGEQAIRASGCRHLIFRTSWVYAARGGNFAKTMLRLAGQRDELKVVADQFGA 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLR--GIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PTSA  IA    Q    L  + + + R  G +H+ A  G  SW  +A ++  ++ ERG  
Sbjct: 183 PTSAELIADVTAQALQRLCWDVELAARASGTYHLVAS-GETSWHLYARFVIEQALERGWE 241

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
                 +V  I T+ YP  A RPA S LD  KL     + +  W+
Sbjct: 242 LQATPQRVLPIATEDYPVPAKRPANSRLDNRKLQQVFGLVLPDWR 286


>gi|260220292|emb|CBA27684.1| dTDP-4-dehydrorhamnose reductase [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 301

 Score =  185 bits (470), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 116/305 (38%), Positives = 168/305 (55%), Gaps = 22/305 (7%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLK-PKDFASFFL----------SF 49
           MK L++G  GQ+   L        E++ +   D D  + P+     F           + 
Sbjct: 1   MKILLLGRGGQVGWELQRSLGVLGEVVAL---DFDANQNPQGLCGDFTDIDGLERTVEAV 57

Query: 50  SPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSR 109
            PDVI+N AA+TAVDKAE EPE+A +INA    A+A+AA   G   ++ STDYVFDG   
Sbjct: 58  QPDVIVNAAAHTAVDKAESEPELARTINALAPAALARAAIKTGAWLVHYSTDYVFDGSGN 117

Query: 110 TPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKER 169
            P  E   T PL++YG++KL GE+ VA+    ++ILRT+WVY+  G NF  +MLRLA ER
Sbjct: 118 APWKETDATGPLSVYGQTKLEGEQAVAT-CPKHLILRTSWVYATRGGNFAKTMLRLAGER 176

Query: 170 REISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYI 229
             ++V+ DQFG PTSA  +A        +L   +   L G++H  A  G  +W  +A+++
Sbjct: 177 DALTVINDQFGAPTSAELLADVTAHAIRSL--QTRPELAGLYHCIA-AGETTWHGYAQHV 233

Query: 230 FWESAERGGPY----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRN 285
             ++A  G P      KV    T  YPT A RP  S LD +KL     +++  W++GV+ 
Sbjct: 234 LEQAATLGLPLKATAGKVAPTATSNYPTPAKRPLNSRLDTTKLQAAFGLKLPHWQDGVKR 293

Query: 286 ILVNI 290
           +L+ I
Sbjct: 294 MLIEI 298


>gi|296505691|ref|YP_003667391.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           BMB171]
 gi|296326743|gb|ADH09671.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Bacillus thuringiensis
           BMB171]
          Length = 284

 Score =  185 bits (469), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 108/291 (37%), Positives = 159/291 (54%), Gaps = 13/291 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G NGQ+   +      Q +E+  +G  D+D+        F  +  PD II+ AA
Sbjct: 1   MKILVTGYNGQLGYDVVKRGEKQGLEMQGIGIEDLDITNEAAVYEFVDNVKPDAIIHCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDK+ED+ E+ +++N EG   +A AA  +    +YISTDYVFDG       E    N
Sbjct: 61  YTAVDKSEDDKELCWNVNVEGTKYLATAAKKLNAKFVYISTDYVFDGEGTHAFVETDGPN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+  YG +K  GE+ V S  +N  I+R +WV+ I G+NF+ +MLRL + R E++VV DQ 
Sbjct: 121 PVGYYGLTKYEGEKVVKSLIDNNFIVRISWVFGINGNNFIKTMLRLGETRNELNVVGDQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT    +AR ++ +         T   G +H T + G  SWA+FA+ IF    E  G 
Sbjct: 181 GSPTYTYDLARLLVDMVV-------TEKYGTYHATNE-GFCSWAEFAQEIF----EIAGQ 228

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             KV  I T++YPT+A RP  S +   KL +     +  WK+  ++ +  +
Sbjct: 229 DVKVNSITTEEYPTRAVRPKNSRMSKQKLIDNGFEPLQDWKKATKHYITQL 279


>gi|251780332|ref|ZP_04823252.1| dTDP-4-dehydrorhamnose reductase [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|243084647|gb|EES50537.1| dTDP-4-dehydrorhamnose reductase [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 287

 Score =  185 bits (469), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 154/282 (54%), Gaps = 13/282 (4%)

Query: 4   LVIGNNGQIAQS-LSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
           LV G NGQ+    +  +  +++E I   R ++D+    + + +     P+ +I+ AAYTA
Sbjct: 3   LVTGVNGQLGYDVIKELKKRNIECIGTTRKELDITNYNEVSKYIEELKPECVIHCAAYTA 62

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VDKAEDE EI   +N  G   IAK    I    IYIS+DYVFDG    P +     NPL+
Sbjct: 63  VDKAEDEEEICTKVNVYGTENIAKVCRRINAKMIYISSDYVFDGAGDKPHEIDETPNPLS 122

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YG SK  GE KV SY   Y I+RT+WV+ + GSNF+ +ML+L KE+  ++VVCDQ G+P
Sbjct: 123 VYGSSKYNGELKVKSYLKKYFIVRTSWVFGLNGSNFVKTMLKLGKEKESLNVVCDQIGSP 182

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
           T    +A+ +  +A        +   GI+H T + G  SWA+FA+ I     +      K
Sbjct: 183 TYTADLAKLLCDMAV-------SEKYGIYHAT-NHGFCSWAEFAKEIM----KIANLNCK 230

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           +  I T +Y TKA RP  S L    L +     +S WK  ++
Sbjct: 231 INYISTNEYKTKAIRPLNSRLSKKSLLDNGFNELSIWKSSLK 272


>gi|198282743|ref|YP_002219064.1| dTDP-4-dehydrorhamnose reductase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218665614|ref|YP_002424938.1| dTDP-4-dehydrorhamnose reductase [Acidithiobacillus ferrooxidans
           ATCC 23270]
 gi|198247264|gb|ACH82857.1| dTDP-4-dehydrorhamnose reductase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218517827|gb|ACK78413.1| dTDP-4-dehydrorhamnose reductase [Acidithiobacillus ferrooxidans
           ATCC 23270]
          Length = 289

 Score =  185 bits (469), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 121/292 (41%), Positives = 158/292 (54%), Gaps = 13/292 (4%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G  GQ+   L       VE+  +GRPD+D+L          SF PD IIN AAYT
Sbjct: 3   RVLLLGAQGQVGWELQRSRPASVELRALGRPDLDILDAAQVLGMAESFRPDAIINAAAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE E   A+++N +GA   A AA + G   I++STD+VFDG   TP    +P  PL
Sbjct: 63  AVDRAESESARAYAVNRDGAAHCALAAQACGARLIHLSTDFVFDGAQATPYPPEAPLAPL 122

Query: 122 NIYGKSKLAGEEKV-ASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            +YG SK  GE +V A   +  +ILRTAWVYS  GSNF+ +MLRL  ER  + VV DQ G
Sbjct: 123 GVYGASKADGERQVQAILGDTALILRTAWVYSAHGSNFVKTMLRLMAERDVLRVVGDQIG 182

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPT A  +ARAI     +          GI H T D G  SW DFA  I  E+   G  +
Sbjct: 183 TPTWAAGLARAIWSTLDH------PGFTGIQHWT-DAGVASWYDFAVAIQEEAVAAGRLH 235

Query: 241 SK--VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRIST-WKEGVRNILVN 289
               +  I T  YPT A RPA + LD  K A+   +  +  W+  +R +L  
Sbjct: 236 RAIPIEMIPTSAYPTPARRPACAILD--KTASYTALGAAPHWRTALRRMLTE 285


>gi|15676654|ref|NP_273798.1| putative dTDP-L-rhamnose synthase [Neisseria meningitidis MC58]
 gi|7225985|gb|AAF41169.1| putative dTDP-L-rhamnose synthase [Neisseria meningitidis MC58]
          Length = 306

 Score =  185 bits (469), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 168/286 (58%), Gaps = 8/286 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+       +   SF PD I+N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRLPEDWETIATDSASLDITDADAVCNMVKSFQPDAIVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   AF++NA     +A AA       I+ISTDYVFDG  + P  E   TNP
Sbjct: 61  TAVDKAEGDAAAAFAVNASAVYNLALAAHRAHARFIHISTDYVFDGKGKRPYQESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            N+YG+SK AGE    S   + +ILRT+W++S +G NF+ +ML LA+ER  +S V +Q G
Sbjct: 121 SNVYGQSKTAGELLALSANPDSLILRTSWLFSEYGDNFIRTMLNLARERSPLSAVHNQIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  ++  II+    L+++S+  +RGI+H  A    VSW +FA++IF  ++++    
Sbjct: 181 CPTYAGDLSATIIR----LLQHSN-PVRGIYHY-AGSKSVSWYEFAQHIFQAASQQQTSF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           P  ++  +  K+YPT A RPAYS LDC K+ N   I+ S W++ + 
Sbjct: 235 PVPELTAVSDKEYPTAAPRPAYSILDCRKIENDFGIKPSDWQKALH 280


>gi|255068240|ref|ZP_05320095.1| dTDP-4-dehydrorhamnose reductase [Neisseria sicca ATCC 29256]
 gi|255047510|gb|EET42974.1| dTDP-4-dehydrorhamnose reductase [Neisseria sicca ATCC 29256]
          Length = 288

 Score =  185 bits (469), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 171/289 (59%), Gaps = 8/289 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+ GQ+A+       ++ E+I      +D+   +   +   +F PD I+N AA+
Sbjct: 1   MRTLLTGSKGQLARCFRDRLPENWELIATDSTSLDITDTEAVRNMVQNFQPDAIVNAAAF 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE     AF++NA     +A AA +     I+ISTDYVFDG ++TP  E   TNP
Sbjct: 61  TAVDKAEAHVGTAFAVNATAVHNLASAARACQARFIHISTDYVFDGTNKTPYKEQDYTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YG++K++GE    +   + VI+RT+W++S +G+NF+ +M+RLA ER  +S+V DQ G
Sbjct: 121 QSVYGRTKVSGELLALAANPDSVIIRTSWLFSEYGNNFVKTMIRLAGERDNLSIVHDQTG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT A  +A+AII +    +     + RGI+H   +   V+W +FA+ IF  + ++   +
Sbjct: 181 SPTYAGDLAQAIITLLQQPV-----APRGIYHYGGNKS-VTWYEFAQAIFQAAQQQDPDF 234

Query: 241 S--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              ++  I T QYP  A RPAYS +DC K+     I+ S W++ +  I+
Sbjct: 235 KIPQLNAITTDQYPLPAPRPAYSIMDCQKIEKECGIKASDWQKALNEII 283


>gi|168481428|gb|ACA24907.1| RmlD [Shigella dysenteriae]
          Length = 299

 Score =  185 bits (469), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 163/296 (55%), Gaps = 15/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EP+ A  +NA    AIAKAA+ +    I+ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPKFAQLLNATSVEAIAKAANEVSAWVIHYSTDYVFPGTGEIPWQEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE+ +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V+ 
Sbjct: 121 ATAPLNVYGETKLAGEKALQEHCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN 180

Query: 177 DQFGTPTSALQIARAI---IQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           DQFG PT A  +A      I++A N  E     + G++H+ A  G  +W ++A  IF E+
Sbjct: 181 DQFGAPTGAELLADCTAHAIRVALNKPE-----VAGLYHLVAS-GTTTWYEYASLIFSEA 234

Query: 234 AERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G   +  K+  I T  YPT A RP  S L+  K     ++ +  W  GV+ ++
Sbjct: 235 RKAGIQLAIKKLNAIPTTCYPTPALRPLNSRLNTEKFQQCFDLTLPMWNIGVKRMI 290


>gi|148265298|ref|YP_001232004.1| dTDP-4-dehydrorhamnose reductase [Geobacter uraniireducens Rf4]
 gi|146398798|gb|ABQ27431.1| dTDP-4-dehydrorhamnose reductase [Geobacter uraniireducens Rf4]
          Length = 276

 Score =  185 bits (469), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 109/284 (38%), Positives = 153/284 (53%), Gaps = 15/284 (5%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV+G  G + Q L  M +   E   V   DID+   +      ++  P V+IN AAYT V
Sbjct: 3   LVVGAKGMLGQDL--MTLLGTEARGVDIEDIDITSMESVQKVLVTLKPRVVINAAAYTDV 60

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D  E   E+A  +N EG   +A  +  IG   + ISTDYVFDG   +P  E  P  PL++
Sbjct: 61  DGCESNQELAMQVNGEGVAHLALISKEIGAKLVQISTDYVFDGGKGSPYLEDDPPRPLSV 120

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKLAGE   A +  +++I+RT W+Y + G NF+ +MLRLA E++E+SVV DQ G+PT
Sbjct: 121 YGESKLAGEMN-ACFNPDHLIVRTQWLYGLHGKNFVETMLRLAAEKKELSVVDDQIGSPT 179

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKV 243
             + ++ AI  +        D    G +H  A+GG  SW +FA  IF E+    G    V
Sbjct: 180 WTVDLSLAIKALI-------DKGCCGTYH-AANGGFCSWNEFARVIFAEA----GMGITV 227

Query: 244 YRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             + T +    A RP YS LDC KL      +   W+E ++N L
Sbjct: 228 NPMSTAELGRPAPRPLYSTLDCGKLNRDAGFQPQPWQEALKNYL 271


>gi|254238138|ref|ZP_04931461.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa C3719]
 gi|126170069|gb|EAZ55580.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas aeruginosa C3719]
          Length = 302

 Score =  185 bits (469), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 154/285 (54%), Gaps = 7/285 (2%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + L++G NGQ+   L        E++   R   DL  P+  A    +  P  I+N  AYT
Sbjct: 3   RILLLGANGQVGWELQRALAPLGELLVCDRRRADLADPEGLARLVRAERPQFIVNAGAYT 62

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE + + A  INA     +A+ A + G   ++ STDYVFDG    P  E +PT PL
Sbjct: 63  AVDKAESDADNARLINARAVAVLAEEAAACGAWLVHYSTDYVFDGAGSVPFAEDAPTGPL 122

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG++KL GE+ + +    ++I R++WVY+  G NF  +MLRLA +R E+ VV DQFG 
Sbjct: 123 SVYGQTKLEGEQAIRASGCRHLIFRSSWVYAARGGNFAKTMLRLAGQRDELKVVADQFGA 182

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLR--GIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           PTSA  IA    Q    L  +++ + R  G +H+ A  G  SW  +A ++  ++ ERG  
Sbjct: 183 PTSAELIADVTAQALQRLRWDAELAARASGTYHLVAS-GETSWHLYARFVIEQALERGWE 241

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
                 +V  I T+ YP  A RPA S LD  KL     + +  W+
Sbjct: 242 LQATPQRVLPIATEDYPVPAKRPANSRLDNRKLQQVFGLVLPDWR 286


>gi|126662750|ref|ZP_01733749.1| dTDP-4-dehydrorhamnose reductase [Flavobacteria bacterium BAL38]
 gi|126626129|gb|EAZ96818.1| dTDP-4-dehydrorhamnose reductase [Flavobacteria bacterium BAL38]
          Length = 315

 Score =  184 bits (468), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 121/317 (38%), Positives = 171/317 (53%), Gaps = 35/317 (11%)

Query: 1   MKCLVIGNNGQIAQSLSSMC------------VQDVEIIRVGRPDIDLLKPKDFASFFLS 48
           M  LV G NGQ+ Q++ S+              Q ++ +     ++D+   ++  + F +
Sbjct: 1   MVVLVTGANGQLGQAIQSISGKYPDSSQYSEQAQQIDFVFCSSSELDITNLENCQTVFST 60

Query: 49  FSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFD--- 105
           + P   IN AAYTAVDKAE EP  AF+INA GA  +A  +       I+ISTD+VFD   
Sbjct: 61  YQPHFCINAAAYTAVDKAESEPANAFNINANGAENLAITSKKHNTILIHISTDFVFDAYF 120

Query: 106 --GLS------RTPID------EFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVY 151
             G++      R P+       E     P  IYG +KL GE+ + +    + I+RT+WVY
Sbjct: 121 LDGIAYYDREFRLPLKSNLGLLETDVPFPSGIYGLTKLQGEQAIQATWEKHFIIRTSWVY 180

Query: 152 SIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGI 210
           S F +NFL +MLRLAKER  ISVV DQ GTPT+A+ +A  +I+I  +   E    S  GI
Sbjct: 181 SQFRNNFLKTMLRLAKERDTISVVNDQIGTPTNAVDLAEVLIKIIESCHAELVSASNYGI 240

Query: 211 FHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLAN 270
           ++ + + G  SW DFA+ IF     +      +  I T  YPT A RPA+S LD SK+ N
Sbjct: 241 YNFSNE-GVCSWYDFAKEIF----NQNKISITLNPIPTTAYPTPAKRPAFSVLDKSKIKN 295

Query: 271 THNIRISTWKEGVRNIL 287
              I I TW+E + + L
Sbjct: 296 IFGIEIKTWEESLSSCL 312


>gi|295397280|ref|ZP_06807375.1| dTDP-4-dehydrorhamnose reductase [Aerococcus viridans ATCC 11563]
 gi|294974486|gb|EFG50218.1| dTDP-4-dehydrorhamnose reductase [Aerococcus viridans ATCC 11563]
          Length = 279

 Score =  184 bits (468), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 112/285 (39%), Positives = 152/285 (53%), Gaps = 13/285 (4%)

Query: 1   MKCLVIGNNGQIAQS-LSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G NGQ+    +  +  + +E +   R  +D+    D       +SPDVI++ AA
Sbjct: 1   MKVLVTGANGQLGYDVIKRLEEKKIEYLGTDRDTLDITNEDDVKRVIKDYSPDVIVHCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAEDE E+  ++N  G   I +A   I    IYISTDYVFDG    P +     N
Sbjct: 61  YTAVDKAEDERELCHAVNVLGTRYIVEACKEIDAKMIYISTDYVFDGEGDKPFEVTDTPN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+N YG++K  GE +V    + Y I+R +WV+   G+NF+ +MLRL KE  EISVV DQ 
Sbjct: 121 PINYYGQTKYEGELEVQKLVDKYFIVRISWVFGSNGNNFVKTMLRLGKEIDEISVVADQV 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT    +A         L+E  +T   GI+H T + G  SW +FA  IF     + G 
Sbjct: 181 GSPTYTYDLAGL-------LLEMIETDKYGIYHATNE-GYCSWYEFACEIF----NQAGM 228

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
             KV  I T+ YPT+A RP  S L    L   +    + W E +R
Sbjct: 229 DVKVNPIKTEDYPTRAKRPKNSRLAKEDLVRNNLKARNEWYEALR 273


>gi|313673141|ref|YP_004051252.1| dtdp-4-dehydrorhamnose reductase [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939897|gb|ADR19089.1| dTDP-4-dehydrorhamnose reductase [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 298

 Score =  184 bits (468), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 115/299 (38%), Positives = 167/299 (55%), Gaps = 23/299 (7%)

Query: 5   VIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVD 64
           +IG  G +   LS +   +         +I +   +    F    S   I+N AAYTAVD
Sbjct: 4   IIGARGMLGTELSEILKSNSVPFIATDKEISITDYESLGQFVRDRSIKFIVNCAAYTAVD 63

Query: 65  KAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLS------RTPIDEFSPT 118
           KAEDE ++  +INA+G   IAK A  IG   I+ISTDYVF G S        P  E  PT
Sbjct: 64  KAEDEVDLCTTINADGVENIAKVAKQIGATVIHISTDYVFSGESIIENGKPRPYLEDDPT 123

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           +P +IYGKSKL GE+++ S     +I+RT+W+Y   G+NF+ +M RL +E++EI+VV DQ
Sbjct: 124 SPTSIYGKSKLEGEKRLLSIVPESIIIRTSWLYGEHGNNFVYTMFRLMREKKEIAVVSDQ 183

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
           +G+PT    +ARAI+Q+  NL +N  +   GI+H + + G +SW DFA  I+     R G
Sbjct: 184 YGSPTWTYDLARAILQMI-NLSKNKLSF--GIYHYSNE-GEISWYDFAVEIY-----RLG 234

Query: 239 PYSKVYR-------IFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              ++ +       I T+ YPTKA RP YS L   K+     + +  WK+ +R+ +  I
Sbjct: 235 REYEILKEDCNIKPIKTEDYPTKAMRPKYSVLSKEKIKRL-GVEVPFWKDSLRSFISGI 292


>gi|308071019|ref|YP_003872624.1| spore coat polysaccharide biosynthesis protein spsK [Paenibacillus
           polymyxa E681]
 gi|305860298|gb|ADM72086.1| Spore coat polysaccharide biosynthesis protein spsK [Paenibacillus
           polymyxa E681]
          Length = 290

 Score =  184 bits (468), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 165/290 (56%), Gaps = 11/290 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G +GQ+ + +  +   Q  +++   R  +D+   +        + PD +I+ AA
Sbjct: 1   MKVLVTGASGQLGKDVVKVFQEQGHDVLGYDREQLDITDLQQTVKIVGQYQPDAVIHCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVD AE + + A+ +NA G   +A A + +G   +YISTDYVFDG ++ P  E+  TN
Sbjct: 61  YTAVDAAETDVDGAYQVNAAGTRNMALATEKVGAKLVYISTDYVFDGTAKEPYHEYDNTN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P +IYGKSK AGE    + ++ Y I+RT+WVY ++G+NF+ +ML+L +E+  + VV DQ 
Sbjct: 121 PQSIYGKSKRAGEVLTQTLSSRYFIVRTSWVYGLYGNNFVKTMLKLGQEKPLLQVVNDQK 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE--RG 237
           G+PT  + +AR + ++         T   GI+H  ++GG  +W +F + I  ++AE    
Sbjct: 181 GSPTYTVDLARFLAELIQ-------TEKYGIYH-ASNGGSCTWYEFTQAILQDAAEILDA 232

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              +K+    T+Q+P  A RP  S ++   +       +  W+EG+R+ L
Sbjct: 233 KITAKLEPCSTEQFPRPAARPRNSVMEHIAIRTNGLNDLRDWREGLRDFL 282


>gi|228996411|ref|ZP_04156053.1| DTDP-4-dehydrorhamnose reductase [Bacillus mycoides Rock3-17]
 gi|228763374|gb|EEM12279.1| DTDP-4-dehydrorhamnose reductase [Bacillus mycoides Rock3-17]
          Length = 280

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 106/291 (36%), Positives = 166/291 (57%), Gaps = 17/291 (5%)

Query: 1   MKCLVIGNNGQIAQS-LSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G  GQ+ +  ++    ++  + R  R ++D+       S   + +PD++++ AA
Sbjct: 1   MKVLVTGAGGQLGKEFVAYFAEKECTVYRFTRKELDITDATSVLSTIKNLNPDLVLHCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VD AE++ + A+++NA G   IA A+++IG   +Y STDYVFDG+      EF  TN
Sbjct: 61  YTKVDAAEEKWKEAYAVNALGTRNIAVASEAIGAKLVYFSTDYVFDGMQTRDYHEFDQTN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PLN+YG SKLAGEE V ++ + Y I+RT+W+Y   G NF+ +M  LA+ ++E+ VVCDQ 
Sbjct: 121 PLNVYGASKLAGEEAVKNFHSRYFIMRTSWLYGGEGPNFVRTMQMLAQTKKELRVVCDQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PT      + ++     +I+   T+  G +H++ + G  SW +FA  IF E       
Sbjct: 181 GCPT----YTKDLVCKTGEMIQ---TNQYGTYHVS-NQGECSWFEFATRIFQEMEAD--- 229

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLD--CSKLANTHNIRISTWKEGVRNILV 288
             KV  + T++Y  KA RP YS L   C +L     +R   W+E +R  ++
Sbjct: 230 -VKVIPVKTEEYGAKAERPRYSVLQHLCLELNGFAPMR--QWEEALREYVI 277


>gi|229008637|ref|ZP_04166049.1| DTDP-4-dehydrorhamnose reductase [Bacillus mycoides Rock1-4]
 gi|228752642|gb|EEM02258.1| DTDP-4-dehydrorhamnose reductase [Bacillus mycoides Rock1-4]
          Length = 280

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 108/293 (36%), Positives = 165/293 (56%), Gaps = 17/293 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEII-RVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G  GQ+ +   +   +  + +    R ++D+       S   + +PD++++ AA
Sbjct: 1   MKVLVTGAGGQLGKEFVAYFTEKGDTLYSFTRNELDITDATSVFSTIKNLNPDLVLHCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VD AE+  + A+++NA G   IA A+++IG   +Y STDYVFDG+      EF  TN
Sbjct: 61  YTKVDAAEENWKEAYAVNALGTRNIAVASEAIGAKLVYFSTDYVFDGMQMRDYHEFDQTN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PLN+YG SKLAGEE V S+ + Y I+RT+W+Y   G NF+ +M  LA+ ++E+ VVCDQ 
Sbjct: 121 PLNVYGASKLAGEEAVKSFHSRYFIMRTSWLYGGEGPNFVRTMQTLAQTKKELRVVCDQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PT      + ++     +I+   T+  G +H++ + G  SW +FA  IF E     G 
Sbjct: 181 GCPT----YTKDLVCKTGEMIQ---TNQYGTYHVS-NRGECSWFEFATRIFQEM----GA 228

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLD--CSKLANTHNIRISTWKEGVRNILVNI 290
             KV  + T++Y  KA RP YS L   C +L     +R   W+E +R  ++ I
Sbjct: 229 DVKVIPVKTEEYGVKAERPRYSVLQHLCLELNGFAPMR--QWEEALREYIIEI 279


>gi|9957826|gb|AAG09507.1|AF279617_2 dTDP-6-deoxy-L-mannose-dehydrogenase [Salmonella enterica]
          Length = 299

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 109/296 (36%), Positives = 160/296 (54%), Gaps = 9/296 (3%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L  S   V ++  + V   +   D   PK          PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVVETVRKLRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A  +NA    AIAKAA+  G   ++ STDYVF G    P  E  
Sbjct: 61  AAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T+PLN+YGK+KL GE+ +      ++I RT+WVY+  G+NF  +MLRLAKER+ +SV+ 
Sbjct: 121 ITSPLNVYGKTKLTGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A           +  + +  G++H+ A GG  +W D+A  +F E+ + 
Sbjct: 181 DQYGAPTGAELLADCTAHAIRMAFKKPEVA--GLYHLVA-GGTTTWYDYAALVFDEARKA 237

Query: 237 G--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +++  + T  Y T A RP  S L+  K      + +  W+ GV+ +L  +
Sbjct: 238 GITLALTELKAVPTSAYQTLASRPGNSRLNTEKFQRNFGLILPQWELGVKRMLTEM 293


>gi|253563372|ref|ZP_04840829.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|251947148|gb|EES87430.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
          Length = 287

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 163/289 (56%), Gaps = 12/289 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVE--IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M  LV G NGQ+   +  +  ++++         ++D+   +   ++      D+I+N A
Sbjct: 1   MNILVTGANGQLGNEMQVLARENLQHTYFFTDVQELDICDEQAVYAYVSEHKIDIIVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED  E+   +N    G +A+AA + G   I +STDYVFDG +  P  E  PT
Sbjct: 61  AYTAVDKAEDNVELCDKLNNIAPGYLARAAQANGAAMIQVSTDYVFDGTAHIPYTEEEPT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG +KLAGE+ V  +    +++RTAW+YSI+G+NF+ +M+RL +ER  + V+ DQ
Sbjct: 121 CPASVYGSTKLAGEQNVMDHCEKAMVIRTAWLYSIYGNNFVKTMIRLGQERDSLGVIFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +A+AI    +  +      +RGI+H + D G  SW DF   I   +   G 
Sbjct: 181 IGTPTYANDLAQAIFAAINKGV------VRGIYHFS-DEGVCSWYDFTVAIHRLA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              KV  + T  YP KA RP YS LD +K+ +T  I I  W+E ++  +
Sbjct: 231 ASCKVKPLHTADYPAKAPRPHYSVLDKTKIKDTFGIEIPHWEESLKRCI 279


>gi|189424718|ref|YP_001951895.1| dTDP-4-dehydrorhamnose reductase [Geobacter lovleyi SZ]
 gi|189420977|gb|ACD95375.1| dTDP-4-dehydrorhamnose reductase [Geobacter lovleyi SZ]
          Length = 277

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 107/284 (37%), Positives = 149/284 (52%), Gaps = 15/284 (5%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV+G NG + Q L  +  +    + +  PDID+           +  P V+IN AAYT V
Sbjct: 3   LVVGANGMLGQDLMGLLGERGRGVDL--PDIDITDMVSVQQVLTALKPKVVINCAAYTDV 60

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D  E   E A  +N EG   +A     IG   + +STDYVFDG   +P  E     PLNI
Sbjct: 61  DGCESNTETAMQVNGEGVAFLALVTREIGAKLVQVSTDYVFDGSKGSPYREDDLQQPLNI 120

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKLAGE  V    +N +++RT W+Y + G NF+ +ML+L +E+  ++VV DQ G+PT
Sbjct: 121 YGESKLAGELNVDINPDN-LLVRTQWLYGLHGKNFVETMLKLGQEKSVLTVVDDQIGSPT 179

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKV 243
             + +AR II +        D   RG +H  A+ G  SW  FA+ IF E+    G   +V
Sbjct: 180 WTMDLARGIIALV-------DKDCRGTYH-CANSGHTSWNGFAKAIFDEA----GLPVQV 227

Query: 244 YRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             + T+Q    A RP YS LDCSKL          W+E ++  L
Sbjct: 228 LPMTTEQLNRPARRPLYSTLDCSKLVADTGFEPQAWREALKQYL 271


>gi|323960873|gb|EGB56493.1| RmlD substrate binding domain-containing protein [Escherichia coli
           H489]
          Length = 295

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 115/299 (38%), Positives = 160/299 (53%), Gaps = 16/299 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDF------ASFFLSFSPDVI 54
           M  L+ G NGQ+   L         I  V     D     DF      A       PDVI
Sbjct: 1   MHILLFGKNGQVGWELQRALAPLGHITAVDFDSTDYCG--DFSNSAGVAETVRLVKPDVI 58

Query: 55  INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDE 114
           +N AA+TAVDKAE E E A  +NA     IAK A+++G   ++ STDYVFDG    P  E
Sbjct: 59  VNAAAHTAVDKAESEREFAELLNATSVAVIAKEAEALGAWLVHYSTDYVFDGSGERPWVE 118

Query: 115 FSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISV 174
               +PLN+YG++KLAGE   A+  + ++I RT+WVY+  G+NF  +MLRL KERREISV
Sbjct: 119 TDVISPLNVYGETKLAGEHG-AALCSRHLIFRTSWVYAARGANFAKTMLRLGKERREISV 177

Query: 175 VCDQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           + DQFG PT A  +A      AH + +  S   + G++H+ A  G  +W D+A  +F ++
Sbjct: 178 INDQFGAPTGAELLADC---TAHAIRVAQSKPDVAGLYHLAAS-GTTTWFDYARLVFDKA 233

Query: 234 AERGGPY--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            + G     +++  + T  +PT A RP  S LD  K   T ++ +  W  GV  +L  I
Sbjct: 234 RDAGVELAVTQLNAVPTGAFPTPAKRPHNSRLDTKKFQRTFDLVLPDWSVGVERMLTEI 292


>gi|148360589|ref|YP_001251796.1| dTDP-6-deoxy-L-mannose dehydrogenase RmlD [Legionella pneumophila
           str. Corby]
 gi|296106345|ref|YP_003618045.1| dTDP-6-deoxy-L-mannose dehydrogenase RmlD [Legionella pneumophila
           2300/99 Alcoy]
 gi|148282362|gb|ABQ56450.1| dTDP-6-deoxy-L-mannose dehydrogenase RmlD [Legionella pneumophila
           str. Corby]
 gi|295648246|gb|ADG24093.1| dTDP-6-deoxy-L-mannose dehydrogenase RmlD [Legionella pneumophila
           2300/99 Alcoy]
          Length = 294

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 104/290 (35%), Positives = 159/290 (54%), Gaps = 5/290 (1%)

Query: 1   MKCLVIGNNGQIA-QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G NGQ+  + +      + E+    R  +D  K +      L   PD+IIN AA
Sbjct: 1   MKILVTGANGQVGTEIIKRFSSSEHEVYACTRDILDCSKLERVHDVLLEIKPDLIINAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAEDEP++A  +NAE    +        IP I++STDYVFDG       E    +
Sbjct: 61  YTAVDKAEDEPDLAHIVNAEFVCHLVNYCSLKNIPLIHLSTDYVFDGEKEGAYHETDIPH 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P++ YG++K  GE+ + S    Y+ILR +WV+   G NF+ ++L LA  R+E+++V DQ+
Sbjct: 121 PVSTYGRTKWEGEQAILSQLKKYIILRVSWVFGEQGKNFVKTILNLASSRKELNIVSDQW 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG-- 237
           G PTSA  IAR + +I    I +S     G++H  A  G  +W +FA      + E+   
Sbjct: 181 GRPTSARDIARVLFEIVQK-IRHSSFDYWGLYHY-AGQGVTNWHEFANVFLNMAKEKQLL 238

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              + +  I +++YPT+A RP  S LD +K+     I+  +WK  + +++
Sbjct: 239 LTLTDLNPIKSEEYPTRATRPKNSVLDTTKIETILGIKSCSWKNDLPDVI 288


>gi|134297306|ref|YP_001121041.1| dTDP-4-dehydrorhamnose reductase [Burkholderia vietnamiensis G4]
 gi|134140463|gb|ABO56206.1| dTDP-4-dehydrorhamnose reductase [Burkholderia vietnamiensis G4]
          Length = 320

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 162/320 (50%), Gaps = 38/320 (11%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASF---------------- 45
           + L++G NGQ+   L         +I +   D D L P+  A                  
Sbjct: 7   RILLLGKNGQVGWELQRSLAPLGPVIAL---DRDGLTPQQAAQLPAWQGQPLLDHPLCGD 63

Query: 46  ----------FLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPC 95
                       +  P +I+N AAYTAVD+AE E  +A  +NAE  G +A+AA  +G   
Sbjct: 64  LSDLEGLRRTVYALRPQIIVNAAAYTAVDRAESEVGLAHRLNAEAPGVLAQAAHEVGAWL 123

Query: 96  IYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFG 155
           ++ STDYVF+G   TP  E   T PLN YG +KL GE+++      ++I RT+WVY+  G
Sbjct: 124 VHYSTDYVFNGSGHTPWQEGDATGPLNAYGLTKLEGEQRILQAGRQHLIFRTSWVYAARG 183

Query: 156 SNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTA 215
            NF  +MLRLA+ER  ++V+ DQFG PT A  IA         ++   +   +G +H+ A
Sbjct: 184 GNFAKTMLRLARERERLTVIDDQFGAPTGAELIADVTAHALRQVLHTGEG--QGTYHLAA 241

Query: 216 DGGPVSWADFAEYIFWESAERGGPYS--KVYRI---FTKQYPTKAHRPAYSCLDCSKLAN 270
             G  +W  +A+++  E A +  P+   KV  I    T+ +PT A RP  S L+ S L +
Sbjct: 242 S-GETTWHRYAQFVI-EQARQLQPHGSWKVQAIDPVPTQTFPTPARRPHNSRLNTSLLKS 299

Query: 271 THNIRISTWKEGVRNILVNI 290
           T  + + TW+ GV  +L  I
Sbjct: 300 TFGLHLPTWQRGVDRMLQEI 319


>gi|82701399|ref|YP_410965.1| dTDP-4-dehydrorhamnose reductase [Nitrosospira multiformis ATCC
           25196]
 gi|82409464|gb|ABB73573.1| dTDP-4-dehydrorhamnose reductase [Nitrosospira multiformis ATCC
           25196]
          Length = 300

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 107/298 (35%), Positives = 163/298 (54%), Gaps = 11/298 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRV--GRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           MK L+ G +GQ+   L        EI+ +  G  +   D  +    A    +  PDVI+N
Sbjct: 1   MKILLFGKDGQVGWELQRSLAPLGEIVALDFGSQEYCGDFTRCDGIADTVRTVVPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AAYTAVDKAE EPE    INA     +A+ A  +G   ++ STDYVFDG    P  E  
Sbjct: 61  AAAYTAVDKAESEPERVRIINALAPAILAREAGKLGAWLVHYSTDYVFDGGGSAPRVETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           P  PLN+YG +KL GE+ + +   N++I RT+WV++  GSNF  +MLRLA++R  ++V+ 
Sbjct: 121 PPAPLNMYGITKLEGEQAILTADCNHLIFRTSWVFAARGSNFAKTMLRLAQQRDSLNVID 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G PT A  +A     +    I     ++ G++H+ A  G  SW  +A ++   + +R
Sbjct: 181 DQVGAPTGAELLADITAHVIR--ISRQRQNISGLYHLAA-AGETSWYGYANFVLNFARQR 237

Query: 237 GGPYS----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G   +     V+ I + ++P+ A RP  S LD +KL +T ++ + +W+ GV  +L  I
Sbjct: 238 GVKLTAAPENVFPIASNEFPSAARRPKNSRLDTAKLQSTFDLSLPSWETGVARMLTEI 295


>gi|53712602|ref|YP_098594.1| putative dTDP-4-dehydrorhamnose reductase [Bacteroides fragilis
           YCH46]
 gi|60680814|ref|YP_210958.1| putative dTDP-dehydrorhamnose reductase [Bacteroides fragilis NCTC
           9343]
 gi|265762742|ref|ZP_06091310.1| dTDP-4-dehydrorhamnose reductase [Bacteroides sp. 2_1_16]
 gi|52215467|dbj|BAD48060.1| putative dTDP-4-dehydrorhamnose reductase [Bacteroides fragilis
           YCH46]
 gi|60492248|emb|CAH07013.1| putative dTDP-dehydrorhamnose reductase [Bacteroides fragilis NCTC
           9343]
 gi|263255350|gb|EEZ26696.1| dTDP-4-dehydrorhamnose reductase [Bacteroides sp. 2_1_16]
 gi|301162311|emb|CBW21856.1| putative dTDP-dehydrorhamnose reductase [Bacteroides fragilis 638R]
          Length = 287

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 163/289 (56%), Gaps = 12/289 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVE--IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M  LV G NGQ+   +  +  ++++         ++D+   +   ++      D+I+N A
Sbjct: 1   MNILVTGANGQLGNEMQVLARENLQHTYFFTDVQELDICDEQAVYAYVSEHKIDIIVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED  E+   +N    G +A+AA + G   I +STDYVFDG +  P  E  PT
Sbjct: 61  AYTAVDKAEDNVELCDKLNNIAPGYLARAAQANGAAMIQVSTDYVFDGTAHIPYTEEEPT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG +KLAGE+ V  +    +++RTAW+YSI+G+NF+ +M+RL +ER  + V+ DQ
Sbjct: 121 CPASVYGSTKLAGEQNVMDHCEKAMVIRTAWLYSIYGNNFVKTMIRLGQERDSLGVIFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +A+AI    +  +      +RGI+H + D G  SW DF   I   +   G 
Sbjct: 181 IGTPTYANDLAQAIFAAINKGV------VRGIYHFS-DEGVCSWYDFTIAIHRLA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              KV  + T  YP KA RP YS LD +K+ +T  I I  W+E ++  +
Sbjct: 231 ASCKVKPLHTADYPAKAPRPHYSVLDKTKIKDTFGIEIPHWEESLKRCI 279


>gi|134300867|ref|YP_001114363.1| dTDP-4-dehydrorhamnose reductase [Desulfotomaculum reducens MI-1]
 gi|134053567|gb|ABO51538.1| dTDP-4-dehydrorhamnose reductase [Desulfotomaculum reducens MI-1]
          Length = 283

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 163/288 (56%), Gaps = 13/288 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G  GQ+   +    ++  + ++ +G  +++++  +  + +    +PD II+ AA
Sbjct: 1   MKILVTGYTGQLGYDVVQRGLKVGLSLVGLGSENLNIINGETVSHYVKELNPDAIIHCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAED+    +++N EG   +AKAA  I    +YISTDYVF+G   +P  E   T 
Sbjct: 61  YTAVDKAEDDKSTCWNVNVEGTKNLAKAAKDIDAKFMYISTDYVFNGEGDSPFKETDETR 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+  YG +K  GEE V      + I+R +WV+ I G+NF+ ++LRLA+ R+EI+VV DQ 
Sbjct: 121 PIGYYGVTKYQGEEIVKQLLERWFIVRVSWVFGINGNNFVKTILRLAETRKEINVVGDQL 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT    +A+ +I +         T   GI+H + + G  SWA+FA+ I+ ++ +    
Sbjct: 181 GSPTYTFDLAKLLIDMIQ-------TDKYGIYHASNE-GFCSWAEFAKEIYRQANKD--- 229

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             KV  I T++YPT+A RP  S +   KL +     + TW+  V   L
Sbjct: 230 -VKVNSISTEEYPTRAIRPKNSRMSKQKLRDNGFSLLPTWQNAVERYL 276


>gi|33594890|ref|NP_882533.1| dTDP-4-dehydrorhamnose reductase [Bordetella parapertussis 12822]
 gi|33564966|emb|CAE39913.1| dTDP-4-dehydrorhamnose reductase [Bordetella parapertussis]
          Length = 318

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 109/286 (38%), Positives = 155/286 (54%), Gaps = 11/286 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M  L++G  GQI  +L +  +    +  + R   DL      A+   +++P ++IN AAY
Sbjct: 21  MNILLLGRTGQIGDALLAHPLAWARLAALERRQADLRDLGRLAAVLDAYAPRILINAAAY 80

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD+AE EPE+A  INA+    +A  A       ++ STDYVFDG       E    +P
Sbjct: 81  TEVDRAEAEPELALRINAQAVAVMADYARRNNALLVHYSTDYVFDGKRARAYRETDAAHP 140

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           LN YG+SKLAGE+ +A+    ++ILRT+WVY+  G+NF+ ++LRLA+ R E+SVV DQ G
Sbjct: 141 LNAYGRSKLAGEQAIAASGCPHLILRTSWVYASHGANFVKTILRLARTRAELSVVADQHG 200

Query: 181 TPTSALQIARAIIQI--AHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            PT A +IA    Q   AH      D    G++H++A GG VSW   A +I   +   G 
Sbjct: 201 APTWAGRIAAVTWQAIDAHRRRRLPD----GLWHLSA-GGHVSWHGLACHIVARARRAGL 255

Query: 239 PYS----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
             S     +  + T QYP  A RPA S LDC  L +     +  W+
Sbjct: 256 ALSLDPAHIRPVTTAQYPLPAPRPANSRLDCGALRDALEPELPDWQ 301


>gi|298372398|ref|ZP_06982388.1| dTDP-4-dehydrorhamnose reductase [Bacteroidetes oral taxon 274 str.
           F0058]
 gi|298275302|gb|EFI16853.1| dTDP-4-dehydrorhamnose reductase [Bacteroidetes oral taxon 274 str.
           F0058]
          Length = 287

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 167/294 (56%), Gaps = 14/294 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKD---FASFFLSFSPDVIINP 57
           M  L+ G+ GQ+   + ++  +          D+D L   D    + FF +   D+++N 
Sbjct: 1   MNILITGSYGQLGSEIRTLYTKKAGEHHFIFTDVDTLDICDETAVSDFFAAHKIDLVVNC 60

Query: 58  AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSP 117
           AAYTAVDKAE + +    IN+     +  AA   G   I+ISTDYVFDG +  P  E   
Sbjct: 61  AAYTAVDKAESDTDKCRQINSLSVRNLMSAAKRHGARIIHISTDYVFDGTAHKPYVETDR 120

Query: 118 TNPLNIYGKSKLAGEEKVA-SYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
             P ++YG +K  GE  +  +Y ++ +I+RT+W+YS FG+NF+ +MLRL KER+E+SVV 
Sbjct: 121 IAPQSVYGSTKAEGEAVLLDNYADDSIIVRTSWLYSTFGNNFVKTMLRLGKERKELSVVF 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G+PT+A  +A AI+ I       SD    G++H + + G  SW DFA+ IF    E 
Sbjct: 181 DQVGSPTNAADLAEAILSIV-----CSDRFESGVYHYSNE-GVCSWYDFAKAIF----EL 230

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                +V  I + QYPT A RP YS L+ +K+ + + I+I  W++ ++ ++ +I
Sbjct: 231 AHIDCRVLPIESSQYPTPAKRPHYSVLNKAKIKSVYGIQIPYWRDSLQRVISSI 284


>gi|302671937|ref|YP_003831897.1| dTDP-4-dehydrorhamnose reductase RfbD1 [Butyrivibrio
           proteoclasticus B316]
 gi|302396410|gb|ADL35315.1| dTDP-4-dehydrorhamnose reductase RfbD1 [Butyrivibrio
           proteoclasticus B316]
          Length = 289

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 163/296 (55%), Gaps = 23/296 (7%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRV------GRPDIDLLKPKDFASFFLSFSPDVII 55
           K +V G NGQ+ ++++       EI+        G   +D+    D         P  II
Sbjct: 3   KIIVTGCNGQLGRAINKELNGKYEIVNTDVFEGAGITPLDITNVDDVIRLAREVKPSAII 62

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AAYTAVDK E + ++++ INA G   +A A+  +G   +++STDYVF+G    P  EF
Sbjct: 63  NCAAYTAVDKQESDVDLSYKINAIGPRNLAIASTEVGAKLVHVSTDYVFEGNGTRPYVEF 122

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
             T P+++YGK+KLAGEE V  +++ Y I+RTAW+Y   G NF+ +ML L+++  EISVV
Sbjct: 123 DKTGPVSVYGKTKLAGEEFVKQFSDKYFIVRTAWLYGD-GKNFVKTMLGLSEKMDEISVV 181

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
            DQ GTPTSA ++A+AI  +         T+  G+FH T +G   +WADF + IF     
Sbjct: 182 MDQQGTPTSAKELAKAIAYLF-------PTNNYGVFHGTCEGS-TNWADFTDEIF----R 229

Query: 236 RGGPYSKVYRIFTKQY----PTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             G  +KV  + T QY    P  A RPAYS L+   L  T +   + W + +   L
Sbjct: 230 IAGKSTKVNHVTTAQYLEKNPQAAPRPAYSILENYMLKLTSDYMFADWHDAIEEYL 285


>gi|120612802|ref|YP_972480.1| dTDP-4-dehydrorhamnose reductase [Acidovorax citrulli AAC00-1]
 gi|120591266|gb|ABM34706.1| dTDP-4-dehydrorhamnose reductase [Acidovorax citrulli AAC00-1]
          Length = 296

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/299 (35%), Positives = 160/299 (53%), Gaps = 13/299 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+     +SLS +               D  +P D A    +  PDVI+N
Sbjct: 1   MNVLLFGKGGQVGWELQRSLSVLGTVTALDFDSTSHCGDFSRPHDIAGTVRALRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EP++A ++NA   G +A+ A  +G   ++ STDYVFDG    P  E  
Sbjct: 61  AAAHTAVDKAESEPDLARTLNATTPGVLAEEAARLGAWLVHYSTDYVFDGSGSRPWTEDD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
              PL++YG++KL GE+++ +    ++ILRT+WVY   G NF  +MLRLA+ER  ++V+ 
Sbjct: 121 VPAPLSVYGRTKLEGEQRIRASGARHLILRTSWVYGARGGNFAKTMLRLAQERERLTVID 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A A      +L +    +  G++H+ A  G   W  +A Y+  E A+R
Sbjct: 181 DQWGAPTGADLLADATAHAIRHLQQRPADA--GLYHLVA-AGETHWHAYACYVL-EQAQR 236

Query: 237 GGPYSK-----VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             P  K     V  + T  +PT A RP  S LD  +  +T  + +  W+ G+  +L  I
Sbjct: 237 IQPALKIAARDVAAVPTSAFPTPAVRPHNSRLDTRRFQSTFGLALPHWQAGIARMLAEI 295


>gi|294635548|ref|ZP_06714028.1| dTDP-4-dehydrorhamnose reductase [Edwardsiella tarda ATCC 23685]
 gi|291091117|gb|EFE23678.1| dTDP-4-dehydrorhamnose reductase [Edwardsiella tarda ATCC 23685]
          Length = 296

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 162/294 (55%), Gaps = 12/294 (4%)

Query: 1   MKCLVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G NGQ+   L  S   +  V  I     D   D   P   A       PDVI+N
Sbjct: 1   MHILLFGKNGQVGWELQRSLAPLGKVTAIDFDSTDYCGDFSNPNGVAETVRRLKPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE E E A  +NA    AIAK A+ +G   ++ STDYVFDG       E  
Sbjct: 61  AAAHTAVDKAESEREFAELLNATSVVAIAKEAELLGAWLVHYSTDYVFDGSGEKSWVEAD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KLAGE   A   + ++I RT+WVY+  G+NF  +MLRL +E +EISV+ 
Sbjct: 121 LTAPLNVYGETKLAGELG-AKLCSRHLIFRTSWVYAARGTNFAKTMLRLGQEHQEISVIN 179

Query: 177 DQFGTPTSALQIARAIIQIAHNL-IENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           DQFG PT A  +A      AH + I  S  ++ G++H+ A  G  +W D+A+ +F ++ +
Sbjct: 180 DQFGAPTGAELLADC---TAHAIRIAQSKPTVSGLYHLIAS-GTTTWFDYAQLVFAKARK 235

Query: 236 RGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            G   +  +V  + +  +PT A RP  S LD +K   T N+ +  W+ GV  +L
Sbjct: 236 AGIDLTVRQVRAVPSSAFPTPAKRPHNSRLDTTKFQQTFNLVLPDWQIGVERML 289


>gi|238021192|ref|ZP_04601618.1| hypothetical protein GCWU000324_01090 [Kingella oralis ATCC 51147]
 gi|237868172|gb|EEP69178.1| hypothetical protein GCWU000324_01090 [Kingella oralis ATCC 51147]
          Length = 293

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 116/291 (39%), Positives = 161/291 (55%), Gaps = 14/291 (4%)

Query: 4   LVIGNNGQIAQSL--SSMCVQDVEIIRVGRPDIDLLKPKDFASFFL---SFSPDVIINPA 58
           L+ G NGQ+   L        D  +I   R  +D+    D A+ F    +  P +IIN A
Sbjct: 5   LITGANGQVGSQLVRQLQARPDATVIAADRDTLDI---TDRAAVFQAAQTHRPHIIINAA 61

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A+TAVDKAE EPE+A +IN +G   +A+AA +I    ++ISTDYVFDG    P  E   T
Sbjct: 62  AHTAVDKAESEPELARAINVDGTRHLAEAAQAISAAFLHISTDYVFDGKGEAPYRETDST 121

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG++KL GE    +     ++LRTAWV+   G+NF+ +MLRL +ER  + +V DQ
Sbjct: 122 APQSVYGQTKLDGETAALAACPRTIVLRTAWVFGEHGNNFVKTMLRLGRERDTLGIVADQ 181

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
           FG PT A  IA A+IQIA ++         G++H +  G P  SW  FA  IF  +AE+ 
Sbjct: 182 FGAPTYAGDIAAALIQIARHIAAGQPVEY-GVYHFS--GSPYTSWHGFAGEIFRRAAEQN 238

Query: 238 --GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
                  +  I T  YPT A RPA S LDCSK+     I  S W+  + ++
Sbjct: 239 LLPRIPTLNAIATADYPTPARRPANSRLDCSKIQAAFGIAPSDWQAALGSL 289


>gi|222087848|ref|YP_002546386.1| dTDP-4-dehydrorhamnose reductase [Agrobacterium radiobacter K84]
 gi|221725296|gb|ACM28452.1| dTDP-4-dehydrorhamnose reductase [Agrobacterium radiobacter K84]
          Length = 295

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 164/289 (56%), Gaps = 4/289 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M  L++G NGQ+A +L+ +  +  +E +  GR ++DL          +      I+N AA
Sbjct: 1   MTLLILGKNGQVATALAELAEERGLEWVAWGRGELDLSDLDQTYVAIMKSGASAIVNAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAE E   A  +NA+    +A+AA  + +P ++ISTDYVF G   TP  E    +
Sbjct: 61  YTAVDKAESEAASAMRLNADAPAIVAQAARELDVPFVHISTDYVFSGDKTTPYTEDDAIS 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P++IYG SK  GE++V    +   ILRTAWV+   GSNF+ +MLRL  ER+E+ VV DQ 
Sbjct: 121 PISIYGLSKAEGEKRVREVYSAATILRTAWVFHESGSNFVKTMLRLGGERKELRVVADQH 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PT A  IA A ++I   + +    S+ G FH  A  G  +W  FAE IF E+A  G  
Sbjct: 181 GNPTYAGDIALACLKIV-EIAKARSRSVAGTFHF-AGRGYTTWHGFAEAIFAEAAAHGWV 238

Query: 240 Y-SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              +V  I T +YPT A RPA S  DCS++A+   I    W++ + + L
Sbjct: 239 VPGRVTAISTAEYPTPARRPANSRFDCSRIASVLEIDAPHWRDSLAHCL 287


>gi|146298096|ref|YP_001192687.1| dTDP-4-dehydrorhamnose reductase [Flavobacterium johnsoniae UW101]
 gi|146152514|gb|ABQ03368.1| dTDP-4-dehydrorhamnose reductase [Flavobacterium johnsoniae UW101]
          Length = 281

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 161/294 (54%), Gaps = 22/294 (7%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEI-------IRVGRPDIDLLKPKDFASFFLSFSPDVI 54
           K LV G NGQI   L  +     E        I++   +++LLK +          P+VI
Sbjct: 3   KILVTGANGQIGSELFVLSTSYPEFEWIFADRIKITLDNLELLKIQ-----LNEIKPNVI 57

Query: 55  INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDE 114
            N  AYT VDKAE E E+AF IN      IAK      +  I++STDYVFDG S + ++E
Sbjct: 58  FNCGAYTDVDKAETEKELAFIINYLAVELIAKYTYENNVKLIHVSTDYVFDGSSSSALNE 117

Query: 115 FSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISV 174
            + TNP+N+YG+SKL GE        N +I+RT+WVYS FG NF+ +M RL  ER EI+V
Sbjct: 118 EAETNPINVYGESKLKGELACLKENPNSIIIRTSWVYSKFGKNFVKTMQRLMLERDEINV 177

Query: 175 VCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
           V DQ G+PT A  +A+ +I I             G+++ + + G +SW +FA  I     
Sbjct: 178 VNDQIGSPTYAADLAQVLINIVRFC-----GWFPGVYNYSNE-GEISWYEFALSI----K 227

Query: 235 ERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
           E GG   KV  I +  Y T A RP +S LD  K+  T+N+ I  +K+ ++N+ +
Sbjct: 228 EFGGYSCKVEGIASSLYHTPAKRPRFSLLDKKKIKETYNLEIPCYKKSLKNMFI 281


>gi|258543637|ref|YP_003189070.1| dTDP-4-dehydrorhamnose reductase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634715|dbj|BAI00691.1| dTDP-4-dehydrorhamnose reductase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256637771|dbj|BAI03740.1| dTDP-4-dehydrorhamnose reductase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256640825|dbj|BAI06787.1| dTDP-4-dehydrorhamnose reductase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643880|dbj|BAI09835.1| dTDP-4-dehydrorhamnose reductase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646935|dbj|BAI12883.1| dTDP-4-dehydrorhamnose reductase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649988|dbj|BAI15929.1| dTDP-4-dehydrorhamnose reductase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652978|dbj|BAI18912.1| dTDP-4-dehydrorhamnose reductase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256656032|dbj|BAI21959.1| dTDP-4-dehydrorhamnose reductase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 301

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 153/288 (53%), Gaps = 4/288 (1%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LV G  GQ+A SL ++    +    VGRP+ D  +P+   +   +  P  ++N AA+TAV
Sbjct: 12  LVTGGKGQLATSLVNLGGPRIRC--VGRPNFDFDRPETLKTTLDAIKPVAVVNAAAWTAV 69

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D AE EPE A   N  G   +A+     GIP I++STDYVF G    P  E  P +P  +
Sbjct: 70  DLAESEPEAAARANTTGPELLARLCAERGIPFIHVSTDYVFAGDKGAPYLETDPVSPQTV 129

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG +K  GE+++ +     +ILRT+WVYS  G NF+ +ML    +   + VV DQ G PT
Sbjct: 130 YGSTKAEGEQRILAADPRSIILRTSWVYSAHGKNFVRTMLNAGAKNPALKVVGDQRGNPT 189

Query: 184 SALQIARAIIQIAHNLIENS-DTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
            +  +ARAI+ I   + +        GI+H     G  +W   AE    +++E G     
Sbjct: 190 CSDDLARAILSILATIEKTGWKDEYAGIYHACGT-GETTWHGLAEAALQKASEYGQAKPT 248

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           +  I T+ +PT A RPA S +D SKLA    +++  W+E V  ++ +I
Sbjct: 249 ITAIRTEDWPTPAKRPADSRMDNSKLARVFGVQMPQWQESVNKVVHHI 296


>gi|325981476|ref|YP_004293878.1| dTDP-4-dehydrorhamnose reductase [Nitrosomonas sp. AL212]
 gi|325530995|gb|ADZ25716.1| dTDP-4-dehydrorhamnose reductase [Nitrosomonas sp. AL212]
          Length = 303

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 164/299 (54%), Gaps = 13/299 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI----DLLKPKDFASFFLSFSPDVIIN 56
           M+ L++G NGQ+   L        E+I +         DL   K         +P++I+N
Sbjct: 1   MRILLLGKNGQLGWELQRSLAPLGELISLDSASRELCGDLSNFKGIKQTIQKTAPNIIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AAYTAVDKAE+EPE+   +NAE    +A+ A       ++ STDYVF+G S  P  E  
Sbjct: 61  AAAYTAVDKAENEPELTQILNAEAPKILAQGAKEQNARLVHYSTDYVFNGNSSQPYVETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
             +PLN YGK+KL G+E + +   +++I RT+W+Y+  G NF+ ++L LA+ R +++VV 
Sbjct: 121 TADPLNYYGKTKLEGDENIMTSGCSHLIFRTSWIYATLGRNFIKTILYLAQNRDKLTVVN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIE-NSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           DQ G+PTSA  IA      A+ L        + G+F++TA G   SW +FA++I     +
Sbjct: 181 DQIGSPTSAELIADI---TAYTLFTVKYKPKISGLFNLTAKGY-TSWYEFAKFILEHVEK 236

Query: 236 RGGPY----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           R  P     + +  I + ++P  A RP  SCL+ +KL NT  + +  W+ GV  IL  I
Sbjct: 237 RNLPLKIHSTHIDPISSVEFPLPAKRPLNSCLNTNKLENTFQLSLPAWQVGVSRILTEI 295


>gi|255008051|ref|ZP_05280177.1| putative dTDP-dehydrorhamnose reductase [Bacteroides fragilis
           3_1_12]
 gi|313145768|ref|ZP_07807961.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313134535|gb|EFR51895.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 287

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 109/289 (37%), Positives = 160/289 (55%), Gaps = 12/289 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVE--IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M  LV G NGQ+   +  +  ++++         ++D+   +   ++      DVI+N A
Sbjct: 1   MNILVTGANGQLGNEMQVLAKENLQHTYFFTDVQELDICDEQAVYAYVSEHKIDVIVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED+ E    +N    G +A+AA + G   I +STDYVFDG +  P  E  PT
Sbjct: 61  AYTAVDKAEDDAEFCDKLNNVAPGYLARAAQANGAAMIQVSTDYVFDGTAHIPYTEDQPT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG +KL GE+ V ++    +++RTAW+YSI+G+NF+ +M+RL +ER    V+ DQ
Sbjct: 121 CPTSVYGSTKLTGEQNVMNHCEKAMVIRTAWLYSIYGNNFVKTMIRLGRERESFGVIFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +A AI    +  I      +RGI+H + D G  SW DF   I   +   G 
Sbjct: 181 IGTPTYANDLALAIFAALNKGI------VRGIYHFS-DEGVCSWYDFTIAIHRLA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              KV  + T  YP KA RP YS LD +K+  T  I I  W+E ++  +
Sbjct: 231 TSCKVKPLHTADYPAKAPRPHYSVLDKTKIKETFGIEIPHWEESLKRCI 279


>gi|167753451|ref|ZP_02425578.1| hypothetical protein ALIPUT_01725 [Alistipes putredinis DSM 17216]
 gi|167658076|gb|EDS02206.1| hypothetical protein ALIPUT_01725 [Alistipes putredinis DSM 17216]
          Length = 286

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 155/288 (53%), Gaps = 8/288 (2%)

Query: 4   LVIGNNGQIAQSLSSM-CVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
           LV G +GQ+ + + ++              D+D+        F  +   D I+N AAYT 
Sbjct: 5   LVTGADGQLGREMRTLGAASRHRYFFTDVADLDITDANAVRRFVENERIDAIVNCAAYTN 64

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VDKAE+E E A  IN E    +A+AA + G    +ISTDYVF G+   P  E  PT PL 
Sbjct: 65  VDKAEEEAETADRINHEAVRNLAEAAKACGATLFHISTDYVFGGMGNIPFREEDPTAPLG 124

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YGK+KLAGEE + +    +++ RTAW+YS +G NFL +ML+L  ++ E+ VV DQ GTP
Sbjct: 125 VYGKTKLAGEEAIVASGCKHLVFRTAWLYSPYGRNFLKTMLQLTADKPELQVVFDQVGTP 184

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
           T    +A  I     + IE+ D + R  F+  ++ G  SW DFA  I   +A  G    K
Sbjct: 185 TCVADLACVIF----DRIESGDYAGREGFYHFSNEGVCSWFDFAHEI---AALAGHTSCK 237

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           +    + ++P+K  RP YS LD +K+  T  I I  W++ +   +  +
Sbjct: 238 IRPCHSAEFPSKVQRPNYSVLDKTKIKTTFGIDIPHWRDSLVRCMATL 285


>gi|332297028|ref|YP_004438950.1| dTDP-4-dehydrorhamnose reductase [Treponema brennaborense DSM
           12168]
 gi|332180131|gb|AEE15819.1| dTDP-4-dehydrorhamnose reductase [Treponema brennaborense DSM
           12168]
          Length = 310

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 161/296 (54%), Gaps = 22/296 (7%)

Query: 5   VIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFF-LSFSPDVIINPAAYTA 62
           +IG NG +   ++    + D+E +   R +ID+       SF   +   D IIN AAYTA
Sbjct: 4   LIGKNGMLGSEIARQLERADLEYVGTDR-EIDITDQAALDSFANGNHGIDWIINCAAYTA 62

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           V+KAE+EPE+A  +NAEGAG IA+ A   G   I+ISTDYVFDG  +TP  E  P +PL 
Sbjct: 63  VEKAEEEPELAARLNAEGAGNIARTAKKAGARMIHISTDYVFDGAGKTPYTEIMPISPLG 122

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YGK+K  GE+ V    ++  + RTAW+Y   G NF+ +M+ L   R  I+VV DQFG+P
Sbjct: 123 VYGKTKADGEKLVTETLDDAYVFRTAWLYGPRGKNFVYTMVDLMNGRDSITVVADQFGSP 182

Query: 183 TSALQIARAIIQIAHNLIENSDTSLR-------------GIFHMTADGGPVSWADFAEYI 229
           T  + +AR II +   ++ +  + +              GI+H T + G  +W DFA  I
Sbjct: 183 TCTMDLARCIITV---ILRDRQSGVSAAAGRQTISAVPPGIYHCTGE-GETTWYDFACEI 238

Query: 230 FWESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
           +     +G       V    T +Y  K  RPAYS L  SKL     I++ +W+E +
Sbjct: 239 YRIGKLKGIVTRNCTVKPCTTAEYGAKVARPAYSVLSKSKLKKALGIKLPSWQESL 294


>gi|317492490|ref|ZP_07950918.1| RmlD substrate binding domain-containing protein
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919482|gb|EFV40813.1| RmlD substrate binding domain-containing protein
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 299

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 150/294 (51%), Gaps = 11/294 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI----DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G NGQ+   L         II V         D   P+  A+      PDVI+N
Sbjct: 1   MNILLFGKNGQVGWELQRSLAPLGNIIAVDHDSSEYCGDFSHPEGVAATVRKIKPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE E E A  +NA    AIAK A+ +G   I+ STDYV  G       E  
Sbjct: 61  AAAHTAVDKAESEQEFAQLLNATSVEAIAKEAEILGAWLIHYSTDYVLPGTGNRAWIETD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
             +PLN+YG +KLAGE  + +    ++I RT+WVY+  G+NF  +MLRL  ER E+S++ 
Sbjct: 121 EPSPLNVYGVTKLAGERAIQNQCKKHLIFRTSWVYASKGNNFAKTMLRLGAEREELSIIN 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A          I N D +  GI+H+ A  G  +W +FA  +F E A R
Sbjct: 181 DQYGAPTGAELLADCTAHAIKKAISNHDVA--GIYHLVAS-GTTTWFEFANLVFAE-ARR 236

Query: 237 GGPYSKVYRIF---TKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            G   KV       T  Y T A RP  S LD +K     ++ +  W  GV+ +L
Sbjct: 237 AGIELKVNNTLPVPTSSYQTPAKRPLNSRLDTTKFKQVFDLNLPNWDVGVKRML 290


>gi|188588264|ref|YP_001922377.1| dTDP-4-dehydrorhamnose reductase [Clostridium botulinum E3 str.
           Alaska E43]
 gi|188498545|gb|ACD51681.1| dTDP-4-dehydrorhamnose reductase [Clostridium botulinum E3 str.
           Alaska E43]
          Length = 284

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 155/286 (54%), Gaps = 13/286 (4%)

Query: 4   LVIGNNGQIAQS-LSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
           LV G NGQ+    +  +  +++E I   R ++D+    + + +     P  +I+ AAYTA
Sbjct: 3   LVTGANGQLGYDVIKELKKRNIECIGTTRKELDITNYNEVSKYIEELKPKCVIHCAAYTA 62

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VDKA+DE EI   +N  G   IAK    I    IYIS+DYVFDG    P +     NPL+
Sbjct: 63  VDKAQDEEEICTKVNVYGTENIAKVCRRINAKMIYISSDYVFDGAGDKPHEIEETPNPLS 122

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YG SK  GE KV SY   Y I+RT+WV+ + GSNF+ +ML+L KE+  ++VVCDQ G+P
Sbjct: 123 VYGSSKYNGELKVKSYLKKYFIVRTSWVFGLNGSNFVKTMLKLGKEKESLNVVCDQIGSP 182

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
           T    +A+ +  +A        +   GI+H T + G  SWA+FAE I            K
Sbjct: 183 TYTEDLAKLLCDMAV-------SEKYGIYHAT-NQGFCSWAEFAEEIM----RIANLNCK 230

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
           +  I T +Y TKA RP  S L    L ++    + +WK  ++  +V
Sbjct: 231 INYISTNEYKTKAIRPLNSRLSKKSLLDSGFNYLPSWKNALKVYIV 276


>gi|18309600|ref|NP_561534.1| dTDP-4-dehydrorhamnose reductase [Clostridium perfringens str. 13]
 gi|110800859|ref|YP_695052.1| dTDP-4-dehydrorhamnose reductase [Clostridium perfringens ATCC
           13124]
 gi|110801012|ref|YP_694936.1| dTDP-4-dehydrorhamnose reductase [Clostridium perfringens ATCC
           13124]
 gi|18144277|dbj|BAB80324.1| dTDP-4-dehydrorhamnose reductase [Clostridium perfringens str. 13]
 gi|110675506|gb|ABG84493.1| dTDP-4-dehydrorhamnose reductase [Clostridium perfringens ATCC
           13124]
 gi|110675659|gb|ABG84646.1| dTDP-4-dehydrorhamnose reductase [Clostridium perfringens ATCC
           13124]
          Length = 294

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 108/302 (35%), Positives = 157/302 (51%), Gaps = 25/302 (8%)

Query: 1   MKCLVIGNNGQIAQSLSSMC-------------VQDVEIIRVGRPDIDLLKPKDFASFFL 47
           MK L+ G+NGQ+   L S+              +++ E+I +    +D+   ++  +   
Sbjct: 1   MKILITGSNGQLGNELQSIIKSGKAEIGSVSENIKNSEVIALDVDKLDITSLENVKNVLN 60

Query: 48  SFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGL 107
              PDV+IN AA T VD  E   + AF +N+ GA  +A   + IG   + +STDYVF G 
Sbjct: 61  EEKPDVVINCAAATNVDGCESNEDFAFKVNSLGARNLAMVCEEIGAKLVQVSTDYVFSGF 120

Query: 108 SRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAK 167
              P+ EF  T P ++YGK+KL GE  V  + + Y I+RTAW+Y   G NF+ +M+RL K
Sbjct: 121 GEKPLTEFDLTAPYSVYGKTKLLGENYVKEFCSKYYIVRTAWLYGYVGHNFVYTMMRLGK 180

Query: 168 ERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAE 227
           E+  ++VV DQ G PT A  +A  I++    LIE   T   GI+H T   G  +W DFA+
Sbjct: 181 EKESLNVVNDQKGNPTHANDLAYHILK----LIE---TEEYGIYHCTGK-GECTWYDFAK 232

Query: 228 YIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            I     E  G    V    +++Y T A RP YS LD   L  T    +  WKE +++  
Sbjct: 233 EIM----ELAGNKCIVNPCTSEEYKTPAKRPEYSSLDNMMLRCTIGDEMRDWKEALKSFF 288

Query: 288 VN 289
            N
Sbjct: 289 EN 290


>gi|87123106|ref|ZP_01078957.1| putative dTDP-4-dehydrorhamnose reductase [Synechococcus sp.
           RS9917]
 gi|86168826|gb|EAQ70082.1| putative dTDP-4-dehydrorhamnose reductase [Synechococcus sp.
           RS9917]
          Length = 305

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 111/302 (36%), Positives = 161/302 (53%), Gaps = 16/302 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRP------DIDLLKPKDFASFFLSFSPDVI 54
           ++ L+ G  GQ+ Q+L +   + +E+I  GR        +DL   +       +  PD +
Sbjct: 5   IRVLLTGAAGQLGQALMASVPEGIELIATGRSVGQGMLGLDLADAEACRQAVEAHQPDWV 64

Query: 55  INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDE 114
           +N  AYTAVD+AE EPE+A ++NA+   A A+A   +G   + +STD+VF+G   +P   
Sbjct: 65  LNAGAYTAVDRAEMEPELAQAVNAQAPCAFAEALADMGGHLLQVSTDFVFNGQQGSPYRP 124

Query: 115 FSPTNPLNIYGKSKLAGEEKVASY---TNNYVILRTAWVYSIFGSNFLLSMLRLAKERRE 171
             P NPL +YG++K AGEE V      +   +ILRT+WV    G NF L+MLRL +ER E
Sbjct: 125 EQPRNPLGMYGRTKAAGEEAVEQLLGGSGRGLILRTSWVMGPVGRNFALTMLRLHRERPE 184

Query: 172 ISVVCDQFGTPTSALQIARAIIQ-IAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIF 230
           I+VV DQ G PTS   +A A  + IA   +  S   L  + H + D G  SW D A  + 
Sbjct: 185 IAVVADQVGCPTSTATLAAACWRAIA---VAESPNGLPPVLHWS-DAGAASWYDVAVAVG 240

Query: 231 WESAERG--GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
               E G     + V  I T +YPT A RP+YS LDCS      ++    W++ +  +L 
Sbjct: 241 ELGVELGLLERAAHVNPITTAEYPTPAQRPSYSLLDCSATRQVLDLPALHWRQALHQLLQ 300

Query: 289 NI 290
            I
Sbjct: 301 AI 302


>gi|222445607|ref|ZP_03608122.1| hypothetical protein METSMIALI_01247 [Methanobrevibacter smithii
           DSM 2375]
 gi|222435172|gb|EEE42337.1| hypothetical protein METSMIALI_01247 [Methanobrevibacter smithii
           DSM 2375]
          Length = 280

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 106/288 (36%), Positives = 157/288 (54%), Gaps = 12/288 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G+NG +   L  +     E+I      +D+   +    F     PD++IN AAY
Sbjct: 1   MKVLITGSNGMLGHDLIDVLNDKHELILTTSKTLDITDKEHTVEFIKENKPDIVINSAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD  E+  E AFS+N EG   +A        P ++ISTDYVF+G + TP  E     P
Sbjct: 61  TDVDGCEENRERAFSVNGEGVRNLAIGCREADCPLVHISTDYVFNGKNDTPWVEDDEIGP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +++YGKSKL GE+ +    + + I+RTAW+Y + G NF  +ML LAK   E++VV D+ G
Sbjct: 121 ISVYGKSKLEGEQAIQEILDKFFIVRTAWLYGVNGGNFPKTMLELAKTHDELTVVYDEIG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPT    +A AI +    LIE   T   GI+H+T + G  SW +FA+YIF    E  G  
Sbjct: 181 TPTYTPDLAEAIGK----LIE---TDYYGIYHIT-NSGNCSWCEFAKYIF----EIAGVD 228

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
            KV  +   ++   A RP+YS L+  K  +     + ++KE +++ L+
Sbjct: 229 VKVTPVTASEFARPAPRPSYSVLNNKKWVDNGFEPLRSYKEAIKDYLI 276


>gi|145219285|ref|YP_001129994.1| dTDP-4-dehydrorhamnose reductase [Prosthecochloris vibrioformis DSM
           265]
 gi|145205449|gb|ABP36492.1| dTDP-4-dehydrorhamnose reductase [Chlorobium phaeovibrioides DSM
           265]
          Length = 286

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 108/295 (36%), Positives = 167/295 (56%), Gaps = 17/295 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGR------PDIDLLKPKDFASFFLSFSPDVI 54
           M  LV G+NGQ+ + L  +      ++   R       ++D+ +     S      P V+
Sbjct: 1   MNILVTGSNGQLGRELQELS----RLLPAHRFFFHDLQELDITESSAVMSAVARCQPSVL 56

Query: 55  INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDE 114
           IN AAYTAVD+AE +PE AF +N  GAG +A A    G+  +++STDYVF+G   TP  E
Sbjct: 57  INAAAYTAVDRAERDPESAFRVNRNGAGVLASACREAGVLLLHVSTDYVFEGNRPTPYSE 116

Query: 115 FSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISV 174
               +P ++YG+SKL GE+ +     +++I+RT+W+YS +G+NF+ +MLRL  E+ E+ V
Sbjct: 117 SDSPSPSSVYGRSKLQGEQLIGEIDPSHIIVRTSWLYSPYGANFVKTMLRLGAEKSELQV 176

Query: 175 VCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
           V DQ GTPTSA  +A A+++IA +   +     R  +H + + G  SW DFA  +     
Sbjct: 177 VFDQTGTPTSAADLAGALLEIAGH--HDPSRHYRQTYHYSNE-GTASWYDFACAVM---- 229

Query: 235 ERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           E  G   ++  + +  YP +A RP+YS LD S +     IRI  W++ +  +L N
Sbjct: 230 ELSGLECRILPVDSSCYPQEAPRPSYSVLDKSAIKRDWGIRIPYWRDSLAAMLSN 284


>gi|299137001|ref|ZP_07030184.1| dTDP-4-dehydrorhamnose reductase [Acidobacterium sp. MP5ACTX8]
 gi|298601516|gb|EFI57671.1| dTDP-4-dehydrorhamnose reductase [Acidobacterium sp. MP5ACTX8]
          Length = 310

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 104/298 (34%), Positives = 158/298 (53%), Gaps = 13/298 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L+IG NGQ+   L  M      ++ V R ++DL       +      P  I+N AAYTAV
Sbjct: 7   LLIGANGQVGSELLPMLNALGHVVAVTRAELDLTDAAAIRAMVRQVKPRWIVNAAAYTAV 66

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           DKAE +   AF+IN +  G + + A  IG   ++ STDYVF G    P  E  P NPL +
Sbjct: 67  DKAESDIPTAFAINGDAPGVLGEEAARIGAAVLHFSTDYVFAGDGTRPWREDDPVNPLGV 126

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG SKLAGE  +A+    ++  RT+WV+   G NFLL++L+ A+ER E+ +V DQ+G PT
Sbjct: 127 YGASKLAGERALAASGAAHLTFRTSWVFGARGKNFLLTILKFAREREELRIVDDQYGAPT 186

Query: 184 SALQIAR----AIIQIAHNLIENSDT------SLRGIFHMTADGGPVSWADFA-EYI-FW 231
            +  +AR    AI++   +      T       L GI+H  +  G  +W  FA E++   
Sbjct: 187 WSRTLARLATHAILRGEKDAATQGGTLVEAMQPLSGIYHACS-AGCTTWFGFASEFVGLA 245

Query: 232 ESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           + A     ++++  + +  YPT A RP  S ++C KLA+T    + TW++    ++  
Sbjct: 246 QLAHPEQAFARLAPVSSDAYPTPAKRPQNSRMNCEKLAHTLEFELPTWQDSTAEVMAE 303


>gi|298209184|ref|YP_003717363.1| putative dTDP-4-dehydrorhamnose reductase [Croceibacter atlanticus
           HTCC2559]
 gi|83849111|gb|EAP86980.1| putative dTDP-4-dehydrorhamnose reductase [Croceibacter atlanticus
           HTCC2559]
          Length = 288

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 161/286 (56%), Gaps = 12/286 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           LV G NGQ+   + ++        ++      +D+        +  +   D IIN AAYT
Sbjct: 10  LVTGANGQLGTCIKAIANNYPSCNVVFEDSSSLDITNRNQVVQYMSNSQFDYIINCAAYT 69

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD AED  E AF INA+    +  A        +++STD+VFDG    P  E   T+PL
Sbjct: 70  AVDLAEDNKEKAFEINAKAVENLTIACKRFSSTLLHVSTDFVFDGKKNAPYLERDSTHPL 129

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           N YG SKL GE+ +    + YVI+RT+W++S FG+NF+ +M+RL +E++E+S+V DQ+G+
Sbjct: 130 NYYGASKLNGEQIIQQALSKYVIIRTSWLFSEFGNNFVKTMVRLGQEKKELSIVADQYGS 189

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT A+ +A  ++      I +S TS  G++H + + G  +W +FA  IF    +      
Sbjct: 190 PTYAIDLAHILL----TFIASSSTSY-GLYHFS-NHGATTWYNFAAEIF----KLQNQDI 239

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           ++++  +KQ+ ++A RP YS L+  K+  T N+ I  W+  ++ ++
Sbjct: 240 RLHKTTSKQFASRAIRPKYSVLETKKVKETLNVEIRNWQSALKEMI 285


>gi|83645210|ref|YP_433645.1| dTDP-4-dehydrorhamnose reductase [Hahella chejuensis KCTC 2396]
 gi|83633253|gb|ABC29220.1| dTDP-4-dehydrorhamnose reductase [Hahella chejuensis KCTC 2396]
          Length = 303

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 160/300 (53%), Gaps = 13/300 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ +V G  GQ+   L+        +  +GR   DL  P    +      PDVI+N AAY
Sbjct: 1   MEIMVTGATGQLGWELARSLSMLGRVRALGRNQCDLNDPGSLRAVVRDIKPDVIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   A  +N++    +A+ A + G   ++ STDYVF+G    P  E  P  P
Sbjct: 61  TAVDKAESDRGGAMRVNSDSVAVLAEEAKNCGALFVHYSTDYVFNGEKGAPYVEVDPVCP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +N YG SKL+GE  +     NY+I RT+WVY+  G NFLL+ML LA+ +  +SVV DQ G
Sbjct: 121 INTYGYSKLSGENLIRQVDGNYLIFRTSWVYASRGKNFLLTMLNLAQTKEVLSVVSDQRG 180

Query: 181 TPTSALQIAR----AIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWE-SAE 235
            PT A  +A+    ++ +  H +  NS  S  GI+++ A  G  SW  FA Y+  E  ++
Sbjct: 181 APTWARDLAQMTLLSVYKSIHAIHNNSFKS--GIYNL-ASSGETSWHGFASYLIEEFKSQ 237

Query: 236 RGGPYSKVY-----RIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            GG   +V      ++ +  Y T A RPAYS LD +K  +   + +  WK+  R  + +I
Sbjct: 238 SGGGAGQVLVKDINKVTSDFYKTDATRPAYSKLDATKFEDEFQVFMPDWKDSCRLCIADI 297


>gi|326318819|ref|YP_004236491.1| dTDP-4-dehydrorhamnose reductase [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323375655|gb|ADX47924.1| dTDP-4-dehydrorhamnose reductase [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 296

 Score =  182 bits (463), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 107/299 (35%), Positives = 159/299 (53%), Gaps = 13/299 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+     +SLS +               D  +P D A    +  PDVI+N
Sbjct: 1   MNILLFGKGGQVGWELQRSLSVLGTVTALDFDSTSHCGDFSRPHDIAGTVRALRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EP++A ++NA   G +A+ A  +G   ++ STDYVFDG    P  E  
Sbjct: 61  AAAHTAVDKAESEPDLARTLNATTPGVLAEEAARLGAWLVHYSTDYVFDGSGARPWTEDD 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
              PL++YG++KL GE+++ +    ++ILRT+WVY   G NF  +MLRLA+ER  ++V+ 
Sbjct: 121 VPAPLSVYGRTKLEGEQRIQASGARHLILRTSWVYGARGGNFAKTMLRLAQERERLTVID 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ+G PT A  +A A      +L +    +  G++H+ A  G   W  +A Y+  E A+R
Sbjct: 181 DQWGAPTGADLLADATAHAIRHLQQRPADA--GLYHLVA-AGETHWHAYACYVL-EQAQR 236

Query: 237 GGPYSK-----VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             P  K     V  + T  +PT A RP  S LD  +   T  + +  W+ G+  +L  I
Sbjct: 237 IQPALKIAARDVVAVPTSAFPTPAVRPHNSRLDTRRFQATFGLALPHWQAGIARMLTEI 295


>gi|218258015|ref|ZP_03474457.1| hypothetical protein PRABACTJOHN_00110 [Parabacteroides johnsonii
           DSM 18315]
 gi|218225814|gb|EEC98464.1| hypothetical protein PRABACTJOHN_00110 [Parabacteroides johnsonii
           DSM 18315]
          Length = 288

 Score =  182 bits (463), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 109/290 (37%), Positives = 159/290 (54%), Gaps = 11/290 (3%)

Query: 4   LVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           LV G NGQ+  S+  +         +      +D+   +   +F      D IIN AAYT
Sbjct: 5   LVTGANGQLGNSIRQLAAGYPQYAFVFTDVDTLDICDAQAVDAFVKEKQADYIINCAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAED+  + F IN +    + +AA   G   I++STDYVFDG +  P  E   T P 
Sbjct: 65  AVDKAEDDEALCFRINRDAVRNLGEAARMAGARVIHVSTDYVFDGTNHLPYVETDATCPA 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           ++YG++KLAGE+ +     + VI+RTAW+YS FG+NF+ +MLRL  ER ++SVV DQ G+
Sbjct: 125 SVYGRTKLAGEQALQEVCPDAVIIRTAWLYSEFGNNFVKTMLRLGNEREQLSVVFDQIGS 184

Query: 182 PTSALQIARAIIQIAHNLIE-NSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           PT A  +A  I+ +   L++  +   + GI+H + + G  SW DFA  I     E G   
Sbjct: 185 PTYAGDLAATILAV---LVQAEAGAFVPGIYHYSNE-GVCSWYDFAVKIM----ELGDAP 236

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             V  I +K YP KA RP +S L+ +K+   + I I  W+  +R  +  I
Sbjct: 237 CHVLPIESKDYPAKAARPHFSVLNKTKIKTIYTISIPHWEASLRECMKRI 286


>gi|225350727|ref|YP_002720716.1| dTDP-4-keto-L-rhamnose reductase [Brachyspira hyodysenteriae WA1]
 gi|225216411|gb|ACN85144.1| dTDP-4-keto-L-rhamnose reductase [Brachyspira hyodysenteriae WA1]
 gi|330368658|gb|AEC11780.1| dTDP-4-keto-L-rhamnose reductase [Brachyspira hyodysenteriae]
 gi|330368668|gb|AEC11788.1| dTDP-4-keto-L-rhamnose reductase [Brachyspira hyodysenteriae]
 gi|330368673|gb|AEC11792.1| dTDP-4-keto-L-rhamnose reductase [Brachyspira hyodysenteriae]
          Length = 286

 Score =  182 bits (463), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 154/271 (56%), Gaps = 19/271 (7%)

Query: 5   VIGNNGQIAQS-LSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           VIG NG +AQ  L +    ++E       +ID+       +F    +   IIN +AYT V
Sbjct: 4   VIGKNGMLAQDILKAFNKNNIEYTSTA-SNIDITNIDILNNFIKDKNIKTIINCSAYTKV 62

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D AEDE +I + +N EG   I + A +I    I+ STDYVFDG +  P +E   TNP+NI
Sbjct: 63  DLAEDEKDICYKVNGEGVKNITEIASNINADLIHFSTDYVFDGENNKPYNEEDKTNPINI 122

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YGKSKL G EK A + N  +++R +W+Y I+G NF+ +M+ L   +  I VV DQFG+PT
Sbjct: 123 YGKSKLEG-EKYALFYNKAIVIRVSWLYGIYGKNFVYTMINLMNSKESIKVVNDQFGSPT 181

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS-- 241
               +A  I    +++I+N++    G++H T +G  +SW DFA+ I+     +G  Y+  
Sbjct: 182 YTEDVAMVI----YDIIKNNNFDY-GLYHYTNEGN-ISWYDFAKTIY----NKGKEYNII 231

Query: 242 ----KVYRIFTKQYPTKAHRPAYSCLDCSKL 268
               KV    T++YPTKA RP YS L   K+
Sbjct: 232 NNDCKVNPCTTEEYPTKAKRPKYSVLSVEKI 262


>gi|313668764|ref|YP_004049048.1| dTDP-4-dehydrorhamnose reductase [Neisseria lactamica ST-640]
 gi|313006226|emb|CBN87688.1| putative dTDP-4-dehydrorhamnose reductase [Neisseria lactamica
           020-06]
          Length = 287

 Score =  182 bits (463), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 165/292 (56%), Gaps = 8/292 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G+  Q+A+ L     +D E I      +D+           +F PD ++N AAY
Sbjct: 1   MRILLTGSKSQLARCLRDRIPEDWETIATDSASLDITDADAVCRMIQNFQPDAVVNTAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   AF++NA     +A AA       I+ISTDYVFDG +  P  E   TNP
Sbjct: 61  TAVDKAEGDAAAAFAVNASAVYNLASAAYRAHARFIHISTDYVFDGQADKPYLESDFTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            NIYGKSK AGE    S   + +ILRT+W++S +G NF+ +ML  A ER  + VV +Q G
Sbjct: 121 PNIYGKSKAAGELLALSANPDSLILRTSWLFSEYGDNFVRTMLNRADERSSLPVVSNQTG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG-- 238
            PT A  +A AII+    L++ S + +RGI+H  A G  VSW +FA +IF  +  +    
Sbjct: 181 CPTYAGDLAAAIIR----LLQQS-SPVRGIYHF-AGGKSVSWYEFARHIFQTALRQDASF 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           P  ++  +  ++YP  A RP YS LDC K+ +   I+ S W++ +  +++ +
Sbjct: 235 PIPELKAVSDEEYPAAASRPPYSILDCRKIESGFGIKPSDWQKALSQVVLKL 286


>gi|297538356|ref|YP_003674125.1| dTDP-4-dehydrorhamnose reductase [Methylotenera sp. 301]
 gi|297257703|gb|ADI29548.1| dTDP-4-dehydrorhamnose reductase [Methylotenera sp. 301]
          Length = 301

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 107/299 (35%), Positives = 159/299 (53%), Gaps = 13/299 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI----DLLKPKDFASFFLSFSPDVIIN 56
           +K L++G NGQ+   L        E+I +    +    D       A    + +PDVI+N
Sbjct: 4   IKILLLGKNGQVGWELQRSLAPLGEVIALDAKSLAYCGDFTNLDGLAQAIRTIAPDVIVN 63

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+TAVDKAE EPE+A +INA     +A  A  IG   ++ STDYVFDG    P  E  
Sbjct: 64  AAAHTAVDKAESEPELARTINALAPAVLANEAKRIGAWLVHYSTDYVFDGSGEMPRLETD 123

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
             +PL+IYG +KL GE  + +    ++I RT+WVY+  G NF  +ML+LA+ER  + V+ 
Sbjct: 124 EVSPLSIYGHTKLEGENAIVASGCKHLIFRTSWVYAARGGNFAKTMLKLAQERDSLKVIN 183

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G PT A  +A          + + + S  G++H+ A  G  SW  +A ++  E A +
Sbjct: 184 DQIGAPTGADLLADVTAHGIRKALVSPEVS--GLYHLVAS-GETSWHGYASFVI-EHARQ 239

Query: 237 GGPYSKV-----YRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            G   KV       + T  +PT A RP  S L+ +KL N+ ++ + +W+ GV  +L  I
Sbjct: 240 AGVEIKVAADAIQAVPTSSFPTPAKRPLNSRLNTNKLQNSFDLVLPSWQSGVTRLLAEI 298


>gi|33599165|ref|NP_886725.1| dTDP-4-dehydrorhamnose reductase [Bordetella bronchiseptica RB50]
 gi|33575211|emb|CAE30674.1| dTDP-4-dehydrorhamnose reductase [Bordetella bronchiseptica RB50]
          Length = 298

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 109/286 (38%), Positives = 154/286 (53%), Gaps = 11/286 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M  L++G  GQI  +L +       +  + R   DL      A+   +++P ++IN AAY
Sbjct: 1   MNILLLGRTGQIGDALLAHPPAWARLAALERRQADLRDLGRLAAVLDAYAPRILINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD+AE EPE+A  INA+    +A  A       ++ STDYVFDG       E    +P
Sbjct: 61  TEVDRAEAEPELALRINAQAVAVMADYARRNNALLVHYSTDYVFDGKRARAYRETDAAHP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           LN YG+SKLAGE+ +A+    ++ILRT+WVY+  G+NF+ ++LRLA+ R E+SVV DQ G
Sbjct: 121 LNAYGRSKLAGEQAIAASGCPHLILRTSWVYASHGANFVKTILRLARTRAELSVVADQHG 180

Query: 181 TPTSALQIARAIIQI--AHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            PT A +IA    Q   AH      D    G++H++A GG VSW   A +I   +   G 
Sbjct: 181 APTWAGRIATVTWQAIDAHRRRRLPD----GLWHLSA-GGHVSWHGLACHIVARARRAGL 235

Query: 239 PYS----KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
             S     +  + T QYP  A RPA S LDC  L +     +  W+
Sbjct: 236 ALSLDPAHIRPVTTAQYPLPAPRPANSRLDCGALRDALEPELPDWQ 281


>gi|152979832|ref|YP_001353940.1| dTDP-4-dehydrorhamnose reductase [Janthinobacterium sp. Marseille]
 gi|151279909|gb|ABR88319.1| dTDP-4-dehydrorhamnose reductase [Janthinobacterium sp. Marseille]
          Length = 298

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 112/299 (37%), Positives = 153/299 (51%), Gaps = 22/299 (7%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G NGQ+   L        +++ + R  +DL       S      P +I+NPAAY
Sbjct: 1   MKILLTGRNGQVGYELERTLQGLGQVVALDRAQMDLSDLDQVRSVIREVKPQLIVNPAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD AE E E+A  INA+    IA+ A  +G   I+ STDYVFDG       E    NP
Sbjct: 61  TAVDLAEREVELAMRINAQAPEVIAQEAKKLGAGMIHYSTDYVFDGDQTGSYTEDDVPNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YG+SKLAGE+ V +    ++ILRT+WVY   G NFLL++ RLA+ER E+ +V DQFG
Sbjct: 121 QSVYGRSKLAGEQAVQAAGIPHLILRTSWVYGARGKNFLLTVRRLAQERDELRIVADQFG 180

Query: 181 TPTSALQIARAIIQIAHNLIE-------NSDTSLR--------GIFHMTADGGPVSWADF 225
            PT    IA A    AH LI+         D  L         G++H++A  G  SW   
Sbjct: 181 APTWCRTIAEA---TAHALIQMQRYSGTQKDAGLDQDVWLNRGGLYHLSAQ-GRTSWHGL 236

Query: 226 AEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
            + I    +    P  ++  I T+ YP  A RPA S L C +   T    +  W E ++
Sbjct: 237 TQAILAHPSISKKP--RLTPISTQDYPLPARRPANSSLSCERFMQTF-CGLPEWDEALK 292


>gi|153813195|ref|ZP_01965863.1| hypothetical protein RUMOBE_03611 [Ruminococcus obeum ATCC 29174]
 gi|149830726|gb|EDM85817.1| hypothetical protein RUMOBE_03611 [Ruminococcus obeum ATCC 29174]
          Length = 285

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 105/292 (35%), Positives = 154/292 (52%), Gaps = 13/292 (4%)

Query: 1   MKCLVIGNNGQIAQS-LSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G  GQ+    ++ +  +  E + V   ++D+              PD +++ AA
Sbjct: 1   MKVLVTGVKGQLGYDVMNELAKRGYEGVGVDVDEMDITDRAAVERVIGEVHPDKVVHCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT- 118
           +TAVD AED  E+   +NAEG   IA+    + IP +YISTDYVFDG    P +   P  
Sbjct: 61  WTAVDAAEDNQEVCHKVNAEGTENIARICGKLDIPMVYISTDYVFDGQGTRPWEPDDPVV 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            PLN+YG++K  GE  V  Y   + I+R AWV+ + G NF+ +ML L K    ++VV DQ
Sbjct: 121 KPLNVYGQAKYDGEVAVEKYAPKHYIVRIAWVFGLNGKNFIKTMLNLGKTHDTLTVVDDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT    +AR ++    +++E  +    G +H T +GG +SW DFA+ IF     + G
Sbjct: 181 IGTPTYTYDLARLLV----DMLEKEEY---GKYHATNEGGYISWCDFAKEIF----RQAG 229

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
              KV  + + +YP KA RP  S L+  KL      R+  WK+ +   L  I
Sbjct: 230 MDVKVLPVSSAEYPAKAKRPTNSRLEKKKLEEHGFTRLPDWKDALGRYLKEI 281


>gi|294673013|ref|YP_003573629.1| dTDP-4-dehydrorhamnose reductase [Prevotella ruminicola 23]
 gi|294472332|gb|ADE81721.1| dTDP-4-dehydrorhamnose reductase [Prevotella ruminicola 23]
          Length = 285

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 107/285 (37%), Positives = 158/285 (55%), Gaps = 12/285 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVE--IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M+ L+ G NGQ+   +  +  ++ +         ++D+   +    F      D I+N A
Sbjct: 1   MRILITGCNGQLGNEMQLLEKENQQHTYFNTDVAELDITDEEAINRFVTDNEIDGIVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAE+  E+   +NA   G +AKA +  G   I ISTDYVFDG +  P  E    
Sbjct: 61  AYTAVDKAEENQELCHKLNATAPGLLAKAIEKRGGWMIQISTDYVFDGTNHRPYTEDESV 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P + YG++KL GE++V +     +I+RTAW+YS FG+NF+ +M+RL KE+ E+ V+ DQ
Sbjct: 121 CPNSTYGRTKLEGEQEVTNGCKRSMIIRTAWLYSTFGNNFVKTMIRLGKEKPELGVIFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +A AI    +  I      + GI+H + + G +SW DF + I   +   G 
Sbjct: 181 IGTPTYARDLAVAIFAAINQGI------VPGIYHFSNE-GVISWYDFTKAIHRIA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
               V  + T +YPT A RP YS LD +K+  T+NI I  W+E +
Sbjct: 231 NTCHVRPLHTSEYPTPAARPHYSVLDKTKIKQTYNIEIPYWEESL 275


>gi|37522803|ref|NP_926180.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Gloeobacter violaceus PCC
           7421]
 gi|35213805|dbj|BAC91175.1| dTDP-6-deoxy-L-mannose-dehydrogenase [Gloeobacter violaceus PCC
           7421]
          Length = 300

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 156/296 (52%), Gaps = 13/296 (4%)

Query: 1   MKC---LVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
            KC   L+ G  GQ+ + L ++   ++   +  GR  +D+                V+ N
Sbjct: 8   QKCFMYLITGAGGQLGKELCALLEAREEPFVAYGRAQLDIADSGAVRQALEQSGAAVLFN 67

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AAYT VDKAE E E A  +NA GA  +A+A  + G   +++STDYVFDG +  P  E +
Sbjct: 68  CAAYTRVDKAESEAEEAHRVNATGARVLAEACSAAGSRLVHVSTDYVFDGSACRPYPEDA 127

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           PT PL IYG+SK  GE  V      ++++RTAWVY + G NF+ ++LRLA ER ++ VV 
Sbjct: 128 PTQPLGIYGQSKRDGEVAVLEGDGEHLVVRTAWVYGVGGPNFVRTILRLAGEREQLRVVA 187

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE- 235
           DQ G+PT    +A A++ +     E       GI+H+T + G  SW DFA  I  E+   
Sbjct: 188 DQVGSPTWTFDLAAALVGLTKAQAEG------GIYHVT-NSGVTSWYDFAVAIVEEAQAL 240

Query: 236 -RGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            R      V  I T +YPT A RPAYS L  ++        +  W++ +R +L  +
Sbjct: 241 GRALKLQSVVPITTAEYPTPAARPAYSVLSNTRALRVLGGPLPQWRQSLRRMLQQL 296


>gi|90962540|ref|YP_536456.1| dTDP-4-dehydrorhamnose reductase [Lactobacillus salivarius UCC118]
 gi|90821734|gb|ABE00373.1| dTDP-4-dehydrorhamnose reductase [Lactobacillus salivarius UCC118]
          Length = 278

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 156/294 (53%), Gaps = 21/294 (7%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK L+ G NGQ+ Q +  +  +   E +      +D+   K   ++F    P+V+ + AA
Sbjct: 1   MKILITGANGQLGQEMQHLLDERGQEYLAEDSQGLDITDKKAVDAYFEKNKPEVVYHCAA 60

Query: 60  YTAVDKAEDE-PEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF--S 116
           YTAVDKAE E  E+ + +N +G   IAKA   +G   +Y+STDYVFDG +RT  +     
Sbjct: 61  YTAVDKAEGEGKELNWKVNVDGTENIAKACQKVGATLLYVSTDYVFDG-NRTSGEYLPDD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           P  P N YGK+KLAGEE V  Y + Y I+RTAWVY  +G NF+ +ML LAK   +++VV 
Sbjct: 120 PKGPRNEYGKAKLAGEEAVQKYCDKYYIIRTAWVYGQWGHNFVYTMLNLAKNHDKLTVVD 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G PT    +A  +  +  N IE       G++H   D G  SW +FA+ I  ++   
Sbjct: 180 DQIGRPTWTRTLAEFLTYLVDNKIE------YGVYHCCND-GQCSWYEFAKEILKDTDVD 232

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             P      + + QYPT A RP YS +   KLA         WKE +   L  +
Sbjct: 233 VQP------VTSDQYPTAAFRPHYSVM---KLAKETGFVFPDWKEALDEFLSEV 277


>gi|118580513|ref|YP_901763.1| dTDP-4-dehydrorhamnose reductase [Pelobacter propionicus DSM 2379]
 gi|118503223|gb|ABK99705.1| dTDP-4-dehydrorhamnose reductase [Pelobacter propionicus DSM 2379]
          Length = 280

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 106/284 (37%), Positives = 153/284 (53%), Gaps = 15/284 (5%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           LVIG NG +   L ++       + V   D+D+   +       S  P V+IN AAYT V
Sbjct: 3   LVIGCNGMLGSDLMTLLEGRGRGVDV--RDLDITSLESTERLLTSLKPSVVINCAAYTDV 60

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D  E   E A  +NAEG   +A+    IG   + ISTDYVFDG   +P  E   T PL++
Sbjct: 61  DGCESNRETAMLVNAEGVANLARVTRGIGARLVQISTDYVFDGAKGSPYLEDDQTAPLSV 120

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG+SKL GE   A+   +++I+RT W+Y + G+NF+ +MLRL  ER  ++VV DQ G+PT
Sbjct: 121 YGQSKLLGERNAAT-NPDHLIVRTQWLYGLQGNNFVETMLRLGTERECLTVVDDQIGSPT 179

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKV 243
             + ++RAI+ +            RG +H  A+ G  SW +FA  IF E+    G   +V
Sbjct: 180 WTVDLSRAILALLAR-------GCRGTYH-AANAGFCSWNEFARAIFREA----GLGVRV 227

Query: 244 YRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             + T+Q    A RP YS LDCSKL      R+ +W + + + +
Sbjct: 228 EPMTTEQLNRPAKRPLYSTLDCSKLERDTGFRLQSWGDALTDYM 271


>gi|254500084|ref|ZP_05112236.1| dTDP-4-dehydrorhamnose reductase [Labrenzia alexandrii DFL-11]
 gi|222441382|gb|EEE48060.1| dTDP-4-dehydrorhamnose reductase [Labrenzia alexandrii DFL-11]
          Length = 298

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 151/280 (53%), Gaps = 4/280 (1%)

Query: 2   KCLVIGNNGQIAQSLSSM-CVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + L+ G  GQ+  SL ++   +  E++   R +IDL      +SF      D II+  AY
Sbjct: 3   RILITGGTGQVGGSLGNLNWPEGTELVLPSRSEIDLGNADQISSFVRDGGFDAIISSGAY 62

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAED+   AF +N     A A+ A  + IP ++ISTDYVF+G       E  P +P
Sbjct: 63  TAVDKAEDDLLTAFKVNGLAPAAFAETAKELDIPVVHISTDYVFNGGKIGRYVETDPIDP 122

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
             +YG SK AGE  + S    +VILRTAWV+S  G+NF+ +M+RLA +R +++VV DQ G
Sbjct: 123 QGVYGASKAAGELAIQSSGCRHVILRTAWVFSAIGANFVKTMIRLA-DRPQLTVVDDQTG 181

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT+A  IARA   +    + + D    G++H   D   V+W  FA  IF     R    
Sbjct: 182 CPTAAPDIARAAQAVVLRQLTDRDAP-SGVYHFCGDEA-VTWFGFASEIFRLLEARSLAV 239

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
             V  I T+ YPT A RPA S LD S+L     I    W+
Sbjct: 240 PAVAPIPTRDYPTPAKRPANSALDTSRLTQDFGIEPCQWR 279


>gi|193222279|emb|CAL61334.2| dTDP-4-dehydrorhamnose reductase (dTDP-4-keto-L-rhamnose reductase)
           (dTDP-6-deoxy-L-mannose dehydrogenase) (dTDP-L-rhamnose
           synthetase) [Herminiimonas arsenicoxydans]
          Length = 293

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 108/293 (36%), Positives = 155/293 (52%), Gaps = 13/293 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G  GQ+   L        EI+ + R  +DL           S  P +IINPAAY
Sbjct: 1   MKILLTGKTGQVGYELERTLQGLGEIVALDRQQMDLANLDQVRDVIRSVKPQLIINPAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD AE  P++A  INA+  G +A  A  +G   I+ STDYVFDG       E    +P
Sbjct: 61  TAVDLAESAPDLAMRINADAPGVMAAEAKKLGAAMIHYSTDYVFDGDKAESYTEEDVPHP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YG+SKLAGE+ + +    ++ILRT+W+Y + G NFLL++ RLA+ER E+ +V DQFG
Sbjct: 121 QSVYGRSKLAGEQAIQAAGIPHLILRTSWIYGLRGKNFLLTVQRLAQERDELRIVADQFG 180

Query: 181 TPTSALQI----ARAIIQI-----AHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFW 231
            PT +  +    A AI Q+       N+   + ++  G++H+TA  G  SW  F + I  
Sbjct: 181 APTWSRTLAEVTAHAICQLQGGGTQANVDHAAWSAHSGLYHVTAQ-GRTSWHGFTQAIIA 239

Query: 232 ESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
            S+    P  KV  I T+ YP  A RP  S L   +       R+  W+  ++
Sbjct: 240 HSSGLKQP--KVTPIATQDYPLPAKRPQNSVLSSQRFMQAF-CRLPEWEAALK 289


>gi|227891401|ref|ZP_04009206.1| dTDP-4-dehydrorhamnose reductase [Lactobacillus salivarius ATCC
           11741]
 gi|227866790|gb|EEJ74211.1| dTDP-4-dehydrorhamnose reductase [Lactobacillus salivarius ATCC
           11741]
          Length = 278

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 110/294 (37%), Positives = 157/294 (53%), Gaps = 21/294 (7%)

Query: 1   MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK L+ G NGQ+ Q +  +   +  E +      +D+   +   ++F    P+V+ + AA
Sbjct: 1   MKILITGANGQLGQEMQHLLDGRGQEYLAEDSQGLDITDKEAVDAYFEKNKPEVVYHCAA 60

Query: 60  YTAVDKAEDE-PEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF--S 116
           YTAVDKAE E  E+ + +N +G   IAKA   +G   +Y+STDYVFDG +RT  +     
Sbjct: 61  YTAVDKAEGEGKELNWKVNVDGTENIAKACQKVGATLLYVSTDYVFDG-NRTSGEYLPDD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           P  P N YGK+KLAGEE V  Y + Y I+RTAWVY  +G NF+ +ML LAK   +++VV 
Sbjct: 120 PKGPRNEYGKAKLAGEEAVQKYCDKYYIIRTAWVYGQWGHNFVYTMLNLAKNHDKLTVVD 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G PT    +A  +  +  N +E       G++H   D G  SW +FA+ I  ++   
Sbjct: 180 DQVGRPTWTRTLAEFLTYLVDNKVE------YGVYHCCND-GQCSWYEFAKEILKDTDVD 232

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             P      + + QYPT A RP YS +   KLA       S WKE +   L  +
Sbjct: 233 VQP------VTSDQYPTAAFRPHYSVM---KLAKETGFVFSDWKEALDEFLSEV 277


>gi|187934268|ref|YP_001887435.1| dTDP-4-dehydrorhamnose reductase [Clostridium botulinum B str.
           Eklund 17B]
 gi|187722421|gb|ACD23642.1| dTDP-4-dehydrorhamnose reductase [Clostridium botulinum B str.
           Eklund 17B]
          Length = 280

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 152/288 (52%), Gaps = 13/288 (4%)

Query: 4   LVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
           LV G NGQ+   +   +  +D+E + +   D+D+   K    + L+  P+ +I+ AAYTA
Sbjct: 3   LVTGVNGQLGYDVVKELNKRDIECLGIDIKDLDITDDKAVNEYILNLKPECVIHCAAYTA 62

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VDKAEDE EI   +N  G   IAKA   I    +YISTDYVFDGL   P +     NPL+
Sbjct: 63  VDKAEDEEEICTKVNVYGTENIAKACKEIDTKMVYISTDYVFDGLGDKPFEVDGNINPLS 122

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YGK+K  GE KV    + Y I+R +WV+ I G+NF+  MLRL  E+  ++VV DQ G+P
Sbjct: 123 VYGKTKYKGELKVKEILDKYFIVRISWVFGINGNNFINIMLRLGAEKESLNVVSDQIGSP 182

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
           T    +A  +  +         +   G++H T +    SWA+FAE I     +  G   K
Sbjct: 183 TYTADLAPLLCDMVI-------SEKYGVYHATNE-RTCSWAEFAEEIM----KMAGLNCK 230

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           +  I T +YPTKA RP  S L    L +     +  WK  +   L  +
Sbjct: 231 INYIQTSEYPTKAVRPFNSRLSKKSLVDNGFELMPEWKNALERYLTEL 278


>gi|240144746|ref|ZP_04743347.1| dTDP-4-dehydrorhamnose reductase [Roseburia intestinalis L1-82]
 gi|257203267|gb|EEV01552.1| dTDP-4-dehydrorhamnose reductase [Roseburia intestinalis L1-82]
          Length = 291

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 164/293 (55%), Gaps = 24/293 (8%)

Query: 2   KCLVIGNNGQIAQSL-SSMCVQDVEIIRV------GRPDIDLLKPKDFASFFLSFSPDVI 54
           K LV G NGQ+ +++      +DV  I        G   +D+       +   +  PDVI
Sbjct: 4   KILVTGCNGQLGRAIRQEYKGEDVSFINTDVAEGEGIVALDITDVNAVLALVRAERPDVI 63

Query: 55  INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDE 114
           IN AA+T VD  E + + A+ INA G   ++ AA  +G   I++STDYVF+G    P  E
Sbjct: 64  INCAAHTNVDACEQQWDAAYRINAIGPRNLSIAAREVGAKMIHVSTDYVFEGNGTKPYTE 123

Query: 115 FSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISV 174
           F   +P++ YGK+K  GE+ V  + + Y I RTAW+Y   G NF+ +MLRLA+   E+SV
Sbjct: 124 FDEIHPVSAYGKTKAEGEKFVREFADRYFIFRTAWLYGD-GKNFVKTMLRLAESHDEVSV 182

Query: 175 VCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
           VCDQ G+PTSA+++ARAI    H+      T   G FH T + G  +WA FAE IF    
Sbjct: 183 VCDQQGSPTSAVELARAI----HHF---EPTENYGTFHATCE-GDTNWAAFAEAIF---- 230

Query: 235 ERGGPYSKVYRIFTKQY----PTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
           +R G  +KV  + ++QY    P  A+RPAYS L+   +  T   +++ W++ +
Sbjct: 231 KRAGKTTKVNHVTSEQYAKMNPASANRPAYSILENYMMKLTDGYKMAEWQDAL 283


>gi|52696135|pdb|1VL0|A Chain A, Crystal Structure Of A Dtdp-4-Dehydrorhamnose Reductase,
           Rfbd Ortholog (Ca_c2315) From Clostridium Acetobutylicum
           Atcc 824 At 2.05 A Resolution
 gi|52696136|pdb|1VL0|B Chain B, Crystal Structure Of A Dtdp-4-Dehydrorhamnose Reductase,
           Rfbd Ortholog (Ca_c2315) From Clostridium Acetobutylicum
           Atcc 824 At 2.05 A Resolution
 gi|52696137|pdb|1VL0|C Chain C, Crystal Structure Of A Dtdp-4-Dehydrorhamnose Reductase,
           Rfbd Ortholog (Ca_c2315) From Clostridium Acetobutylicum
           Atcc 824 At 2.05 A Resolution
          Length = 292

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 154/284 (54%), Gaps = 14/284 (4%)

Query: 2   KCLVIGNNGQIAQSLSSMCV-QDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           K L+ G NGQ+ + +      ++VE+I     D+D+        FF    P+V+IN AA+
Sbjct: 14  KILITGANGQLGREIQKQLKGKNVEVIPTDVQDLDITNVLAVNKFFNEKKPNVVINCAAH 73

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDK E++ ++A+ INA G   +A AA S+G   + ISTDYVFDG ++ PI EF   NP
Sbjct: 74  TAVDKCEEQYDLAYKINAIGPKNLAAAAYSVGAEIVQISTDYVFDGEAKEPITEFDEVNP 133

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            + YGK+KL GE  V +    Y I+RTAW+Y   G+NF+ + + L K   E+ VV DQ G
Sbjct: 134 QSAYGKTKLEGENFVKALNPKYYIVRTAWLYGD-GNNFVKTXINLGKTHDELKVVHDQVG 192

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPTS + +AR ++++        D    G FH T   G  SW DFA  IF       G  
Sbjct: 193 TPTSTVDLARVVLKVI-------DEKNYGTFHCTCK-GICSWYDFAVEIF----RLTGID 240

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
            KV    T+++P  A RP YS L    L  T       WKE ++
Sbjct: 241 VKVTPCTTEEFPRPAKRPKYSVLRNYXLELTTGDITREWKESLK 284


>gi|229016573|ref|ZP_04173513.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus AH1273]
 gi|229022780|ref|ZP_04179304.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus AH1272]
 gi|228738592|gb|EEL89064.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus AH1272]
 gi|228744749|gb|EEL94811.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus AH1273]
          Length = 284

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 158/288 (54%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSLSS-MCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+             +P +II+ AAY
Sbjct: 4   RVIITGANGQLGKQLQEELNPEEYDIYPFDKKLLDVTNISRVQQVVQEINPHIIIHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD AE E ++A+ INA GA  IA A+  +G   +YISTDYVF G      DEF    P
Sbjct: 64  TKVDHAEKEQDLAYLINAIGARNIAVASQLVGAKLVYISTDYVFQGDRPDGYDEFYSPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G NF+ +M+RL KER E+SVV DQ G
Sbjct: 124 INIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGKNFVKTMMRLGKEREELSVVADQIG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  +    
Sbjct: 184 SPTYVADLNMIINKLIH-------TSLYGTYHVS-NRGSCSWFEFAQKIFLYANMK---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++ + A RP YS    S L      ++S+W+EG+    +
Sbjct: 232 VNVLPVSTEEFGSAAARPKYSIFQHSMLRLNGFAQMSSWEEGLERFFI 279


>gi|291534624|emb|CBL07736.1| dTDP-4-dehydrorhamnose reductase [Roseburia intestinalis M50/1]
          Length = 290

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 164/293 (55%), Gaps = 24/293 (8%)

Query: 2   KCLVIGNNGQIAQSL-SSMCVQDVEIIRV------GRPDIDLLKPKDFASFFLSFSPDVI 54
           K LV G NGQ+ +++      +DV  I        G   +D+       +   +  PDVI
Sbjct: 3   KILVTGCNGQLGRAIRQEYKGEDVSFINTDVAEGEGIVALDITDVNAVLALVRAERPDVI 62

Query: 55  INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDE 114
           IN AA+T VD  E + + A+ INA G   ++ AA  +G   I++STDYVF+G    P  E
Sbjct: 63  INCAAHTNVDACEQQWDAAYRINAIGPRNLSIAAREVGAKMIHVSTDYVFEGNGTKPYTE 122

Query: 115 FSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISV 174
           F   +P++ YGK+K  GE+ V  + + Y I RTAW+Y   G NF+ +MLRLA+   E+SV
Sbjct: 123 FDEIHPVSAYGKTKAEGEKFVREFADRYFIFRTAWLYGD-GKNFVKTMLRLAESHDEVSV 181

Query: 175 VCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
           VCDQ G+PTSA+++ARAI    H+      T   G FH T + G  +WA FAE IF    
Sbjct: 182 VCDQQGSPTSAVELARAI----HHF---EPTENYGTFHATCE-GDTNWAAFAEAIF---- 229

Query: 235 ERGGPYSKVYRIFTKQY----PTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
           +R G  +KV  + ++QY    P  A+RPAYS L+   +  T   +++ W++ +
Sbjct: 230 KRAGKTTKVNHVTSEQYAKMNPASANRPAYSILENYMMKLTDGYKMAEWQDAL 282


>gi|149925746|ref|ZP_01914010.1| dTDP-4-dehydrorhamnose reductase [Limnobacter sp. MED105]
 gi|149825863|gb|EDM85071.1| dTDP-4-dehydrorhamnose reductase [Limnobacter sp. MED105]
          Length = 337

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 114/315 (36%), Positives = 163/315 (51%), Gaps = 29/315 (9%)

Query: 1   MKCLVIGNNGQIAQSLSS------MCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVI 54
           ++ LV+G  GQ+  ++        M   D   I  GR   DL K     +      PDV+
Sbjct: 25  IRVLVLGAQGQLGHTIGQHAKPALMETMDA-CISYGRDKADLSKLDTLINALKDIRPDVV 83

Query: 55  INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDE 114
           IN AAYT V+KAE E E+A +INA+  G +A+     G+  ++ STDYVFDG +  P  E
Sbjct: 84  INAAAYTNVEKAETETELAHTINAKAVGILAEQCKKQGVALVHYSTDYVFDGKASQPYTE 143

Query: 115 FSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISV 174
              TNPL+ YGKSKL GE+ +     N+V+ RT+WVY   G+NF  +M++LA+ER  + V
Sbjct: 144 TDATNPLSAYGKSKLEGEKYLKEVGGNWVVFRTSWVYGQRGNNFCRTMIKLAQERDTLKV 203

Query: 175 VCDQFGTPTSALQIARAIIQIAHNLIEN-----------------SDTSLRGIFHMTADG 217
           V DQ G PT A  +A   + +A  +  +                 S+     IFH +A  
Sbjct: 204 VDDQTGAPTPANWLAELGLTVAGVVAMHRYKTMGKLAPTFLPDFPSEIPSGEIFHASA-A 262

Query: 218 GPVSWADFAEYIFWESAERGGPYSK---VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNI 274
           G  +W D+A  +  E+A + G   +   + R  T      A RPAYS LD +KL NT  +
Sbjct: 263 GVTTWFDYA-CLAIENAHKQGIVQRMPNIERASTSSMNFAAQRPAYSVLDNTKLMNTFRV 321

Query: 275 RISTWKEGVRNILVN 289
               W +GVRN ++N
Sbjct: 322 NPPEWTKGVRNFVLN 336


>gi|254516000|ref|ZP_05128060.1| dTDP-4-dehydrorhamnose reductase [gamma proteobacterium NOR5-3]
 gi|219675722|gb|EED32088.1| dTDP-4-dehydrorhamnose reductase [gamma proteobacterium NOR5-3]
          Length = 298

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 118/291 (40%), Positives = 161/291 (55%), Gaps = 9/291 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K ++ G  GQ+  +L       +E+  + R D D+       +   +  PD++IN AAYT
Sbjct: 8   KVMISGAAGQLGSALCLSAPPSIELCALSRADCDISDSTAVEAALDAQRPDLLINAAAYT 67

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD+AE+E   AF+ NAE  G +A+A  + GI   ++STD+VFDGL  +P  E + T PL
Sbjct: 68  AVDRAEEESAAAFAANAEAPGTLARACAARGIRFFHVSTDFVFDGLRSSPYPEDAATAPL 127

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
            +YG+SK AGE+       + +ILRT WVYS  G NF+ +MLRL     EISVV DQ GT
Sbjct: 128 GVYGESKRAGEQATLDSGADCLILRTGWVYSHDGQNFMRTMLRLHGSHDEISVVADQVGT 187

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG--GP 239
           PT AL +A A+   AH         L GI+H + D G  SW DFA  I  E+   G    
Sbjct: 188 PTDALSLAGALWAAAHR------PGLSGIYHWS-DAGVCSWYDFALAIGEEAFALGLLPK 240

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            + V  I TK YPT A RPAYS LD ++      I  + W+  +R +L  +
Sbjct: 241 VAAVKPIRTKDYPTPAQRPAYSVLDKTRSWQDFEIPPTHWRSQLRAVLTRL 291


>gi|313202901|ref|YP_004041558.1| dtdp-4-dehydrorhamnose reductase [Paludibacter propionicigenes WB4]
 gi|312442217|gb|ADQ78573.1| dTDP-4-dehydrorhamnose reductase [Paludibacter propionicigenes WB4]
          Length = 290

 Score =  181 bits (460), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 107/289 (37%), Positives = 156/289 (53%), Gaps = 11/289 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           K LV G NGQ+   +  +    +    I     ++D+   +           ++I+N AA
Sbjct: 3   KILVTGANGQLGNEMRKLAPISKTNTFIFTDIEELDITNQEAIRILIQQEQIEIIVNCAA 62

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VDKAED+ E+A  IN +    +A     +G   I++STDYVF G   TP  E   TN
Sbjct: 63  YTNVDKAEDDSEMANLINNKAVENLAIVCQDVGATLIHVSTDYVFQGTKNTPCREDEQTN 122

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PL +YG++KLAGE+ V +    Y+I RTAW+YS FGSNF+ +M+RL  ER ++SVV DQ 
Sbjct: 123 PLGVYGQTKLAGEQSVQNSGCKYLIFRTAWLYSAFGSNFVKTMIRLTDEREKLSVVFDQV 182

Query: 180 GTPTSALQIARAIIQIAHNLIENSD-TSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
           GTPT A  +A  I Q     IE     +L GI+H + + G  SW DFA  I   +A    
Sbjct: 183 GTPTYAGDLAALIFQT----IETKQYETLNGIYHYSNE-GVCSWYDFAIEI---AALAAH 234

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               +    + ++P+K  RPA+S LD +K+    N ++  WK  ++  +
Sbjct: 235 DTCDIQPCHSDEFPSKVKRPAFSVLDKTKVKADFNCKVPHWKVSLQKCM 283


>gi|13650069|gb|AAK37552.1|AF349575_3 putative dTDP-4-rhamnose reductase [Azospirillum brasilense]
 gi|46241699|gb|AAS83084.1| putative dTDP-4-rhamnose reductase [Azospirillum brasilense]
          Length = 309

 Score =  181 bits (460), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 119/293 (40%), Positives = 162/293 (55%), Gaps = 6/293 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           +  LV G NGQ+   L        +  + + R   D+   K  ++   +  P +++N +A
Sbjct: 9   LPVLVFGANGQVGFELRRAAWAPGLAPLGLDRASGDVTDAKAVSAAIAAHRPALVVNASA 68

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRT-PIDEFSPT 118
           YTAVDKAE E + AF++N +G   +A+A  + G+P I+ISTDYVFDG S+T P  E  P 
Sbjct: 69  YTAVDKAESERDTAFAVNRDGPANLARACAAAGVPLIHISTDYVFDGTSKTTPWSESDPV 128

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P  +Y  SKLAGEE V     ++VILRTAWV+   G NF+ +MLRLA+ER E+ VV DQ
Sbjct: 129 APQGVYAASKLAGEEAVRDAQPDHVILRTAWVFGAHGHNFVKTMLRLARERDELRVVADQ 188

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
            G PT A  IA AI  IA   +     +  G FH    G P  +W  FAE I   +A R 
Sbjct: 189 HGCPTPAAAIAAAIATIAQARLTGEGWTP-GTFHY--GGAPATTWHGFAERIVDRAAARI 245

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G    V  I T  +PT A RPA S LD ++L   + I  + W  G+  +L +I
Sbjct: 246 GRRPAVTAITTADFPTPARRPANSVLDTARLGQAYGIPPADWMAGLDRVLDDI 298


>gi|291520151|emb|CBK75372.1| dTDP-4-dehydrorhamnose reductase [Butyrivibrio fibrisolvens 16/4]
          Length = 286

 Score =  181 bits (460), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 114/296 (38%), Positives = 163/296 (55%), Gaps = 23/296 (7%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKP------KDFASFFLSFSPDVII 55
           K LV G NGQ+ +++ +    +VE I     + + + P       +  SF  +  PDVII
Sbjct: 3   KILVTGCNGQLGRAIQNEYKDEVEFILTDVVEGEKISPLNIMDLDEVLSFVEAKKPDVII 62

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AA T VD  E + + A+ +NA G   +A AA  +G   +++STDYVF G   +PI EF
Sbjct: 63  NCAAATNVDGCEKDWDFAYKLNALGPRNLAIAASKVGAKLVHVSTDYVFPGNGSSPITEF 122

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
               P++ YGK+K  GE+ V  + + + I+RTAW+Y   G NF+ +ML LA+   E+SVV
Sbjct: 123 DQPAPISAYGKTKYEGEKFVQQFADKWFIVRTAWLYGD-GKNFVKTMLSLAETHDELSVV 181

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           CDQ G+PTSA+++AR I    H+L     T   GIFH T +G   +WADF E IF     
Sbjct: 182 CDQLGSPTSAVELARMI----HHL---EPTENYGIFHGTCEGD-TNWADFTEEIF----R 229

Query: 236 RGGPYSKVYRIFTKQY----PTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
             G   KV  + +++Y    P  A RP YS LD   L  T   R++ WK+ +   L
Sbjct: 230 LKGINVKVNHVTSEEYKRMNPASADRPHYSILDNYMLRLTSGYRMADWKDALAEYL 285


>gi|330368663|gb|AEC11784.1| dTDP-4-keto-L-rhamnose reductase [Brachyspira hyodysenteriae]
          Length = 286

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 105/271 (38%), Positives = 148/271 (54%), Gaps = 19/271 (7%)

Query: 5   VIGNNGQIAQS-LSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           +IG NG +AQ  L      ++E       +ID+       +F    +   IIN +AYT V
Sbjct: 4   IIGKNGMLAQDILQVFNKNNIEYTSTA-SNIDITNIDILNNFIKDKNIKTIINCSAYTKV 62

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D AEDE +I + +N EG   I + A +I    I+ STDYVFDG +  P +E   TNP+NI
Sbjct: 63  DLAEDEKDICYKVNGEGVKNITEIASNINADLIHFSTDYVFDGENNKPYNEEDKTNPINI 122

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YGKSKL GE+   SY N  +++R +W+Y I+G NF+ +M+ L   +  I VV DQFG+PT
Sbjct: 123 YGKSKLEGEKYALSY-NKSIVIRVSWLYGIYGKNFVYTMINLMNSKESIKVVNDQFGSPT 181

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS-- 241
               +A  I  I  N     +    G++H T + G +SW DFA+ I+     +G  Y+  
Sbjct: 182 YTEDVAMVIYDIIKN-----NNFYYGLYHYTNE-GDISWYDFAKTIY----NKGKEYNII 231

Query: 242 ----KVYRIFTKQYPTKAHRPAYSCLDCSKL 268
               KV    T++YPTKA RP YS L   K+
Sbjct: 232 NNDCKVNPCTTEEYPTKAKRPKYSVLSVEKI 262


>gi|237711070|ref|ZP_04541551.1| dTDP-4-dehydrorhamnose reductase [Bacteroides sp. 9_1_42FAA]
 gi|229454914|gb|EEO60635.1| dTDP-4-dehydrorhamnose reductase [Bacteroides sp. 9_1_42FAA]
          Length = 287

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 108/287 (37%), Positives = 159/287 (55%), Gaps = 14/287 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSP---DVIINP 57
           M  LV G NGQ+   +  M             D++ L   DF +   +       +I+N 
Sbjct: 1   MNVLVTGANGQLGNEMRLMAQNSSH--HYIFTDVEELDITDFNAILQTVKEKEIQIIVNC 58

Query: 58  AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSP 117
           AAYT VDKAE++ +IA ++N    G +A  A +     I+ISTDYVF+G +  P  E   
Sbjct: 59  AAYTNVDKAENDFDIANALNNIAVGRLANVAKAQNATLIHISTDYVFNGNNHIPYTEDDI 118

Query: 118 TNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD 177
           T+P+ +YGK+KLAGEE +     NY+ILRTAW+YS +G+NF+ +M +L  E+  +SV+ D
Sbjct: 119 TDPIGVYGKTKLAGEETIKKVGCNYIILRTAWLYSKWGNNFVKTMQKLTLEKDILSVIFD 178

Query: 178 QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
           Q G+PT A  +A AI  I    IE +  + +GI+H + + G  SW DFA+    E  E  
Sbjct: 179 QIGSPTYAKDLAHAISLI----IERNMLNQQGIYHYSNE-GVCSWFDFAK----EICELS 229

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           G    +  I ++ YP+K  RP YS LD +K   T  I +  WK+ ++
Sbjct: 230 GHNCNITPIHSQDYPSKVTRPHYSVLDKTKFKETFGIPVPYWKDSLK 276


>gi|300215155|gb|ADJ79571.1| dTDP-4-dehydrorhamnose reductase [Lactobacillus salivarius CECT
           5713]
          Length = 278

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 155/294 (52%), Gaps = 21/294 (7%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK L+ G NGQ+ Q +  +  +   E +      +D+   +   ++F    P+V+ + AA
Sbjct: 1   MKVLITGANGQLGQEMQHLLDERGQEYLAEDSQGLDITDKEAVDAYFEKNKPEVVYHCAA 60

Query: 60  YTAVDKAEDE-PEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF--S 116
           YTAVDKAE E  E+ + +N +G   IAKA   +G   +Y+STDYVFDG +RT  +     
Sbjct: 61  YTAVDKAEGECKELNWKVNVDGTENIAKACQKVGATLLYVSTDYVFDG-NRTSGEYLPDD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           P  P N YGK+KLAGEE V  Y N Y I+RTAWVY  +G NF+ +ML LAK   +++VV 
Sbjct: 120 PKGPRNEYGKAKLAGEEAVQKYCNKYYIIRTAWVYGQWGHNFVYTMLNLAKNHDKLTVVD 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G PT    +A  +  +  N IE       G++H   D G  SW +FA+ I   +   
Sbjct: 180 DQVGRPTWTRTLAEFLTYLVDNKIE------YGVYHCCND-GQCSWYEFAKEILKNTDVD 232

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             P      + + QYPT A RP YS +   KLA         WKE +   L  +
Sbjct: 233 VQP------VTSDQYPTAAFRPHYSVM---KLAKETGFVFPDWKEALDEFLSEV 277


>gi|54293741|ref|YP_126156.1| dTDP-4-keto-L-rhamnose reductase [Legionella pneumophila str. Lens]
 gi|53753573|emb|CAH15028.1| dTDP-4-keto-L-rhamnose reductase [Legionella pneumophila str. Lens]
          Length = 294

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 158/290 (54%), Gaps = 5/290 (1%)

Query: 1   MKCLVIGNNGQIA-QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G NGQ+  + +      + E+    R  +D  K +          PD+IIN AA
Sbjct: 1   MKILVTGANGQVGTEIIKRFSSSEHEVSPCTRDILDCFKLERVQDVLSEIKPDLIINAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAEDEP++A  +NAE    +        IP I++STDYVFDG       E    +
Sbjct: 61  YTAVDKAEDEPDLAHIVNAEFVCRLVNYCSFKNIPLIHLSTDYVFDGEKEGAYHETDIPH 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P++ YG++K  GE+ + S    Y+ILR +WV+   G NF+ ++L LA  R+E+++V DQ+
Sbjct: 121 PVSTYGRTKWEGEQAILSQLKKYIILRVSWVFGEQGKNFVKTILNLASSRKELNIVSDQW 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG-- 237
           G PTSA  IAR + +I    I +S     G++H  A  G  +W +FA      + E+   
Sbjct: 181 GRPTSARDIARVLFEIVQK-ISHSSFDYWGLYHY-AGQGVTNWHEFANVFLNMAKEKQLL 238

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              + +  I +++YPT+A RP  S LD +K+     I+  +WK  + +++
Sbjct: 239 LTLTDLNPIKSEEYPTRATRPKNSVLDTTKIETILGIKSCSWKNDLPDVI 288


>gi|167586361|ref|ZP_02378749.1| dTDP-4-dehydrorhamnose reductase [Burkholderia ubonensis Bu]
          Length = 302

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 103/296 (34%), Positives = 156/296 (52%), Gaps = 7/296 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+IG  GQ+   L    +   E+  V R  +DL  P        +  PDVI+N AAY
Sbjct: 1   MRILLIGKRGQLGWELQRSLLPLGEVFAVDRQTLDLSSPLTIGPAIAAIRPDVIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE   E+A  +NA   G +A AA  +    ++ STDYVFDGL+  P  E    +P
Sbjct: 61  TAVDEAETHHELATMVNATAVGELAVAARKLNALLLHYSTDYVFDGLAEVPYREEVRPDP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
             +YG+SKLAGE+ +A    ++++ RT+WVY   G NFL ++ + A E+  + VV DQ G
Sbjct: 121 QTVYGRSKLAGEQAIADSGADWLVFRTSWVYGTNGRNFLRAIAKAACEQDALRVVADQRG 180

Query: 181 TPTSALQIARAIIQIAHNLIE---NSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
           TPT+   +A   +Q    +I+   + D S  G++H+T   G  +W  FA+ I    + RG
Sbjct: 181 TPTAVRVLADLSVQALRTVIQLRRSGDLSKLGLYHLTLR-GETTWHGFAQAIVCGMSARG 239

Query: 238 GP---YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                 ++V  I +      A RP YS LDCS+      +    W + +  +L ++
Sbjct: 240 VHDLRATRVDEITSSDLTRAARRPKYSVLDCSRFDAAFELARPAWDQALEIVLDDM 295


>gi|2500164|sp|Q46769|RMLD_ECOLX RecName: Full=dTDP-4-dehydrorhamnose reductase; AltName:
           Full=dTDP-4-keto-L-rhamnose reductase; AltName:
           Full=dTDP-6-deoxy-L-lyxo-4-hexulose reductase; AltName:
           Full=dTDP-6-deoxy-L-mannose dehydrogenase; AltName:
           Full=dTDP-L-rhamnose synthase
 gi|799233|gb|AAC63613.1| RmlD [Escherichia coli]
          Length = 301

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 161/296 (54%), Gaps = 13/296 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDI--DLLKPKDFASFFLSFSPDVIIN 56
           M  L+ G  GQ+   L      + ++  + V   D   D   P+  A       PDVI+N
Sbjct: 1   MNILLFGKTGQVGWELQRALAPLGNLIALDVHSTDYCGDFSNPEGVAETVKKIRPDVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AA+T VDKAE EPE A  +NA    AIAKAA+ +G   I+ STDYVF G    P    +
Sbjct: 61  AAAHTDVDKAESEPEFAQLLNATSVEAIAKAANEVGAWVIHYSTDYVFPGTGEIPWQGGT 120

Query: 117 -PTNPLNIYGKSKLAGEEK-VASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISV 174
             T PLN+YG++KL+ E+K +  +   ++I RT+WVY+  G+NF  +MLRLAKER E++V
Sbjct: 121 DATAPLNVYGETKLSSEKKALQKHCGKHIIFRTSWVYAGKGNNFAKTMLRLAKEREELAV 180

Query: 175 VCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
           + DQFG PT A  +A          ++  + +  G++H+ A GG  +W D+A  +F E A
Sbjct: 181 INDQFGRPTGAELLADCTAHAIRVAVDKPEVA--GLYHLVA-GGTTTWHDYAALVF-EEA 236

Query: 235 ERGG---PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            + G     +K+  + T  YPT A RP  S L+  K      + +  W+ GV+ +L
Sbjct: 237 RKAGINLALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRML 292


>gi|300775247|ref|ZP_07085109.1| dTDP-4-dehydrorhamnose reductase [Chryseobacterium gleum ATCC
           35910]
 gi|300505987|gb|EFK37123.1| dTDP-4-dehydrorhamnose reductase [Chryseobacterium gleum ATCC
           35910]
          Length = 287

 Score =  181 bits (460), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 105/286 (36%), Positives = 149/286 (52%), Gaps = 13/286 (4%)

Query: 2   KCLVIGNNGQIAQSLSSMC---VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           K  VIG+NGQ+   +  +        E +      +D+   +    FF    PD  IN +
Sbjct: 3   KIAVIGSNGQLGNCIKKIAPDFEHQYEFLFTDSSTLDVTSEEQVNDFFYENKPDYCINAS 62

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVD AE E E AF++NA+G   +A+A        I++STDYVFDG +  P  E   T
Sbjct: 63  AYTAVDLAEKEKEKAFAVNADGVAHLAQACAEYKSTLIHVSTDYVFDGTTNLPYSEDDFT 122

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           NP+ +YG+SK  GEE         +ILRT+W+YS F  NF+ +ML L  ++ E+ +V DQ
Sbjct: 123 NPVGVYGESKRKGEELALEINPKTIILRTSWLYSEFNKNFVKTMLHLFSQKDELGIVADQ 182

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
           FG PT+A  +A AI+QI       +     GIFH  ++    +W +FA+ I    AE   
Sbjct: 183 FGQPTNANDLAEAIMQIIQ-----TPQKTYGIFHF-SNYPETTWFEFAKKI----AEFSK 232

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
              K+  I T QYPT A RP  S +   K+  T+ I    W+  + 
Sbjct: 233 SPVKLNAITTDQYPTPAKRPVRSTMSLDKIEETYKIEPKHWENSLE 278


>gi|168216435|ref|ZP_02642060.1| dTDP-4-dehydrorhamnose reductase [Clostridium perfringens NCTC
           8239]
 gi|182381469|gb|EDT78948.1| dTDP-4-dehydrorhamnose reductase [Clostridium perfringens NCTC
           8239]
          Length = 294

 Score =  181 bits (460), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 109/302 (36%), Positives = 160/302 (52%), Gaps = 25/302 (8%)

Query: 1   MKCLVIGNNGQIAQSLSSMC-------------VQDVEIIRVGRPDIDLLKPKDFASFFL 47
           MK L+ G+NGQ+   L S+              +++ E+I +    +D+   ++  +   
Sbjct: 1   MKILITGSNGQLGNELQSIIKSGKAEIGSVSENIKNSEVIALDVDKLDITSLENVKNVLN 60

Query: 48  SFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGL 107
              PDV+IN AA T VD  E+  + AF +N+ GA  +A   + IG   + +STDYVF G+
Sbjct: 61  EEKPDVVINCAAATNVDGCENNEDFAFKVNSLGARNLAMVCEEIGAKLVQVSTDYVFSGV 120

Query: 108 SRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAK 167
              P+ EF  T P ++YGK+KL GE  V  + + Y I+RTAW+Y   G NF+ +M+RL K
Sbjct: 121 GEKPLTEFDLTAPYSVYGKTKLLGENYVKEFCSKYYIVRTAWLYGYVGHNFVYTMMRLGK 180

Query: 168 ERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAE 227
           E+  ++VV DQ G PT A  +A  I++    LIE   T   GI+H T   G  +W DFA+
Sbjct: 181 EKESLNVVNDQKGNPTHANDLAYHILK----LIE---TEEYGIYHCTGK-GECTWYDFAK 232

Query: 228 YIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            I  E AE       V    +++Y T A RP YS LD   L  T    +  WKE +++  
Sbjct: 233 EIM-ELAENK---CIVNPCTSEEYKTPAKRPEYSSLDNMMLRCTIGDEMRDWKEALKSFF 288

Query: 288 VN 289
            N
Sbjct: 289 KN 290


>gi|13539633|gb|AAK29184.1| unknown [Aggregatibacter actinomycetemcomitans]
          Length = 233

 Score =  181 bits (460), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 138/233 (59%), Gaps = 10/233 (4%)

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           A TAVD+AE E E + +IN +G   +A+ A S+    ++ISTDYVFDG S     E    
Sbjct: 1   APTAVDRAETEVERSEAINVKGPQYLAETAKSVDAAILHISTDYVFDGRSAGKYKETDAA 60

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
           +P  IYGK+KLAGE+ VA   + +++LRTAWV+   G+NF+ +MLRLAK R  + VV DQ
Sbjct: 61  DPQGIYGKTKLAGEQAVAEANDKFIVLRTAWVFCEHGNNFVKTMLRLAKTRDTLGVVADQ 120

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAERG 237
            G PT A  IA A+IQIA  +I        GI+H T  G P VSW DFA  IF E+  + 
Sbjct: 121 IGGPTYAGDIAAALIQIAEKIIAGESVEY-GIYHFT--GEPYVSWCDFARAIFDEAVSQN 177

Query: 238 ----GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
                P   V  I T  YPT A RPA SCLD +K+     I+ S W+  ++NI
Sbjct: 178 MLEKAPL--VNAITTADYPTPAKRPANSCLDLTKIQQAFGIQPSDWQRALKNI 228


>gi|228920042|ref|ZP_04083391.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228839498|gb|EEM84790.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 284

 Score =  181 bits (460), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 157/288 (54%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+              P +II+ AAY
Sbjct: 4   RVIITGANGQLGKQLFEELNSEEYDIYAFDKKLLDVTNISRIQQVVQEIKPHIIIHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD AE E ++A+ INA GA  +A A+  +G   +YISTDYVF G      DEF    P
Sbjct: 64  TKVDHAEKEQDLAYRINAIGARNVAVASQLVGAKLVYISTDYVFQGARPEGYDEFHSPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G+NF+ +M+RL KER EISVV DQ G
Sbjct: 124 VNIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMIRLGKERDEISVVADQVG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  +    
Sbjct: 184 SPTYVADLNMVINKLIH-------TSLYGTYHVS-NRGSCSWFEFAQKIFSYANMK---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++   A RP YS    + L     +++ +W+EG+    +
Sbjct: 232 VNVLPVSTEEFGAAAARPKYSIFQHNMLRLNGFLQMPSWEEGLERFFI 279


>gi|317487715|ref|ZP_07946311.1| RmlD substrate binding domain-containing protein [Eggerthella sp.
           1_3_56FAA]
 gi|316913172|gb|EFV34685.1| RmlD substrate binding domain-containing protein [Eggerthella sp.
           1_3_56FAA]
          Length = 300

 Score =  181 bits (459), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 106/307 (34%), Positives = 160/307 (52%), Gaps = 29/307 (9%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQD-------------VEIIRVGRPDIDLLKPKDFASFFL 47
           M+ LV G NGQ+   L  +  +               EI+     ++D+       ++  
Sbjct: 1   MRILVTGGNGQLGNELQRILREGRSEIGPIPDAYAGAEIVAADVDELDVTDADAVMAYVA 60

Query: 48  SFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGL 107
               D+I+N AA T VD  E   + AF +NAE  G +A+AA+++G   + +STDYVF G 
Sbjct: 61  QGGFDLIVNGAAMTNVDGCETAEDAAFRVNAEAPGNLARAAEAVGAKLVQVSTDYVFPGT 120

Query: 108 SRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAK 167
              P  E  PT P++ YG++KLAGEE+  +  +   ++RTAW+Y   G NF+ +M+RL  
Sbjct: 121 EPEPRVEDDPTGPVSAYGRTKLAGEERSLAACSRCFVVRTAWLYGYVGKNFVKTMMRLGA 180

Query: 168 ERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAE 227
           +R E++VV DQ G PTSA  +A  I++IA        T   G++H T + G  SWADFAE
Sbjct: 181 DRDEVTVVDDQLGNPTSANDLAHEILKIAS-------TEDYGVYHCTNE-GTCSWADFAE 232

Query: 228 YIFWESAERGGPYSKVYRIFTKQY----PTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
            +     E  G    V R  +++Y    P  A RPAYS L   +L +T    +  W++ +
Sbjct: 233 AVM----EGAGLDCAVIRCTSEEYAAMNPASAKRPAYSSLRNKRLEDTVGNEMRPWRDAL 288

Query: 284 RNILVNI 290
              L N+
Sbjct: 289 SAYLNNL 295


>gi|260911585|ref|ZP_05918170.1| dTDP-4-dehydrorhamnose reductase [Prevotella sp. oral taxon 472
           str. F0295]
 gi|260634291|gb|EEX52396.1| dTDP-4-dehydrorhamnose reductase [Prevotella sp. oral taxon 472
           str. F0295]
          Length = 282

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 110/293 (37%), Positives = 160/293 (54%), Gaps = 14/293 (4%)

Query: 1   MKCLVIGNNGQIAQS---LSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINP 57
           M  L+ G NGQ+      L +MC Q          ++D+        F  S     I+N 
Sbjct: 1   MNILITGCNGQLGNEIKLLQAMCAQHT-WFNTDVNELDITDKAAIEHFVESNEIGGIVNC 59

Query: 58  AAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSP 117
           AAYTAVDKAE +  +A  +NA+    +A+A    G   + +STDYVFDG   TP  E   
Sbjct: 60  AAYTAVDKAESDLLLARELNADAPAFLAEAVAKRGGWMVQVSTDYVFDGTKHTPYVESDE 119

Query: 118 TNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD 177
             P ++YG++KL GE+ VA +  N +I+RTAW+YS FG+NF+ +M+RL KER ++ V+ D
Sbjct: 120 PCPNSVYGQTKLEGEQAVAKFCPNSMIIRTAWLYSEFGNNFVKTMIRLGKEREQLGVIFD 179

Query: 178 QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
           Q GTPT A  +A AI+      I+       GI+H + + G  SW DF + I   S   G
Sbjct: 180 QVGTPTYAHDLATAIMTAIDKGIK------PGIYHFSNE-GVTSWYDFTKSIHRLS---G 229

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
               +V  + T +YPT A+RP+YS LD +K+  T+ I I  W+E +   +  +
Sbjct: 230 ITTCQVSPLHTVEYPTPANRPSYSVLDKTKIKTTYGIEIPHWEESLAKCIAKL 282


>gi|221201087|ref|ZP_03574127.1| dTDP-4-dehydrorhamnose reductase [Burkholderia multivorans CGD2M]
 gi|221206461|ref|ZP_03579474.1| dTDP-4-dehydrorhamnose reductase [Burkholderia multivorans CGD2]
 gi|221173770|gb|EEE06204.1| dTDP-4-dehydrorhamnose reductase [Burkholderia multivorans CGD2]
 gi|221178937|gb|EEE11344.1| dTDP-4-dehydrorhamnose reductase [Burkholderia multivorans CGD2M]
          Length = 300

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 111/288 (38%), Positives = 146/288 (50%), Gaps = 10/288 (3%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L+ G NGQ+   L         ++ + R  +DL +            PD+I+NPAAYTAV
Sbjct: 10  LLTGINGQVGFELQRTLQGLGNVVALDRSRLDLSRLDQVRDVVRDLKPDLIVNPAAYTAV 69

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D+AE +  +A  +NAE    +A+ A  IG   I+ STDYVF G    P  E    +P N+
Sbjct: 70  DQAETDVAMATRLNAEAPAVLAEEAKRIGAALIHYSTDYVFSGTKAGPYVEDDAVDPQNV 129

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG++KL GE  +A+    ++I RT+WVY   G NFLL+MLRL  ER E+ VV DQ G PT
Sbjct: 130 YGRTKLDGERAIAASGCAHLIFRTSWVYGTRGKNFLLTMLRLGAERDELKVVADQIGAPT 189

Query: 184 SALQIARAIIQIAHNLIENSDTSLR-------GIFHMTADGGPVSWADFAEYIFWESAER 236
            +  IA     I       SD           GI+H+ A G   SW  FAE IF  S   
Sbjct: 190 WSNTIATLTAHILAQAAGVSDADRHAWWRERSGIYHLCASGS-TSWHGFAEAIFDSSRLV 248

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
             P  KV  I    YPT A RPA S +  +KL+ T  I    W + +R
Sbjct: 249 RKP--KVKPIPASAYPTPAARPANSRMSGAKLSRTFGICAPDWHDALR 294


>gi|325830486|ref|ZP_08163941.1| dTDP-4-dehydrorhamnose reductase [Eggerthella sp. HGA1]
 gi|325487468|gb|EGC89908.1| dTDP-4-dehydrorhamnose reductase [Eggerthella sp. HGA1]
          Length = 302

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/307 (34%), Positives = 160/307 (52%), Gaps = 29/307 (9%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQD-------------VEIIRVGRPDIDLLKPKDFASFFL 47
           M+ LV G NGQ+   L  +  +               EI+     ++D+       ++  
Sbjct: 3   MRILVTGGNGQLGNELQRILREGRSEIGPIPDAYAGAEIVAADVDELDVTDADAVMAYVA 62

Query: 48  SFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGL 107
               D+I+N AA T VD  E   + AF +NAE  G +A+AA+++G   + +STDYVF G 
Sbjct: 63  QGGFDLIVNGAAMTNVDGCETAEDAAFRVNAEAPGNLARAAEAVGAKLVQVSTDYVFPGT 122

Query: 108 SRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAK 167
              P  E  PT P++ YG++KLAGEE+  +  +   ++RTAW+Y   G NF+ +M+RL  
Sbjct: 123 EPEPRVEDDPTGPVSAYGRTKLAGEERSLAACSRCFVVRTAWLYGYVGKNFVKTMMRLGA 182

Query: 168 ERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAE 227
           +R E++VV DQ G PTSA  +A  I++IA        T   G++H T + G  SWADFAE
Sbjct: 183 DRDEVTVVDDQLGNPTSANDLAHEILKIAS-------TEDYGVYHCTNE-GTCSWADFAE 234

Query: 228 YIFWESAERGGPYSKVYRIFTKQY----PTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
            +     E  G    V R  +++Y    P  A RPAYS L   +L +T    +  W++ +
Sbjct: 235 AVM----EGAGLDCAVIRCTSEEYAAMNPASAKRPAYSSLRNKRLEDTVGNEMRPWRDAL 290

Query: 284 RNILVNI 290
              L N+
Sbjct: 291 SAYLNNL 297


>gi|222109770|ref|YP_002552034.1| dtdp-4-dehydrorhamnose reductase [Acidovorax ebreus TPSY]
 gi|221729214|gb|ACM32034.1| dTDP-4-dehydrorhamnose reductase [Acidovorax ebreus TPSY]
          Length = 296

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 109/303 (35%), Positives = 160/303 (52%), Gaps = 21/303 (6%)

Query: 1   MKCLVIGNNGQIAQSLS-SMCVQDVEIIRVGRPDID-------LLKPKDFASFFLSFSPD 52
           M  L++G +GQ+   L  S+ V    + RV   D D          P+       +  PD
Sbjct: 1   MNILLLGKSGQVGWELQRSLAV----LGRVTALDHDSTEHCGDFANPEGVRETVRALRPD 56

Query: 53  VIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPI 112
           VI+N AA+TAVDKAE EPEIA  +NA   G +A+ A  +G   ++ STDYVFDG    P 
Sbjct: 57  VIVNAAAHTAVDKAESEPEIARLLNATTPGVLAEEAARLGTWLVHYSTDYVFDGSGTRPW 116

Query: 113 DEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREI 172
            E     PL++YG +KL GE+++      ++ILRT+WVY+  G NF  +MLRL  ER  +
Sbjct: 117 VETDAPAPLSVYGATKLEGEQRIQQTGCRHLILRTSWVYAARGGNFAKTMLRLGSERERL 176

Query: 173 SVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWE 232
           +V+ DQ+G PT A  +A        +L   S     G++H  A  G  +W  +A+Y+  E
Sbjct: 177 TVIDDQWGAPTGADLLADVTAHAVRHL--QSRPGDGGLYHCVAS-GETNWHSYAKYVL-E 232

Query: 233 SAERGGP-----YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            A +  P      ++V  + T  +PT A RP  S LD ++L  T  + +  W++GV  +L
Sbjct: 233 HARQAQPAIELKATEVAPVPTSAFPTPARRPHNSRLDTTRLQTTFGLVLPPWQQGVARML 292

Query: 288 VNI 290
             I
Sbjct: 293 TEI 295


>gi|94497767|ref|ZP_01304334.1| dTDP-4-dehydrorhamnose reductase [Sphingomonas sp. SKA58]
 gi|94422816|gb|EAT07850.1| dTDP-4-dehydrorhamnose reductase [Sphingomonas sp. SKA58]
          Length = 285

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 109/292 (37%), Positives = 156/292 (53%), Gaps = 13/292 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G  GQ+ + L +    D  ++ V   ++D+       +F     PD+I+N AAY
Sbjct: 1   MKTLITGAKGQLGRGLQATAPADATLLCVDVDELDITDSVAVGAFVTREKPDLILNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD+AE E + A +IN    G +A AA S+G   +++STD+VFDG +  P    + T P
Sbjct: 61  TAVDRAETEEDAAMAINGIATGTLADAARSVGARFVHVSTDFVFDGRAGIPYAPDAQTAP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L+ YG++KLAGE+       + +I+RTAWVY+  G NF+ +MLRL  ER E+ VV DQ G
Sbjct: 121 LSAYGRTKLAGEQLAGP---DALIVRTAWVYAPTGGNFVRTMLRLMAERPEVRVVADQIG 177

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG--G 238
           TPT A  +A A+  +A          + GI H T D G  SW DFA  I  E    G   
Sbjct: 178 TPTYAPGLASALWTMAGK-------GVSGIHHYT-DSGAASWYDFAVAIQEEGLASGLLS 229

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             +++  I T  YPT A RP  S LD +   +        W+  +R ++  I
Sbjct: 230 QEARIVPIPTSAYPTPAARPHCSVLDKASTFDALGGPTPHWRANLRVMMQAI 281


>gi|228961526|ref|ZP_04123136.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228798144|gb|EEM45147.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis serovar
           pakistani str. T13001]
          Length = 284

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/291 (36%), Positives = 157/291 (53%), Gaps = 13/291 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G NGQ+   +      Q +E+  +G  D+D+        F     PD II+ AA
Sbjct: 1   MKILVTGYNGQLGYDVVKRGEKQGLEMQGIGIEDLDITNEAAVYEFVDKVKPDAIIHCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDK+ED+ E+ +++N EG   +  AA  +    +YISTDYVFDG       E    N
Sbjct: 61  YTAVDKSEDDKELCWNVNVEGTKYLTTAAKKLNAKFVYISTDYVFDGEGTHAFVETDAPN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P+  YG +K  GE+ V S  +N  I+R +WV+ I G+NF+ +MLRL + R E++VV DQ 
Sbjct: 121 PVGYYGLTKHEGEKVVRSLIDNNFIVRISWVFGINGNNFIKTMLRLGETRNELNVVGDQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT    +AR ++ +         T   G +H T + G  SWA+FA+ IF    +  G 
Sbjct: 181 GSPTYTYDLARLLVDMVV-------TEKYGTYHATNE-GFCSWAEFAQEIF----KIAGQ 228

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             KV  I T++YPT+A RP  S +   KL +     +  WK+  ++ +  +
Sbjct: 229 DVKVNSITTEEYPTRAVRPKNSRMSKQKLIDNGFEPLQDWKKATKHYITQL 279


>gi|88860051|ref|ZP_01134690.1| dTDP-4-dehydrorhamnose reductase [Pseudoalteromonas tunicata D2]
 gi|88818045|gb|EAR27861.1| dTDP-4-dehydrorhamnose reductase [Pseudoalteromonas tunicata D2]
          Length = 289

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 117/295 (39%), Positives = 168/295 (56%), Gaps = 21/295 (7%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           K L+IG  GQ+AQ+L +    ++E++ VG  + D+ +     S    F P+VIIN AAYT
Sbjct: 7   KVLIIGRKGQLAQALLATKKANIEVLVVGSNEFDVTQLGTLRSIINQFKPEVIINAAAYT 66

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVD AE  PE A+ INA+    +AK      I  I +STDYVFDG  +TP        PL
Sbjct: 67  AVDLAESNPERAYLINADLVTFLAKICQLQRIRFIQLSTDYVFDGEQQTPYTVGDLPKPL 126

Query: 122 NIYGKSKLAGEEKVASYTNNY-VILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           N+YG SK AGE  V ++  ++  ++RT+W+YS+ G+NFLL+MLRL +ER  + +V DQ G
Sbjct: 127 NVYGASKRAGEMAVLTHCPDFGSVVRTSWLYSLCGNNFLLTMLRLMQERPALEIVNDQVG 186

Query: 181 TPTSALQIAR---AIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
           +PTSA+ +A    ++I + + L          I+H +  G   SW DFA  I    A   
Sbjct: 187 SPTSAITLADFLWSLIDLPNWL---------PIYHFSGQGQG-SWFDFAVEI-QHVAHSA 235

Query: 238 GPYS---KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
           G  S    +  I + Q+ T A RP YS LDCS     +++R   W+E + N+L+N
Sbjct: 236 GLLSYLIPIKPICSAQFHTAAIRPCYSVLDCSGSNGIYHMR--PWQETL-NVLLN 287


>gi|160863320|gb|ABX51886.1| dTDP-6-deoxy-L-mannose dehydrogenase [Cronobacter sakazakii]
          Length = 300

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 153/291 (52%), Gaps = 11/291 (3%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRV--GRPDI--DLLKPKDFASFFLSFSPDVIINPAA 59
           L+ G NGQ+   L         +I +     D   D   P+  A       PDVI+N AA
Sbjct: 6   LLFGKNGQVGWELQRALAPLGNLISLDFNSEDYCGDFSNPEGVAETVRRIKPDVIVNAAA 65

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           +TAVDKAE E E A  +NA    AIA+ A  I    I+ STDYVF G   TP  E   T 
Sbjct: 66  HTAVDKAESEREFAQLLNATSVEAIAREAAKINAWLIHYSTDYVFPGTGETPWCESDATA 125

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PLN+YG++KLAGE+ V  +  N++I RT+WVY+  G+NF  +MLRLAKER  +SV+ DQ+
Sbjct: 126 PLNVYGETKLAGEQAVQRFCPNHLIFRTSWVYAGKGNNFAKTMLRLAKERESLSVINDQY 185

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG- 238
           G PT A  +A          +   D +  G++H+ A  G  +W DFA  +F + A + G 
Sbjct: 186 GAPTGAELLADCTAHAIRVALTKPDVA--GLYHLVAS-GVTTWYDFAALVF-DQARKAGI 241

Query: 239 --PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
               + +  + T  YPT A RP  S L+  K      + +  W  GV+ +L
Sbjct: 242 TLKLTDLQPVPTSAYPTPACRPQNSRLNTMKFQQQFGLVLPQWDMGVKRML 292


>gi|224369262|ref|YP_002603426.1| RfbD [Desulfobacterium autotrophicum HRM2]
 gi|223691979|gb|ACN15262.1| RfbD [Desulfobacterium autotrophicum HRM2]
          Length = 291

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 103/287 (35%), Positives = 159/287 (55%), Gaps = 16/287 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ L+ G  GQ+ Q  + +  ++  +   G  D+D+  P          +P+V+IN AAY
Sbjct: 1   MRILICGGTGQLGQDCTRVFNKNHSVQSFGSRDLDISDPDLVERTIRELAPEVVINCAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPID--EFSPT 118
           T VD  ED  + AF +NA GA  +A++  ++    ++ISTDYVFDG    P+   E  PT
Sbjct: 61  TNVDGCEDNRDHAFHVNAVGAENLARSCRTVDALMVHISTDYVFDGKKEPPLTYAETDPT 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLR--LAKERREISVVC 176
            PLN+YG SKL GE++VA+     +I+RTAW+Y   G+NF+ ++L+  L    + I VV 
Sbjct: 121 APLNVYGASKLEGEKRVAALLEKQIIVRTAWLYGAQGNNFIKTILKLTLGNPEKTIRVVD 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQFG+PT  L++A  + ++        +   RGIFH TA+ G  SW +FA Y      ++
Sbjct: 181 DQFGSPTWTLRLALQLERLV-------EADGRGIFHATAE-GYCSWYEFATYFL----KK 228

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
                 +    T++YP  A RP  S LD ++L   +  R++ W+ GV
Sbjct: 229 MDVSHNIIACTTQEYPLPATRPFNSILDNARLKQKNMNRMTGWRHGV 275


>gi|75759811|ref|ZP_00739888.1| dTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228899902|ref|ZP_04064146.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis IBL 4222]
 gi|228906954|ref|ZP_04070821.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis IBL 200]
 gi|74492711|gb|EAO55850.1| dTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228852702|gb|EEM97489.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis IBL 200]
 gi|228859742|gb|EEN04158.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis IBL 4222]
          Length = 284

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 157/288 (54%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+              P +II+ AAY
Sbjct: 4   RVIITGANGQLGKQLFEELNSEEYDIYPFDKKLLDVTNISRIQQVVQEIKPHIIIHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD AE E ++A+ INA GA  +A A+  +G   +YISTDYVF G      DEF    P
Sbjct: 64  TKVDHAEKEQDLAYRINAIGARNVAVASQLVGAKLVYISTDYVFQGARPEGYDEFHSPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G+NF+ +M+RL KER EISVV DQ G
Sbjct: 124 INIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMMRLGKERDEISVVADQVG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  +    
Sbjct: 184 SPTYVADLNIVINKLIH-------TSLYGTYHVS-NRGSCSWFEFAQKIFSYTNMK---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++   A RP YS    + L     +++ +W+EG+    +
Sbjct: 232 VNVLPVSTEEFGAAAARPKYSIFQHNMLRLNGFLQMPSWEEGLERFFI 279


>gi|330815728|ref|YP_004359433.1| DTDP-4-dehydrorhamnose reductase [Burkholderia gladioli BSR3]
 gi|327368121|gb|AEA59477.1| DTDP-4-dehydrorhamnose reductase [Burkholderia gladioli BSR3]
          Length = 298

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 148/288 (51%), Gaps = 11/288 (3%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L+ G NGQ+   L+        +I + R  +DL +P+          P +I+NPAAYTAV
Sbjct: 9   LLTGINGQVGYELARSLQGLGRVIALDRQALDLSEPESIRRVVREIEPQLIVNPAAYTAV 68

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D+AE +   A  +N E     A+ A  +G   ++ STDYV+ G       E  P  P N+
Sbjct: 69  DQAETDVAAATRLNVEVPAVFAEEAKRVGAALVHYSTDYVYAGEGERRYVETDPVGPRNV 128

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG++KL GE  + +    ++ILRT+WVY + G NFL +MLRL  ER E++VV DQ G PT
Sbjct: 129 YGRTKLDGERAIVASGCRHLILRTSWVYGMRGRNFLKTMLRLGAERDELNVVADQIGAPT 188

Query: 184 SALQIARAIIQIAHNLIENSDTS------LRGIFHMTADGGPVSWADFAEYIFWESAERG 237
            +  IA     I    +    TS        GI+H+ A  G  SW  FAE IF   AE G
Sbjct: 189 WSRTIADLTAAILAQSVATGCTSDDWWTNHSGIYHLAA-AGETSWHGFAEAIF---AESG 244

Query: 238 GPYSKVYR-IFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           G    + R I    YPT A RP+ S L   KL  +  + +  W+E +R
Sbjct: 245 GERRPLVRPIPASAYPTPATRPSNSRLSMDKLERSFGLTVPDWREALR 292


>gi|182625742|ref|ZP_02953510.1| dTDP-4-dehydrorhamnose reductase [Clostridium perfringens D str.
           JGS1721]
 gi|177909004|gb|EDT71486.1| dTDP-4-dehydrorhamnose reductase [Clostridium perfringens D str.
           JGS1721]
          Length = 294

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 109/302 (36%), Positives = 159/302 (52%), Gaps = 25/302 (8%)

Query: 1   MKCLVIGNNGQIAQSLSSMC-------------VQDVEIIRVGRPDIDLLKPKDFASFFL 47
           MK L+ G+NGQ+   L S+              +++ E+I +    +D+   ++  +   
Sbjct: 1   MKILITGSNGQLGNELKSIIKSGKAEIGSVSENIKNSEVIALDVDKLDITSLENVKNVLN 60

Query: 48  SFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGL 107
              PDV+IN AA T VD  E   + AF +N+ GA  +A   + IG   + +STDYVF G+
Sbjct: 61  EEKPDVVINCAAATNVDGCESNEDFAFKVNSLGARNLAMVCEEIGAKLVQVSTDYVFSGV 120

Query: 108 SRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAK 167
              P+ EF  T P ++YGK+KL GE  V  + + Y I+RTAW+Y   G NF+ +M+RL K
Sbjct: 121 GEKPLTEFDLTAPYSVYGKTKLLGENYVKEFCSKYYIVRTAWLYGYVGHNFVYTMMRLGK 180

Query: 168 ERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAE 227
           E+  ++VV DQ G PT A  +A  I++    LIE   T   GI+H T   G  +W DFA+
Sbjct: 181 EKESLNVVNDQKGNPTHANDLAYHILK----LIE---TEEYGIYHCTGK-GECTWYDFAK 232

Query: 228 YIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            I  E AE       V    +++Y T A RP YS LD   L  T    +  WKE +++  
Sbjct: 233 EIM-ELAENK---CIVNPCTSEEYKTPAKRPEYSSLDNMMLRCTIGDEMRDWKEALKSFF 288

Query: 288 VN 289
            N
Sbjct: 289 KN 290


>gi|332529598|ref|ZP_08405554.1| dTDP-4-dehydrorhamnose reductase [Hylemonella gracilis ATCC 19624]
 gi|332040948|gb|EGI77318.1| dTDP-4-dehydrorhamnose reductase [Hylemonella gracilis ATCC 19624]
          Length = 300

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 107/305 (35%), Positives = 160/305 (52%), Gaps = 21/305 (6%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASF------FLSFSPDVI 54
           MK L+ G NGQ+   L        E+I V R  +D L   D +          +  P VI
Sbjct: 1   MKILLFGKNGQVGWELQRSLAPLGEVIAVDRVGVDGLC-GDLSDLDCLQRTVRAVQPQVI 59

Query: 55  INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDE 114
           +N AAYTAVD AE +   A+ INAE  G +A+AA       ++ STDYVFDG    P  E
Sbjct: 60  VNAAAYTAVDLAETDVAAAYRINAEAPGVLARAAAQHDALLVHYSTDYVFDGSGERPWRE 119

Query: 115 FSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISV 174
                PL++YG++KL GE+ + + +  ++I RT+WVY+  G NF  +MLRLA E+ E+  
Sbjct: 120 DDAPAPLSVYGRTKLEGEQAIRASSCRHLIFRTSWVYAARGDNFAKAMLRLAVEQDELRA 179

Query: 175 VCDQFGTPTSALQIARAIIQ-IAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWES 233
           + DQ G PT A  +A      I   ++ N  ++  GI+H+ A  G  SW D+A ++   +
Sbjct: 180 INDQLGAPTGADLLADVTAHAIRWVVLANDGSAASGIYHL-ASAGEASWFDYARFVLAHA 238

Query: 234 AERGGPYSKVYRIFTKQ--------YPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRN 285
            ++G    +V ++  +Q        YP  A RP  S LDC++L  T  + +  W+ G+  
Sbjct: 239 QQKG----RVLKVAPQQVRAIPASAYPGSARRPHNSRLDCTRLRQTFGLALPPWQSGMTR 294

Query: 286 ILVNI 290
           +L  I
Sbjct: 295 MLDEI 299


>gi|119357789|ref|YP_912433.1| dTDP-4-dehydrorhamnose reductase [Chlorobium phaeobacteroides DSM
           266]
 gi|119355138|gb|ABL66009.1| dTDP-4-dehydrorhamnose reductase [Chlorobium phaeobacteroides DSM
           266]
          Length = 290

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 114/297 (38%), Positives = 161/297 (54%), Gaps = 23/297 (7%)

Query: 1   MKCLVIGNNGQIAQSLSSM---------CVQDVEIIRVGRPDIDLLKPKDFASFFLSFSP 51
           M  LV G NGQ+   L S+         C  D+       PD+D+       +   +   
Sbjct: 1   MNILVTGGNGQLGSELRSLQRDYPAWMFCFCDL-------PDLDITDSNAVDALMRTCKC 53

Query: 52  DVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTP 111
           +VI+N AAYTAVD+AE EP  A+ +N +GAG +A  A +     I+ISTDYVFDG S  P
Sbjct: 54  NVIVNCAAYTAVDQAEQEPGRAYRVNRDGAGVLAACAKAHHALLIHISTDYVFDGNSCLP 113

Query: 112 IDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERRE 171
             E     PL IYGKSK A EE +     +++ILRT+W+YS++G NFL +MLRL  E+  
Sbjct: 114 YRETDRPAPLGIYGKSKRAAEELIFEIAPSFLILRTSWLYSLYGHNFLKTMLRLGAEKDV 173

Query: 172 ISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFW 231
           I V+ DQ GTPT A  +ARAI+ I   +    D     ++H + + G  SW DFA  I  
Sbjct: 174 IKVIFDQTGTPTYAGDLARAIMTILGKV--RLDEQYGALYHYSNE-GVCSWYDFAVAIM- 229

Query: 232 ESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             A +  P  KV  I T +YP  + RP +S L+ S +     + I  W++ + ++L+
Sbjct: 230 --ALKKLP-CKVLPIETTEYPLPSPRPFFSVLNKSAIKRDWGLVIPYWRDSLESVLL 283


>gi|307720180|ref|YP_003891320.1| dTDP-4-dehydrorhamnose reductase [Sulfurimonas autotrophica DSM
           16294]
 gi|306978273|gb|ADN08308.1| dTDP-4-dehydrorhamnose reductase [Sulfurimonas autotrophica DSM
           16294]
          Length = 289

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 113/287 (39%), Positives = 155/287 (54%), Gaps = 12/287 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           L+ G NGQ+   L  +  +          R  +D+   K    F      + IIN AAYT
Sbjct: 5   LITGANGQVGSELKELSCKYNAYNFFFTDRETLDITDNKAVKKFIEDNHINTIINTAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAED+   A  IN      +A+ +    I  I+ISTDYVFDG +  P  E   TNP 
Sbjct: 65  AVDKAEDDVTNADKINHLAVKNLAQISKEKDIKLIHISTDYVFDGKNYKPYTEIDETNPN 124

Query: 122 NIYGKSKLAGEEKVASYT-NNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            +YGK+KL GE+ +      N +I+RT+WVYS FG+NF+ +MLRL KER  + V+ DQ G
Sbjct: 125 GVYGKTKLDGEKVLQEIKPKNSIIIRTSWVYSSFGNNFVKTMLRLGKERDGVGVIFDQVG 184

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPT A  +A+ I+ I    I+NS      I+H + + G +SW DFA+ I           
Sbjct: 185 TPTYARDLAKTILDIIPK-IQNSKLE---IYHYSNE-GVLSWYDFAKEII----RMAKLD 235

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            K+  I TK+YPT A RP YS L+ +K+  T N+ I  WK+ +   L
Sbjct: 236 CKINPIETKEYPTPAARPYYSLLNKAKIKQTFNVIIPYWKDSLDTCL 282


>gi|218130285|ref|ZP_03459089.1| hypothetical protein BACEGG_01873 [Bacteroides eggerthii DSM 20697]
 gi|317473772|ref|ZP_07933053.1| RmlD substrate binding domain-containing protein [Bacteroides
           eggerthii 1_2_48FAA]
 gi|217987569|gb|EEC53897.1| hypothetical protein BACEGG_01873 [Bacteroides eggerthii DSM 20697]
 gi|316910029|gb|EFV31702.1| RmlD substrate binding domain-containing protein [Bacteroides
           eggerthii 1_2_48FAA]
          Length = 287

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 159/286 (55%), Gaps = 12/286 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVE--IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M  LV G NGQ+   + ++  ++ +         ++D+   +   +F      DVI+N A
Sbjct: 1   MNILVTGANGQLGNEMRALSAENGQHTYFFTDVQELDICDEQAIRAFVSGNRVDVIVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED PE+   +N    G +A AA++ G   I +STDYVFDG    P  E    
Sbjct: 61  AYTAVDKAEDNPELCDKLNHIAPGYLAAAAEACGAAMIQVSTDYVFDGTGHIPYTEDIAP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG +KLAGE+ V    +  +I+RTAW+YSI+G+NF+ +M+RL  ER ++ VV DQ
Sbjct: 121 CPNSVYGSTKLAGEQAVGEKCSRAMIIRTAWLYSIYGNNFVKTMIRLGNEREKLGVVFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +ARAI    +  I      + G++H + D G  SW DF   I   +   G 
Sbjct: 181 IGTPTYANDLARAIFAAINQGI------VPGVYHFS-DEGVCSWYDFTVAIHRMA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
              KV  + T +YP KA RP YS LD +K+  T  I I  W+E ++
Sbjct: 231 TSCKVSPLHTDEYPAKAPRPQYSVLDKTKIKKTFGIEIPHWEESLQ 276


>gi|83719857|ref|YP_442018.1| dTDP-4-dehydrorhamnose reductase [Burkholderia thailandensis E264]
 gi|167580856|ref|ZP_02373730.1| dTDP-4-dehydrorhamnose reductase [Burkholderia thailandensis TXDOH]
 gi|167618957|ref|ZP_02387588.1| dTDP-4-dehydrorhamnose reductase [Burkholderia thailandensis Bt4]
 gi|257138201|ref|ZP_05586463.1| dTDP-4-dehydrorhamnose reductase [Burkholderia thailandensis E264]
 gi|83653682|gb|ABC37745.1| dTDP-4-dehydrorhamnose reductase [Burkholderia thailandensis E264]
          Length = 298

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 153/289 (52%), Gaps = 7/289 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G NGQ+   L+       +++ + R + DL +P+  A       PDV++N AAY
Sbjct: 1   MKILVTGANGQVGWELARSLAVLGQVVPLARDEADLGRPETLARIVEDAKPDVVVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD AE +   A  +N E  G +A A   +G   ++ STDYVFDG   +P  E  PT P
Sbjct: 61  TAVDAAESDGAAAKVVNGEAVGVLAAATKRVGGLFVHYSTDYVFDGTKSSPYIETDPTCP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +N YG SKL GE  VA    +++  RT WV++  G NFL +MLRLAKER E+ +V DQFG
Sbjct: 121 VNAYGASKLLGELAVAETGGDWLTFRTTWVFAARGKNFLRTMLRLAKEREEMKIVADQFG 180

Query: 181 TPTSALQIARAIIQ-IAHNLIENSDTSL-RGIFHMTADGGPVSWADFAEYIF--WESAER 236
            PT A  IA      +A  + E +  +   G++HMT+  G  SW  FA+ I   W +   
Sbjct: 181 APTWARSIADGTAHALATAMRERAAGAFTSGVYHMTS-AGQTSWHGFADAIVASWRAVPG 239

Query: 237 GGPY--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
             P   S++  I T  YP  A RPA S L    L     I +  W+  V
Sbjct: 240 AAPLAVSRIVPIPTSAYPVPARRPANSVLSNEALKERFGIELPDWRYAV 288


>gi|332828457|gb|EGK01162.1| dTDP-4-dehydrorhamnose reductase [Dysgonomonas gadei ATCC BAA-286]
          Length = 317

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 157/283 (55%), Gaps = 9/283 (3%)

Query: 4   LVIGNNGQIA---QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           L+ G NGQ+    + ++S    + +       ++D+   +    F    +   I+N AAY
Sbjct: 31  LITGANGQLGNEIRRIASFHENNFQFFFTDVAELDITDQQAIEDFIRENNIKYIVNCAAY 90

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAED+  + + IN +    +  AA + G   I+ISTDYV+DG +  P  E    NP
Sbjct: 91  TAVDKAEDDVALCYRINRDAVANLGAAATNNGSKIIHISTDYVYDGTASKPYTETDEVNP 150

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            ++YGKSK  GE  +     + +I+RTAW+YSIFG+NF+ +M++  KER  ++VV DQ G
Sbjct: 151 QSVYGKSKQEGEAALIKACPDSIIIRTAWLYSIFGNNFVKTMMKYGKERDTLNVVADQTG 210

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPT+A  +A AII+I      NS T   GI+H + + G  +W DF   I   +   G   
Sbjct: 211 TPTNAGDLANAIIKILDYSEANSFTP--GIYHYSNE-GITTWYDFTLAIHKHA---GIIN 264

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
             V  I T QYPTKA RP YS LD +K+  T  I I  W++ +
Sbjct: 265 CTVNPITTDQYPTKATRPKYSVLDKTKIKTTFKITIPEWEKSL 307


>gi|167570966|ref|ZP_02363840.1| dTDP-4-dehydrorhamnose reductase [Burkholderia oklahomensis C6786]
          Length = 250

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 135/243 (55%), Gaps = 7/243 (2%)

Query: 49  FSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLS 108
             P +I+NPAAYTAVDKAE +  +A  +NAE     A+ A   G   I+ STDYVFDG  
Sbjct: 8   LEPSIIVNPAAYTAVDKAESDEAMARQLNAEAPRVFAEEAARSGATLIHYSTDYVFDGAK 67

Query: 109 RTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKE 168
            +P  E    NP N+YG++KLAGE+ +A+    ++ILRT+WVY   G NFLL+MLRL  E
Sbjct: 68  ASPYTEDDAVNPQNVYGRTKLAGEQAIAASGCAHLILRTSWVYGQRGKNFLLTMLRLRDE 127

Query: 169 RREISVVCDQFGTPTSALQIARAIIQI-AHNLIENSD---TSLRGIFHMTADGGPVSWAD 224
           R E+ VV DQ G PT A  IA     I A  L   S        GI+H+T   G  SW  
Sbjct: 128 RSELRVVADQIGAPTWANTIATMTAHIVAQGLAAGSVQWWAERSGIYHLTC-AGATSWHG 186

Query: 225 FAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
           FA+ IF  ++    P  ++  I T  YPT A RPA S L   KL     ++ S W E ++
Sbjct: 187 FAQDIFARASSESSP--RLLPISTSDYPTPAKRPANSRLSNEKLETVFGLKPSRWDEALQ 244

Query: 285 NIL 287
             L
Sbjct: 245 LCL 247


>gi|241763422|ref|ZP_04761476.1| dTDP-4-dehydrorhamnose reductase [Acidovorax delafieldii 2AN]
 gi|241367364|gb|EER61685.1| dTDP-4-dehydrorhamnose reductase [Acidovorax delafieldii 2AN]
          Length = 297

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 104/299 (34%), Positives = 164/299 (54%), Gaps = 13/299 (4%)

Query: 1   MKCLVIGNNGQIA----QSLSSM-CVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVII 55
           M  L++G  GQ+     +SLS +  V  ++    G    D   P   A    +  PDVI+
Sbjct: 1   MNILLLGKGGQVGWELQRSLSVLGTVTALDHDSTGHCG-DFANPAGLADTVRALRPDVIV 59

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N AA+TAVDKAE EPE A ++NA   G +A+ A  +G   ++ STDYVFDG    P  E 
Sbjct: 60  NAAAHTAVDKAESEPEFARTLNATTPGVLAEEAARLGAWLVHYSTDYVFDGSGTRPWVET 119

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
               PL++YG++KL GE+++      ++ILRT+WVY+  G NF  +MLRLA+ER  ++V+
Sbjct: 120 DTPAPLSVYGRTKLEGEQRIQQSGAKHLILRTSWVYAARGGNFAKTMLRLAQERDRLTVI 179

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
            DQ+G PT A  +A        +L ++ +    G++H  A GG  +W  +A+Y+  ++ +
Sbjct: 180 DDQWGAPTGADLLADVTAHALRHLQQHPEAG--GLYHCVA-GGETNWHLYAKYVLAQAQQ 236

Query: 236 RGG----PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                    ++V  + T  +PT A RP  S LD ++L     +++  W+ GV  +L  +
Sbjct: 237 AQPAIKIKATEVAPVPTSAFPTPAQRPHNSRLDTTQLQTIFGLQLPHWQTGVERMLQEV 295


>gi|90425661|ref|YP_534031.1| dTDP-4-dehydrorhamnose reductase [Rhodopseudomonas palustris
           BisB18]
 gi|90107675|gb|ABD89712.1| dTDP-4-dehydrorhamnose reductase [Rhodopseudomonas palustris
           BisB18]
          Length = 291

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 158/289 (54%), Gaps = 5/289 (1%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M+ LVIG +GQ+A +L+ +     ++  +G  D++ L   +          + +IN AAY
Sbjct: 1   MRILVIGRHGQVATALARLGAGVHDVTCLGHDDVNALVKAELDDAVTRTGAEAVINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE + + A+++N      +A+ + + G+P I++STDYVFDG    P     P  P
Sbjct: 61  TAVDKAETDQDAAYALNQRLPRLLAEISAARGVPFIHLSTDYVFDGSKAAPYLPTDPIRP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           ++IYG SK  GE  V        ILRTAWVYS  GSNF+  ML L  ER E+ +V DQ G
Sbjct: 121 VSIYGASKATGEIAVRVANPAAAILRTAWVYSETGSNFVKRMLELGAERDELRIVDDQLG 180

Query: 181 TPTSALQ-IARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
            PT A    A  +   AH  +     S  GI+H  A  G V+W  FA+ IF E++ RG  
Sbjct: 181 NPTFADDLAAACLRLAAHPGLRAG--SAGGIYHY-AGHGDVTWYGFAQAIFAEASRRGRR 237

Query: 240 Y-SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              +V  I + QYPT A RPA S LDC+    T ++   +W++ ++  L
Sbjct: 238 TPQRVLAITSDQYPTPARRPANSRLDCAATEATFSVASQSWRDALKTCL 286


>gi|85543849|gb|ABC71787.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas fluorescens]
          Length = 296

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 112/305 (36%), Positives = 160/305 (52%), Gaps = 27/305 (8%)

Query: 1   MKCLVIGNNGQIAQSLSSM-------CV--QDVEIIRVGRPDIDLLKPKDFASFFLSFSP 51
           MK L++G NGQ+   L          C+    +E +     ++D L+     +      P
Sbjct: 1   MKILLLGKNGQVGWELQRSLGDRGDGCLDRHPLEGLSGDLSELDALR-----ATIRKVGP 55

Query: 52  DVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTP 111
           D+I+N AAYTAVDKAE E E+A  +N E +  +A+ A S+    I+ STDYVF G   TP
Sbjct: 56  DIIVNAAAYTAVDKAESETELADRVNGEASRVMAQEAASLDAWLIHYSTDYVFSGEGSTP 115

Query: 112 IDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERRE 171
             E     P+N YG SKLAGE+ +A+    ++I RT+WVY   G+NF  +MLRLAK+R  
Sbjct: 116 WQESDAVAPVNHYGASKLAGEQAIAASGCKHLIFRTSWVYGARGNNFAKTMLRLAKDRES 175

Query: 172 ISVVCDQFGTPTSALQIAR----AIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAE 227
           + V+ DQ G PT A  IA     AI Q+ H        +L GI+H+ A  G VSW  +A 
Sbjct: 176 LGVIADQVGAPTGADLIADVTALAIQQVVHR------PALSGIYHLAA-AGEVSWHGYAS 228

Query: 228 YIFWESAERGGPY--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRN 285
            +   +   G     + +  I T  YPT A RP  S L+  KL +  ++ +  W+ GV  
Sbjct: 229 LVISFAKAHGEELAVTAINPIDTTAYPTPARRPLNSRLNTQKLCDNFSLHLPDWQSGVTR 288

Query: 286 ILVNI 290
           +L  +
Sbjct: 289 MLREV 293


>gi|228964269|ref|ZP_04125388.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228795366|gb|EEM42854.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis serovar
           sotto str. T04001]
          Length = 284

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 157/288 (54%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+              P +II+ AAY
Sbjct: 4   RVIITGANGQLGKQLFEELNSEEYDIYPFDKKLLDVTNISRIQQVVQEIKPHIIIHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD AE E ++A+ INA GA  +A A+  +G   +YISTDYVF G      DEF    P
Sbjct: 64  TKVDHAEKEQDLAYRINAIGARNVAVASQLVGAKLVYISTDYVFQGARPEGYDEFHSPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G+NF+ +M+RL KER EISVV DQ G
Sbjct: 124 INIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMMRLGKERDEISVVADQVG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  +    
Sbjct: 184 SPTYVADLNIVINKLIH-------TSLYGTYHVS-NRGSCSWFEFAKKIFSYTNMK---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++   A RP YS    + L     +++ +W+EG+    +
Sbjct: 232 VNVLPVSTEEFGAAAARPKYSIFQHNMLRLNGFLQMPSWEEGLERFFI 279


>gi|150019561|ref|YP_001311815.1| dTDP-4-dehydrorhamnose reductase [Clostridium beijerinckii NCIMB
           8052]
 gi|149906026|gb|ABR36859.1| dTDP-4-dehydrorhamnose reductase [Clostridium beijerinckii NCIMB
           8052]
          Length = 279

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 152/288 (52%), Gaps = 13/288 (4%)

Query: 4   LVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
           LV G NGQ+   +   +  +++E + + R ++D+              PD +I+ AAYTA
Sbjct: 3   LVTGVNGQLGYDVVKELNRRNIECLGIDRAELDITDKNAVKDCIGKLKPDCVIHCAAYTA 62

Query: 63  VDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLN 122
           VD+AEDE E+   +N  G   IAKA   IG   IYISTDYVFDG   TP +      P +
Sbjct: 63  VDRAEDEEEVCAKVNVYGTDNIAKACKEIGAKMIYISTDYVFDGKGNTPFEVEDKIEPHS 122

Query: 123 IYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTP 182
           +YGK+K  GE KV    + Y I+R +WV+ + G+NF+ +MLRL  E+  ++VVCDQ G+P
Sbjct: 123 VYGKTKYEGELKVKEVLDKYFIVRISWVFGVNGNNFIKTMLRLGSEKESLNVVCDQIGSP 182

Query: 183 TSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK 242
           T    +A  +  +A        +   G++H T +G   SWA+FA  I     ++ G   K
Sbjct: 183 TYTADLAPLLCDMAV-------SEKYGVYHATNEGF-CSWAEFAGEIM----KKAGLSCK 230

Query: 243 VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           V  I T +YP KA RP  S L    L +     +  W+  +   L+ +
Sbjct: 231 VNPIPTSEYPAKAQRPFNSRLSKKSLVDNGFGLLPNWENALDRYLIEL 278


>gi|241668048|ref|ZP_04755626.1| dTDP-4-dehydrorhamnose reductase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876583|ref|ZP_05249293.1| dTDP-4-dehydrorhamnose reductase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254842604|gb|EET21018.1| dTDP-4-dehydrorhamnose reductase [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 301

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 163/301 (54%), Gaps = 16/301 (5%)

Query: 1   MKCLVIGNNGQIAQSL------SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVI 54
           MK LV G+NGQ+   L      S + +Q+   I +    +D+   +    F +    + I
Sbjct: 1   MKVLVTGSNGQLGSELKELVSNSKLEIQNYTFIFMDSKSLDITDHQAVERFVVEHDIEAI 60

Query: 55  INPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDE 114
           IN AAYTAVDKAE + E+A  IN      IA+ A    I  I+ISTDYVF+G S  P  E
Sbjct: 61  INCAAYTAVDKAESDIEMADKINHLAVATIAELAKKCSIKLIHISTDYVFNGESFRPYIE 120

Query: 115 FSPTNPLNIYGKSKLAGEEKVASYT-NNYVILRTAWVYSIFGSNFLLSMLRLAKERREIS 173
              TNP +IYG +KLAGEE +      + +I+RT+WVYS +G+NF+ +MLRL +E+  + 
Sbjct: 121 SDKTNPQSIYGATKLAGEEVIQRINPKDSIIIRTSWVYSSYGNNFVKTMLRLGREKDTLG 180

Query: 174 VVCDQFGTPTSALQIARAII----QIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYI 229
           V+ DQ GTPT A  +A+AI+    Q+   +   +D  +  I++ + + G  SW DFA+ I
Sbjct: 181 VIYDQVGTPTYAKDLAKAILDILSQVDSRVKHENDNEVVEIYNYSNE-GVTSWYDFAKEI 239

Query: 230 FWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVN 289
                       +V  I T  YPT A RP YS L+  K+     + I  WK  +++ +  
Sbjct: 240 M----SIAKIECQVNPIETVDYPTPAKRPHYSLLNKKKIKQDFGLSIPYWKNSLQDCIYR 295

Query: 290 I 290
           I
Sbjct: 296 I 296


>gi|288942438|ref|YP_003444678.1| dTDP-4-dehydrorhamnose reductase [Allochromatium vinosum DSM 180]
 gi|288897810|gb|ADC63646.1| dTDP-4-dehydrorhamnose reductase [Allochromatium vinosum DSM 180]
          Length = 302

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 108/288 (37%), Positives = 150/288 (52%), Gaps = 16/288 (5%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVG-----RPDIDLLKPKDFASFFLSFSPDVIIN 56
           K L+IG NGQ+   L        E+I         P IDL+  K  A       PD +IN
Sbjct: 12  KLLLIGANGQVGWELRRTLAGVGEVIAASLEGEYGPTIDLMDAKALARLIEDSRPDALIN 71

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDG-LSRTPIDEF 115
            AAYTAVDKAE +   A  +NA+  G +       G P I+ STD+VF G L RT  ++ 
Sbjct: 72  AAAYTAVDKAESDRATAQRLNADAVGEMGALLAERGTPIIHYSTDFVFSGSLGRTYTEDD 131

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
           SP +PLN+YG++KL GE  +       +I RT+WVY   G+NFLL+M RL +ER E+ VV
Sbjct: 132 SP-DPLNVYGETKLGGERALLDSGARALIFRTSWVYGARGANFLLTMRRLFQEREELRVV 190

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIENSDTSLR---GIFHMTADGGPVSWADFAEYIFWE 232
            DQ G+PT +  +A    Q+ H ++   D  L    G++H+T   G VSW  FA  I   
Sbjct: 191 DDQIGSPTWSRMLAEITAQVLHRVLRG-DLDLDKVGGLYHLTGS-GQVSWYGFASAIL-- 246

Query: 233 SAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWK 280
             E  G  + +  I + +Y   A RP +S LD  +   T  + +  W+
Sbjct: 247 --EASGAQTNLIPIPSSEYQAPAKRPTFSVLDNGRFQETFGLAMPDWR 292


>gi|21673146|ref|NP_661211.1| dTDP-4-dehydrorhamnose reductase [Chlorobium tepidum TLS]
 gi|21646223|gb|AAM71553.1| dTDP-4-dehydrorhamnose reductase [Chlorobium tepidum TLS]
          Length = 292

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 111/296 (37%), Positives = 159/296 (53%), Gaps = 17/296 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDV----EIIRVGRPDIDLLKPKDFASFFLSFSPDVIIN 56
           M  LV G+ GQ+   L  +  Q+V    E   +  P++D+                 I+N
Sbjct: 1   MNILVTGSRGQLGSELQKL--QEVHGWQEWFFMDLPELDITDALAVERVCRDRRIGAIVN 58

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AAYTAVD+AE + E AF +N +GA  +A  A  +G   +++STDYVFDG S  P  E  
Sbjct: 59  CAAYTAVDRAESDAEAAFRVNRDGAAVLAAVAMEVGALLLHVSTDYVFDGSSNRPYCEDD 118

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           P  P  +YG SK  GEE + +   +Y+ILRTAW+YS++G NF+ +MLRL  ER+ + VV 
Sbjct: 119 PVAPCGVYGLSKWEGEEAIRASGCSYIILRTAWLYSVYGQNFVKTMLRLGSERQSLGVVF 178

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSD--TSLRGIFHMTADGGPVSWADFAEYIFWESA 234
           DQ G+PT A  +A  I+ I    ++  D   S    FH + + G  SW DFA+ I    A
Sbjct: 179 DQVGSPTWAADLAGTIVSI----LDQCDPVRSYSETFHYSNE-GVCSWYDFAKSIM--DA 231

Query: 235 ERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           E  G   KV  I +  YPT A RP +S L+  K+ +T  + I  W + +  +L  +
Sbjct: 232 E--GLSCKVLPIESSNYPTPARRPHFSVLNKRKIKSTLGLEIPYWHDSLLRMLTEL 285


>gi|293611244|ref|ZP_06693542.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826495|gb|EFF84862.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 297

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 110/298 (36%), Positives = 158/298 (53%), Gaps = 12/298 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI-----DLLKPKDFASFFLSFSPDVII 55
           MK L++G NGQ+   L        +II + R  +     D+ + +      L+  PDV++
Sbjct: 1   MKILLLGKNGQVGWELQRALAPLGDIIALDRHGLNGLSGDMTQLQAIYDTILAVQPDVVV 60

Query: 56  NPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF 115
           N +AYTAVD AE + E A  +N +   A A+A        ++ STDYVF+G+  T   E 
Sbjct: 61  NASAYTAVDLAETQQEQADIVNHQTVKAAAEACLKTNALLVHYSTDYVFEGMGTTAFVET 120

Query: 116 SPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVV 175
               PLNIYGK+K  GE+ +      Y+I RT+WVY+    NFL +ML LA++R E+S++
Sbjct: 121 DAIAPLNIYGKTKALGEQAIVDSGCRYLIFRTSWVYASRAKNFLKTMLSLAQQREELSII 180

Query: 176 CDQFGTPTSALQIARAIIQIAHNLIEN-SDTSLRGIFHMTADGGPVSWADFAEYIFWESA 234
            DQ G PTSA  IA      AH + +   D +  GI+H+ A  G  SW  +A Y F ++ 
Sbjct: 181 DDQIGAPTSAELIADI---TAHAIPQTVVDANKVGIYHLVAS-GETSWFGYANYAFAQAR 236

Query: 235 ERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             G   +  KV  I T  YPT A RP  S LD  K+  T  + +  W+EGV+  L  +
Sbjct: 237 ILGQELTIQKVSPIPTSAYPTPATRPHNSRLDNQKIQRTFGLTLPVWQEGVKRALTEL 294


>gi|228994851|ref|ZP_04154648.1| DTDP-4-dehydrorhamnose reductase [Bacillus pseudomycoides DSM
           12442]
 gi|228764898|gb|EEM13655.1| DTDP-4-dehydrorhamnose reductase [Bacillus pseudomycoides DSM
           12442]
          Length = 280

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 162/291 (55%), Gaps = 17/291 (5%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEII-RVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G  GQ+ +   +   +  + +    R ++D+           S  PD++++ AA
Sbjct: 1   MKVLVTGAGGQLGKEFIAYFTEKGDTLYSFTRKELDVTDATSLNPIMKSLKPDLVLHCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YT VD AE+  + A+++NA G   IA A+++IG   +Y STDYVFDG+      EF  TN
Sbjct: 61  YTKVDAAEENWKEAYAVNALGTRNIAVASEAIGAKLVYFSTDYVFDGMHARDYHEFDQTN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           PLN+YG SKLAGEE V ++ + Y I+RT+W+Y   G NF+ +M  LA+ ++E+ VVCDQ 
Sbjct: 121 PLNVYGASKLAGEEAVRNFHSRYFIMRTSWLYGGEGPNFVRTMQTLAQTKKELRVVCDQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G PT      + ++     +I+   T+  G +H+ ++ G  SW +FA  IF E       
Sbjct: 181 GCPT----YTKDLVCKTGEMIQ---TNQYGTYHV-SNRGECSWFEFATRIFQEMRVN--- 229

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLD--CSKLANTHNIRISTWKEGVRNILV 288
             KV  + T++Y  KA RP YS L   C +L    ++R   W+E +R  ++
Sbjct: 230 -VKVIPVKTEEYRAKAERPRYSVLQHLCLELNGFTSMR--QWEEALREYII 277


>gi|47568424|ref|ZP_00239125.1| dTDP-4-dehydrorhamnose reductase [Bacillus cereus G9241]
 gi|47554972|gb|EAL13322.1| dTDP-4-dehydrorhamnose reductase [Bacillus cereus G9241]
          Length = 284

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 159/288 (55%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSLSS-MCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+              P +II+ AAY
Sbjct: 4   RIIITGANGQLGKQLQEELNPEEYDIYPFDKKLLDITNISQVQQVVQKIRPHIIIHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD+AE E ++A+ INA GA  +A A+  +G   +YISTDYVF G      DEF    P
Sbjct: 64  TKVDQAEKERDLAYRINAIGARNVAVASQLVGAKLVYISTDYVFQGDRPEGYDEFHDPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G+NF+ +M+RL KER E+SVV DQ G
Sbjct: 124 INIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMMRLGKEREEVSVVADQIG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  +    
Sbjct: 184 SPTYVADLNVMINKLIH-------TSLYGTYHVS-NRGSCSWFEFAKKIFSYANMK---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++ + A RP YS    + L     +++ +W+EG+    +
Sbjct: 232 VDVLPVSTEEFGSAAARPKYSIFQHNMLRLNGFLQMPSWEEGLERFFI 279


>gi|167770811|ref|ZP_02442864.1| hypothetical protein ANACOL_02162 [Anaerotruncus colihominis DSM
           17241]
 gi|167666851|gb|EDS10981.1| hypothetical protein ANACOL_02162 [Anaerotruncus colihominis DSM
           17241]
          Length = 283

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 108/291 (37%), Positives = 156/291 (53%), Gaps = 13/291 (4%)

Query: 1   MKCLVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           M+  V G +GQ+   +   +  + +E   V   D+D+   K   +   +  PD +I+ AA
Sbjct: 1   MRVFVTGASGQLGYDVCKELTRRGIENRGVSVEDLDITDRKAVEAALENNRPDAVIHCAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAEDE E  +++N +G   +A +  +IG   +YISTDYVF GL +   +     N
Sbjct: 61  YTAVDKAEDEAEQCWAVNVDGTRNLAVSCKAIGAKMLYISTDYVFPGLGKQFYEVTDAVN 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P N+YG SKLAGE  V S   +Y I+R +WV+   G+NF+ +MLRL+K   E++VVCDQ 
Sbjct: 121 PTNVYGASKLAGELVVQSLLTDYFIVRISWVFGANGNNFIKTMLRLSKSNTELNVVCDQI 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           G+PT    +A  +  +         T   G++H T + G  SWA+FAE IF       G 
Sbjct: 181 GSPTYTADLAPLLCDMIR-------TDQFGLYHATNE-GVCSWAEFAEEIF----RCAGK 228

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             KV  I T++YPT A RP  S L    L+      +  W   +R  L+ I
Sbjct: 229 EVKVNHILTEEYPTCAKRPLNSRLSKRMLSAQGFRPLPEWTNALRRYLIEI 279


>gi|228951700|ref|ZP_04113802.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228807985|gb|EEM54502.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
          Length = 284

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 156/288 (54%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+              P +II+ AAY
Sbjct: 4   RVIITGANGQLGKQLFEELDSEEYDIYPFDKKLLDVTNISRIQQVVQEIKPHIIIHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD AE E ++A+ INA GA  +A A+  +G   +YISTDYVF G      DEF    P
Sbjct: 64  TKVDHAEKEQDLAYRINAIGARNVAVASQLVGAKLVYISTDYVFQGARPDGYDEFHSPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G+NF+ +M+RL KER EISVV DQ G
Sbjct: 124 INIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMMRLGKERNEISVVADQVG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  +    
Sbjct: 184 SPTYVADLNMVINKLIH-------TSLYGTYHVS-NRGSCSWFEFAQKIFSYANMK---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++   A RP YS    + L      ++ +W+EG+    +
Sbjct: 232 VNVLPVSTEEFGAAAARPKYSIFQHNMLRLNGFSQMPSWEEGLERFFI 279


>gi|168212615|ref|ZP_02638240.1| dTDP-4-dehydrorhamnose reductase [Clostridium perfringens CPE str.
           F4969]
 gi|170715772|gb|EDT27954.1| dTDP-4-dehydrorhamnose reductase [Clostridium perfringens CPE str.
           F4969]
          Length = 295

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 109/302 (36%), Positives = 158/302 (52%), Gaps = 25/302 (8%)

Query: 1   MKCLVIGNNGQIAQSLSSMC-------------VQDVEIIRVGRPDIDLLKPKDFASFFL 47
           MK L+ G+NGQ+   L S+               ++ E+I +    +D+   ++  +   
Sbjct: 1   MKILITGSNGQLGNELQSIIKSGKAEIGSVSENTKNSEVIALDVDKLDITSLENVKNVLN 60

Query: 48  SFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGL 107
              PDV+IN AA T VD  E   + AF +N+ GA  +A   + IG   + +STDYVF G+
Sbjct: 61  EEKPDVVINCAAATNVDGCESNEDFAFKVNSLGARNLAMVCEEIGAKLVQVSTDYVFSGV 120

Query: 108 SRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAK 167
              P+ EF  T P ++YGK+KL GE  V  + + Y I+RTAW+Y   G NF+ +M+RL K
Sbjct: 121 GEKPLTEFDLTAPYSVYGKTKLLGENYVKEFCSKYYIVRTAWLYGYVGHNFVYTMMRLGK 180

Query: 168 ERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAE 227
           E+  ++VV DQ G PT A  +A  I++    LIE   T   GI+H T   G  +W DFA+
Sbjct: 181 EKESLNVVNDQKGNPTHANDLAYHILK----LIE---TEEYGIYHCTGK-GECTWYDFAK 232

Query: 228 YIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            I  E AE       V    +++Y T A RP YS LD   L  T    +  WKE +++  
Sbjct: 233 EIM-ELAENK---CIVNPCTSEEYKTPAKRPEYSSLDNMMLRCTIGDEMRDWKEALKSFF 288

Query: 288 VN 289
            N
Sbjct: 289 EN 290


>gi|30261326|ref|NP_843703.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. Ames]
 gi|47526496|ref|YP_017845.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49184158|ref|YP_027410.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. Sterne]
 gi|65318594|ref|ZP_00391553.1| COG1091: dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str.
           A2012]
 gi|165872857|ref|ZP_02217483.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A0488]
 gi|167636153|ref|ZP_02394458.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A0442]
 gi|167641233|ref|ZP_02399487.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A0193]
 gi|170686734|ref|ZP_02877954.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A0465]
 gi|170708895|ref|ZP_02899329.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A0389]
 gi|177654464|ref|ZP_02936361.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A0174]
 gi|190569153|ref|ZP_03022051.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis
           Tsiankovskii-I]
 gi|196036252|ref|ZP_03103651.1| dTDP-4-dehydrorhamnose reductase [Bacillus cereus W]
 gi|196044318|ref|ZP_03111554.1| dTDP-4-dehydrorhamnose reductase [Bacillus cereus 03BB108]
 gi|227815933|ref|YP_002815942.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. CDC 684]
 gi|228913893|ref|ZP_04077518.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228944928|ref|ZP_04107289.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229601322|ref|YP_002865747.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A0248]
 gi|254682613|ref|ZP_05146474.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str.
           CNEVA-9066]
 gi|254725410|ref|ZP_05187192.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A1055]
 gi|254734030|ref|ZP_05191744.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. Western
           North America USA6153]
 gi|254740823|ref|ZP_05198512.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. Kruger B]
 gi|254753666|ref|ZP_05205702.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. Vollum]
 gi|254758763|ref|ZP_05210790.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. Australia
           94]
 gi|30255180|gb|AAP25189.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. Ames]
 gi|47501644|gb|AAT30320.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49178085|gb|AAT53461.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. Sterne]
 gi|164711434|gb|EDR16985.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A0488]
 gi|167510874|gb|EDR86266.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A0193]
 gi|167528507|gb|EDR91272.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A0442]
 gi|170126211|gb|EDS95104.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A0389]
 gi|170669257|gb|EDT20000.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A0465]
 gi|172080748|gb|EDT65830.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A0174]
 gi|190559736|gb|EDV13723.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis
           Tsiankovskii-I]
 gi|195991227|gb|EDX55196.1| dTDP-4-dehydrorhamnose reductase [Bacillus cereus W]
 gi|196024957|gb|EDX63628.1| dTDP-4-dehydrorhamnose reductase [Bacillus cereus 03BB108]
 gi|227004044|gb|ACP13787.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. CDC 684]
 gi|228814597|gb|EEM60857.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228845832|gb|EEM90858.1| DTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229265730|gb|ACQ47367.1| dTDP-4-dehydrorhamnose reductase [Bacillus anthracis str. A0248]
          Length = 284

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 158/288 (54%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSLSS-MCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+              P +II+ AAY
Sbjct: 4   RVIITGANGQLGKQLQEELNPEEYDIYPFDKKLLDITNISQVQQVVQEIRPHIIIHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD+AE E ++A+ INA GA  +A A+  +G   +YISTDYVF G      DEF    P
Sbjct: 64  TKVDQAEKERDLAYVINAIGARNVAVASQLVGAKLVYISTDYVFQGDRPEGYDEFHNPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G+NF+ +M+RL KER EISVV DQ G
Sbjct: 124 INIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMIRLGKEREEISVVADQIG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  +    
Sbjct: 184 SPTYVADLNVMINKLIH-------TSLYGTYHVS-NTGSCSWFEFAKKIFSYANMK---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++   A RP YS    + L     +++ +W+EG+    +
Sbjct: 232 VNVLPVSTEEFGAAAARPKYSIFQHNMLRLNGFLQMPSWEEGLERFFI 279


>gi|315640671|ref|ZP_07895775.1| dTDP-4-dehydrorhamnose reductase [Enterococcus italicus DSM 15952]
 gi|315483567|gb|EFU74059.1| dTDP-4-dehydrorhamnose reductase [Enterococcus italicus DSM 15952]
          Length = 281

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 106/290 (36%), Positives = 159/290 (54%), Gaps = 17/290 (5%)

Query: 4   LVIGNNGQIAQSLSSMC-VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTA 62
           L+ G NGQ+   L  +   Q    +     ++D+   +   +      P VI + AAYTA
Sbjct: 3   LLTGGNGQLGTELRHLLDEQGHAYLSTDSHEMDITDAEATMAKIKEIQPKVIYHCAAYTA 62

Query: 63  VDKAEDE-PEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDG-LSRTPIDEFSPTNP 120
           VDKAEDE  E+   +N +G   +AKAA+++G   +YISTDYVFDG L        +PTNP
Sbjct: 63  VDKAEDEGKELDELVNVKGTENVAKAAEAVGATLVYISTDYVFDGTLKDGEYATDAPTNP 122

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           LN YG++KLAGEE V  Y + Y I+RT+WV+  +G NF+ +M +LA+    ++VV DQ+G
Sbjct: 123 LNEYGRTKLAGEEAVQKYMSKYYIIRTSWVFGKYGHNFVFTMQKLAQTHPTLTVVNDQYG 182

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
            PT    +A  +       I        GI+H++ D    +W +FA+ I  ++     P 
Sbjct: 183 RPTWTRTLAEFMTFATEKKIP------YGIYHLSNDHA-CTWYEFAKEILKDTDVDVQP- 234

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
                + + Q+P KAHRP YS +D SK A      I TW+E ++ +L ++
Sbjct: 235 -----VTSDQFPQKAHRPQYSVMDLSK-AKATGFTIPTWEEALKMMLESV 278


>gi|120437610|ref|YP_863296.1| dTDP-4-dehydrorhamnose reductase [Gramella forsetii KT0803]
 gi|117579760|emb|CAL68229.1| dTDP-4-dehydrorhamnose reductase [Gramella forsetii KT0803]
          Length = 282

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 149/286 (52%), Gaps = 13/286 (4%)

Query: 4   LVIGNNGQIAQSLSSMC--VQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           LV G NGQ+ Q          + +       ++D+        FF     D  IN AAYT
Sbjct: 5   LVTGANGQLGQCFQKQTQNFSNFKFFFCSSGELDITSKDALEQFFQKHQIDFCINTAAYT 64

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
            V++AE+E E AFS+NAEG   IA+     G    + STDYVF+G S+ P  E    +P+
Sbjct: 65  NVEQAENEEEKAFSVNAEGTKNIAEICKKHGAVLFHFSTDYVFNGQSQKPYKEIDEVDPI 124

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           N+YG SKL GEE++ S    Y ILRT+W+YS FG NF  ++LR  +E+ E+++   Q GT
Sbjct: 125 NVYGASKLKGEEEIQSTMEQYFILRTSWLYSEFGHNFFRTILRKVEEKAELNITTSQIGT 184

Query: 182 PTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYS 241
           PT+A  +A+ ++++      +S++   G++H + + G  +W DFA  I        G   
Sbjct: 185 PTNANDLAKFVLKMI-----SSESQDFGLYHFSNE-GQATWYDFAAEIL----NYSGKMD 234

Query: 242 KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
           +V    T  + T A RP YS L   K        I  WKE + N++
Sbjct: 235 QVQLNKTGFFKTLAERPEYSVLSKEKFTEQFG-PIDNWKESLFNLI 279


>gi|311109416|ref|YP_003982269.1| dTDP-4-dehydrorhamnose reductase [Achromobacter xylosoxidans A8]
 gi|310764105|gb|ADP19554.1| dTDP-4-dehydrorhamnose reductase [Achromobacter xylosoxidans A8]
          Length = 299

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 110/292 (37%), Positives = 160/292 (54%), Gaps = 9/292 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L++G +GQ+ + L    +   EI+ +GR   DL       +   S  PDVI+N AAY
Sbjct: 1   MKILLLGKDGQVGRELCHALLPFGEIVALGRDGADLRDQDALLAVLSSCRPDVIVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD AE++ E A  +NA     +A+ A +     ++ STDYVFDG  + P  E    NP
Sbjct: 61  TAVDAAENDRETATRVNALAVATLARHAQAARALLVHFSTDYVFDGAQQRPYSETDGPNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           LN+YG +KLAGE  + +   + ++ R  WVYS  G NFL +MLRLA ER+ ++VV DQ G
Sbjct: 121 LNVYGSTKLAGERAIQATGCDALVFRIGWVYSRHGKNFLNTMLRLALERQSLNVVSDQHG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSL-RGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
            PTSA  +A      A  + ++    L  G +H+ A  G  +W  +A YI   +A RG  
Sbjct: 181 APTSATFVADV---TALAIRQHCAGRLPAGTYHLAA-AGSTNWHAYARYIVAGAAARGAS 236

Query: 240 Y----SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
                 +++ I  + YP  A RP+ S LD +KL++   +R+ +W E V   L
Sbjct: 237 LMLAPEQIHAIAARDYPGAAQRPSNSTLDTAKLSHALQLRMPSWTEQVDRTL 288


>gi|329956905|ref|ZP_08297473.1| dTDP-4-dehydrorhamnose reductase [Bacteroides clarus YIT 12056]
 gi|328523662|gb|EGF50754.1| dTDP-4-dehydrorhamnose reductase [Bacteroides clarus YIT 12056]
          Length = 286

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 159/286 (55%), Gaps = 12/286 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVE--IIRVGRPDIDLLKPKDFASFFLSFSPDVIINPA 58
           M  LV G NGQ+   + ++  ++ +         ++D+   +   +F      DVI+N A
Sbjct: 1   MNILVTGANGQLGNEMRALSAENQQHTYFFTDVQELDICDEQAIRTFVAGNRVDVIVNCA 60

Query: 59  AYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPT 118
           AYTAVDKAED PE+   +N    G +A AA++ G   I +STDYVFDG    P  E    
Sbjct: 61  AYTAVDKAEDNPELCDKLNHVAPGYLAAAAEACGAAMIQVSTDYVFDGTGHIPYTEEVTP 120

Query: 119 NPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQ 178
            P ++YG +KLAGE+ V    +  +++RTAW+YS++G+NF+ +M+RL  ER ++ VV DQ
Sbjct: 121 CPNSVYGSTKLAGEQAVMEKCSRAMVIRTAWLYSVYGNNFVKTMIRLGNEREKLGVVFDQ 180

Query: 179 FGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGG 238
            GTPT A  +ARAI    +  I      + GI+H + D G  SW DF   I   +   G 
Sbjct: 181 IGTPTYANDLARAIFAAINRGI------VPGIYHFS-DEGVCSWYDFTVAIHRIA---GI 230

Query: 239 PYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
              KV  + T +YP KA RP YS LD +K+  T  I I  W+E ++
Sbjct: 231 TSCKVSPLHTDEYPAKAPRPQYSVLDKTKIKKTFGIGIPHWEESLQ 276


>gi|187927733|ref|YP_001898220.1| dTDP-4-dehydrorhamnose reductase [Ralstonia pickettii 12J]
 gi|187724623|gb|ACD25788.1| dTDP-4-dehydrorhamnose reductase [Ralstonia pickettii 12J]
          Length = 306

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 109/292 (37%), Positives = 150/292 (51%), Gaps = 10/292 (3%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYT 61
           + +V G  GQ+   L        EII V R  +DL +     +   S  P +I+N AAYT
Sbjct: 8   RIVVTGTTGQVGWELLRSLQGLGEIISVDRSVVDLSRLDAVRALIRSIEPSIIVNAAAYT 67

Query: 62  AVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPL 121
           AVDKAE EP+ AF +NA+  G +A+         I+ STDYVFDG    P  E   TNPL
Sbjct: 68  AVDKAEQEPDPAFRLNADLPGVLAEECKRTQAAFIHYSTDYVFDGRKDGPYTEADATNPL 127

Query: 122 NIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGT 181
           N+YG SKLAGE          ++ RT+WVY   G NFL ++ RLAKER+++ VV DQ G 
Sbjct: 128 NVYGASKLAGEHNALDANPATLVFRTSWVYGARGKNFLTTIQRLAKERQQLRVVSDQIGA 187

Query: 182 PTSALQIARAIIQIAHNLIENSD------TSLRGIFHMTADGGPVSWADFAEYIFWESAE 235
           PT +  IA     +    + ++       T   G++H+T++G   SW  FAE I   S  
Sbjct: 188 PTWSRSIADLTAHVIARGLGSTHAEPAWWTVHGGVYHLTSNGS-TSWYGFAEAILQRSGI 246

Query: 236 RGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            G     V  I   +YPT A RP  S L  +KL +   +   +W++ +   L
Sbjct: 247 TG---VAVEPIPAMEYPTPAVRPGNSRLALNKLQSVFGLVPESWEQSLTKCL 295


>gi|330988616|gb|EGH86719.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 301

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 163/299 (54%), Gaps = 14/299 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI---------DLLKPKDFASFFLSFSP 51
           MK L++G NGQ+   L        E+I + R  +         DL   +   +      P
Sbjct: 1   MKILLLGKNGQVGWELQRSLAVVGEVIALDRHTVSTAYGDLSGDLSNLEGLRNSIRRIQP 60

Query: 52  DVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTP 111
            VI+N AAYTAVDKAE E E+A ++NA  +  +A+ A ++    ++ STDYVFDG   T 
Sbjct: 61  QVIVNAAAYTAVDKAETERELAHTVNALASQVMAEEAQTLDALLVHYSTDYVFDGSGNTA 120

Query: 112 IDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERRE 171
             E    +P+N YG +KL GE+ +A+    ++I RT+WVY+  G+NF  +MLRLAK+R  
Sbjct: 121 WKESDAVSPVNYYGATKLEGEQLIAASGCKHLIFRTSWVYAARGNNFAKTMLRLAKDRPT 180

Query: 172 ISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFW 231
           ++V+ DQ G PT A  +A   I  A  L   +   L GI+++ A  G VSW  +A+Y+  
Sbjct: 181 LNVIADQIGAPTGAELLAD--IATAALLQTLAKPELCGIYNL-APAGEVSWHAYAQYVID 237

Query: 232 ESAERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
            +   G P +   +  I T +YPT A RP  S L+  KL +  ++ +  W+ GV  +L+
Sbjct: 238 FARANGEPLAVETINPIGTIEYPTPAQRPLNSRLNTEKLRHNFSLHLPDWQSGVARMLM 296


>gi|13518096|gb|AAK27394.1| putative dTDP-4-keto-L-rhamnose reductase [Burkholderia mallei]
          Length = 298

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 117/297 (39%), Positives = 154/297 (51%), Gaps = 21/297 (7%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LV G NGQ+   L+       +++ + R   DL +P+  A       PDV++N AAY
Sbjct: 1   MKILVTGANGQVGWELARSLAVLGQVVPLTREQADLGRPETLARIVEDAKPDVVVNAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVD AE +   A  IN E  G +A A   +G   ++ STDYVFDG   +P  E  PT P
Sbjct: 61  TAVDAAETDGAAANVINGEAVGVLAAATKRVGGLFVHYSTDYVFDGTKPSPYIETDPTCP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +N YG SKL GE  VA    +++  RT WV++  G NFL +MLRLAKER E+ +V DQFG
Sbjct: 121 VNAYGASKLLGELAVAETGGDWLTFRTTWVFAARGKNFLRTMLRLAKEREEMKIVADQFG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLR---------GIFHMTADGGPVSWADFAEYIF- 230
            PT A  IA      AH L     T++R         G++HMT+  G  SW  FA+ I  
Sbjct: 181 APTWARSIADG---TAHALT----TAMRERAAGAFTSGVYHMTS-AGQTSWHGFADAIIA 232

Query: 231 -WESAERGGPY--SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVR 284
            W +A    P   S++  I    YP  A RPA S L    L     I +  W+  +R
Sbjct: 233 SWRAAPGAAPLAVSRIVPIPASAYPVPAQRPANSVLSNKALKERFGIELPDWRYALR 289


>gi|229090266|ref|ZP_04221511.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus Rock3-42]
 gi|228693046|gb|EEL46762.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus Rock3-42]
          Length = 284

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 158/288 (54%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSLSS-MCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+              P +II+ AAY
Sbjct: 4   RVIITGANGQLGKQLQEELNPEEYDIYPFDKKLLDITNISQVQQVVQEIRPHIIIHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD+AE E ++A+ INA GA  +A A+  +G   +YISTDYVF G      DEF    P
Sbjct: 64  TKVDQAEKERDLAYVINAIGARNVAVASQLVGAKLVYISTDYVFQGDRPEGYDEFHNPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G+NF+ +M+RL KER EISVV DQ G
Sbjct: 124 INIYGASKCAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMIRLGKEREEISVVADQIG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  +    
Sbjct: 184 SPTYVADLNVMINKLIH-------TSLYGTYHVS-NTGSCSWFEFAKKIFSYANMK---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++   A RP YS    + L     +++ +W+EG+    +
Sbjct: 232 VNVLPVSTEEFGAAAARPKYSIFQHNMLRLNGFLQMPSWEEGLERFFI 279


>gi|254284101|ref|ZP_04959069.1| dTDP-4-dehydrorhamnose reductase [gamma proteobacterium NOR51-B]
 gi|219680304|gb|EED36653.1| dTDP-4-dehydrorhamnose reductase [gamma proteobacterium NOR51-B]
          Length = 301

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 154/290 (53%), Gaps = 11/290 (3%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L++G NGQ+   L      D E+I   R D+D+         F  +    +IN +AYTAV
Sbjct: 8   LLLGANGQLGSELQFTKPGDTELIACARTDLDIADTDALQRAFTRYRFQSVINASAYTAV 67

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D AE E E A ++N +G   +A    + G+  ++ISTD++FDG+  +P       NPL  
Sbjct: 68  DAAETEREAAHAVNTKGPARLADLCAAHGVRLLHISTDFIFDGMKGSPYRIDDTPNPLGH 127

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG +KLAGE  V     + +++RT WVYS  GSNF+ +MLRL  ER  +SVV DQ GTPT
Sbjct: 128 YGVTKLAGERAVLGSGADALVVRTGWVYSAQGSNFVRTMLRLMAERDRLSVVEDQVGTPT 187

Query: 184 SALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSK- 242
                AR +  +   L+  +D    G +H + D G  SW DFA  I  + A R G   + 
Sbjct: 188 ----WARGLANVCWTLL--ADPGAYGCYHWS-DAGACSWYDFAVAIA-DEASRIGLLDRA 239

Query: 243 --VYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             +  I +  YPT A RPAYS LD +      N     W+E +R++L+ +
Sbjct: 240 PAIVPIPSSDYPTPARRPAYSVLDKTGTRERLNYPGVHWREALRSMLLEV 289


>gi|206900293|ref|YP_002250033.1| dTDP-4-dehydrorhamnose reductase [Dictyoglomus thermophilum H-6-12]
 gi|206739396|gb|ACI18454.1| dTDP-4-dehydrorhamnose reductase [Dictyoglomus thermophilum H-6-12]
          Length = 292

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 149/264 (56%), Gaps = 11/264 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK +++G  GQ+   +        EI      ++D+L             PDV+IN +AY
Sbjct: 5   MKIVILGGKGQLGTEIYEYLKDKEEIYSFSHQELDILNYDLLEKKLQEIKPDVVINCSAY 64

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VDKAE+E +    +N  GA  ++  A  +G   +Y STDY+FDG   TP  EF   NP
Sbjct: 65  TKVDKAEEEKDECIKVNTIGAKYVSFLAYKVGAKIVYFSTDYIFDGEKSTPYTEFDDPNP 124

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L++YG SKL GE+    +  N++ILR +W+Y I+G NF+ ++L LA+ER+++++V DQ G
Sbjct: 125 LSVYGLSKLYGEKLTIEHNPNHLILRISWLYGIYGRNFVKTILNLARERKKLTIVNDQKG 184

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT  L +A+ +    + LI+       GI+H +++ G  +W DFA+ I      +    
Sbjct: 185 SPTYTLDVAKQV----YELIKKDKV---GIYH-SSNQGETTWYDFAKRIIEILKIKD--- 233

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLD 264
            +V  I T++YP+ A RP YS LD
Sbjct: 234 VEVLPIKTEEYPSIAKRPKYSVLD 257


>gi|168211916|ref|ZP_02637541.1| dTDP-4-dehydrorhamnose reductase [Clostridium perfringens B str.
           ATCC 3626]
 gi|170710142|gb|EDT22324.1| dTDP-4-dehydrorhamnose reductase [Clostridium perfringens B str.
           ATCC 3626]
          Length = 294

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 107/302 (35%), Positives = 156/302 (51%), Gaps = 25/302 (8%)

Query: 1   MKCLVIGNNGQIAQSLSSMC-------------VQDVEIIRVGRPDIDLLKPKDFASFFL 47
           MK L+ G+NGQ+   L S+              +++ E+I +    +D+   ++  +   
Sbjct: 1   MKILITGSNGQLGNELQSIIKSGKAEIGSVSENIKNSEVIALDVDKLDITSLENVKNVLN 60

Query: 48  SFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGL 107
              PDV+IN AA T VD  E   + AF +N+ GA  +A   + I    + +STDYVF G 
Sbjct: 61  EEKPDVVINCAAATNVDGCESNEDFAFKVNSLGARNLAMVCEEIVAKLVQVSTDYVFSGF 120

Query: 108 SRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAK 167
              P+ EF  T P ++YGK+KL GE  V  + + Y I+RTAW+Y   G NF+ +M+RL K
Sbjct: 121 GEKPLTEFDLTAPYSVYGKTKLLGENYVKEFCSKYYIVRTAWLYGYVGHNFVYTMMRLGK 180

Query: 168 ERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAE 227
           E+  ++VV DQ G PT A  +A  I++    LIE   T   GI+H T   G  +W DFA+
Sbjct: 181 EKESLNVVNDQKGNPTHANDLAYHILK----LIE---TEEYGIYHCTGK-GECTWYDFAK 232

Query: 228 YIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
            I     E  G    V    +++Y T A RP YS LD   L  T    +  WKE +++  
Sbjct: 233 EIM----ELAGNKCIVNPCTSEEYKTPAKRPEYSSLDNMMLRCTIGDEMRDWKEALKSFF 288

Query: 288 VN 289
            N
Sbjct: 289 EN 290


>gi|198277052|ref|ZP_03209583.1| hypothetical protein BACPLE_03260 [Bacteroides plebeius DSM 17135]
 gi|198269550|gb|EDY93820.1| hypothetical protein BACPLE_03260 [Bacteroides plebeius DSM 17135]
          Length = 285

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 105/284 (36%), Positives = 155/284 (54%), Gaps = 12/284 (4%)

Query: 2   KCLVIGNNGQIAQSLSSMCVQ--DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           K LV G NGQ+   +  +  +  + E       ++D+   +    F  +   DVI+N AA
Sbjct: 3   KILVTGANGQLGNEMRLLAEKHRNFEYFFTDVAELDICDEQAVMEFVSAHQIDVIVNCAA 62

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAED  E+   +N    G +AKAA S     + +STDYVFDG +  P  E     
Sbjct: 63  YTAVDKAEDNVELCDKLNHVAPGYLAKAAQSRNGWLVQVSTDYVFDGTAHVPYKEEDTPC 122

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P ++YG +KLAGE++      N +++RTAW+YS FG+NF+ +M+RL +E+  + V+ DQ 
Sbjct: 123 PNSVYGSTKLAGEQEALKQCPNTMVIRTAWLYSTFGNNFVKTMIRLGQEKETLGVIFDQI 182

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGP 239
           GTPT A  +A+AI       I      + GI+H + + G  SW DF + I   +   G  
Sbjct: 183 GTPTYARDLAQAIFVALEKGI------VPGIYHFSNE-GVCSWYDFTKAIHRLA---GIT 232

Query: 240 YSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
              V  + T+ YPTKA RP YS LD +KL  T+ + +  W + +
Sbjct: 233 TCHVSPLHTEDYPTKACRPHYSVLDKTKLKKTYGVEVPYWMDSL 276


>gi|229177736|ref|ZP_04305110.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus 172560W]
 gi|228605700|gb|EEK63147.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus 172560W]
          Length = 284

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 155/288 (53%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+              P +II+ AAY
Sbjct: 4   RVIITGANGQLGKQLFEELDSEEYDIYPFDKKLLDVTNISRIQQVVQEIKPHIIIHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD AE E + A+ INA GA  +A A+  +G   +YISTDYVF G      DEF    P
Sbjct: 64  TKVDHAEKEQDFAYRINAIGARNVAVASQLVGAKLVYISTDYVFQGARPDGYDEFHSPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G+NF+ +M+RL KER EISVV DQ G
Sbjct: 124 INIYGASKYAGEQFVKGLHNKYFIVRTSWLYGKYGNNFVKTMMRLGKERDEISVVADQVG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  +    
Sbjct: 184 SPTYVADLNMVINKLIH-------TSLYGTYHVS-NSGSCSWFEFAQKIFSYANMK---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++   A RP YS    + L      ++ +W+EG+    +
Sbjct: 232 VNVLPVSTEEFGAAAARPKYSVFQHNMLRLNGFSQMPSWEEGLERFFI 279


>gi|171057311|ref|YP_001789660.1| dTDP-4-dehydrorhamnose reductase [Leptothrix cholodnii SP-6]
 gi|170774756|gb|ACB32895.1| dTDP-4-dehydrorhamnose reductase [Leptothrix cholodnii SP-6]
          Length = 296

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 108/297 (36%), Positives = 157/297 (52%), Gaps = 11/297 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDID----LLKPKDFASFFLSFSPDVIIN 56
           MK L++G NGQ+   L        E+I + R   D    L +P   A+   +  P VI+N
Sbjct: 1   MKILLLGKNGQLGWELQRALAPLGELIALDRHATDFAADLAQPDSLAATVRALQPQVIVN 60

Query: 57  PAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFS 116
            AAYTAVDKAE EPE+A ++NA   G +A+AA   G   ++ STDYVFDG       E +
Sbjct: 61  AAAYTAVDKAESEPELARTVNATSPGVLAQAAAEAGAWLLHYSTDYVFDGSGTAARSEDA 120

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
            T PLN+YG++KL GE  + +    ++ILRT+WVY+  G NF  +MLRLA ER  ++V+ 
Sbjct: 121 ATAPLNVYGQTKLEGEAAIRASGCRHLILRTSWVYAARGGNFAKTMLRLAGERERLTVID 180

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G PT A  +A     +    ++  + +  G +H  A GG  SW  +A ++  E A  
Sbjct: 181 DQIGAPTGADLLADLSAHMLRQALQQPECA--GTYHAVA-GGETSWHAYARHVI-EWARA 236

Query: 237 GGPYSKVYRIF---TKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
            G   K   I    +  + T A RP  S L  ++L     + +  W+ GV  +L  +
Sbjct: 237 HGHELKATDIAAVPSSAFATAAQRPLNSRLSTARLQQVFGLHLPHWQTGVDRMLAEV 293


>gi|301299656|ref|ZP_07205913.1| dTDP-4-dehydrorhamnose reductase [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|300852750|gb|EFK80377.1| dTDP-4-dehydrorhamnose reductase [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 279

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 156/294 (53%), Gaps = 21/294 (7%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQ-DVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK L+ G NGQ+ Q +  +  +   E +      +D+   +   ++F    P+V+ + AA
Sbjct: 1   MKVLITGANGQLGQEMQHLLDERGQEYLAEDSQGLDITDKEAVDAYFEKNKPEVVYHCAA 60

Query: 60  YTAVDKAEDE-PEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEF--S 116
           YTAVDKAE E  E+ + +N +G   IAKA   +G   +Y+STDYVFDG +RT  +     
Sbjct: 61  YTAVDKAEGEGKELNWKVNVDGTENIAKACQKVGATLLYVSTDYVFDG-NRTSGEYLPDD 119

Query: 117 PTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVC 176
           P  P N YGK+KLAGEE V  Y + Y I+RTAWVY  +G NF+ +M+ LAK   +++VV 
Sbjct: 120 PKGPRNEYGKAKLAGEEAVQKYCDKYYIIRTAWVYGQWGHNFVYTMINLAKNHDKLTVVD 179

Query: 177 DQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAER 236
           DQ G PT    +A  +  +  N +E       G++H   D G  SW +FA+ I  ++   
Sbjct: 180 DQVGRPTWTRTLAEFLTYLVDNKVE------YGVYHCCND-GQCSWYEFAKEILKDTNVD 232

Query: 237 GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
             P      + + QYPT A RP YS +   KLA         WKE +   L  +
Sbjct: 233 VQP------VTSDQYPTAAFRPHYSVM---KLAKETGFVFPDWKEALDEFLSEV 277


>gi|229108781|ref|ZP_04238388.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus Rock1-15]
 gi|229149526|ref|ZP_04277758.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus m1550]
 gi|228633872|gb|EEK90469.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus m1550]
 gi|228674672|gb|EEL29909.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus Rock1-15]
          Length = 284

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 156/288 (54%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+              P +II+ AAY
Sbjct: 4   RVIITGANGQLGKQLFEELDSEEYDIYPFDKKLLDVTNISRIQQVVQEIKPHIIIHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD AE E ++A+ INA GA  +A A+  +G   +YISTDYVF G      DEF    P
Sbjct: 64  TKVDHAEKEQDLAYRINAIGARNVAVASQLVGAKLVYISTDYVFQGARPDGYDEFHSPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G+NF+ +M+RL KER EISVV DQ G
Sbjct: 124 INIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMMRLGKERDEISVVADQVG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  +    
Sbjct: 184 SPTYVADLNMVINKLIH-------TSLYGTYHVS-NRGSCSWFEFAQKIFSYANMK---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++   A RP YS    + L      ++ +W+EG+    +
Sbjct: 232 VHVLPVSTEEFGAAAARPKYSIFQHNMLRLNGFSQMPSWEEGLERFFI 279


>gi|221214409|ref|ZP_03587380.1| dTDP-4-dehydrorhamnose reductase [Burkholderia multivorans CGD1]
 gi|221165666|gb|EED98141.1| dTDP-4-dehydrorhamnose reductase [Burkholderia multivorans CGD1]
          Length = 303

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 108/288 (37%), Positives = 148/288 (51%), Gaps = 14/288 (4%)

Query: 4   LVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAV 63
           L+ G NGQ+   L         ++ + R  +DL +            PD+I+NPAAYTAV
Sbjct: 10  LLTGINGQVGFELQRTLQGLGNVVALDRSRLDLSRLDQVRDVVRDLKPDLIVNPAAYTAV 69

Query: 64  DKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNI 123
           D+AE +  +A  +NAE    +A+ A  IG   I+ STDYVF G    P  E  P +P N+
Sbjct: 70  DQAETDVAMATRLNAEAPAVLAEEAKRIGAALIHYSTDYVFSGTKEGPYVEDDPVDPQNV 129

Query: 124 YGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPT 183
           YG++KL GE  +A+    ++I RT+WVY   G NFLL+MLRL  ER E++VV DQ G PT
Sbjct: 130 YGRTKLDGERAIAASGCAHLIFRTSWVYGTRGKNFLLTMLRLGAERDELNVVADQIGAPT 189

Query: 184 SALQIARAIIQIAHNLIENSDTSLR--------GIFHMTADGGPVSWADFAEYIFWESAE 235
            +  IA      AH + +     +R        GI+H+ A  G  SW  FAE IF  +  
Sbjct: 190 WSNTIA---TLTAHVVAQAISAPMRDEWWHAHSGIYHLCA-AGSTSWHGFAEAIFRLADL 245

Query: 236 RGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGV 283
              P   V  I    YPT A RPA S +  +KLA    +    W+  +
Sbjct: 246 PKKP--AVMPIPASAYPTPAKRPANSQMSNAKLAEHFGLHAPHWEAAL 291


>gi|52840994|ref|YP_094793.1| dTDP-6-deoxy-L-mannose dehydrogenase RmlD [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|54296784|ref|YP_123153.1| dTDP-4-keto-L-rhamnose reductase [Legionella pneumophila str.
           Paris]
 gi|6688598|emb|CAB65207.1| RmlD protein [Legionella pneumophila]
 gi|52628105|gb|AAU26846.1| dTDP-6-deoxy-L-mannose dehydrogenase RmlD [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|53750569|emb|CAH11971.1| dTDP-4-keto-L-rhamnose reductase [Legionella pneumophila str.
           Paris]
          Length = 294

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 157/290 (54%), Gaps = 5/290 (1%)

Query: 1   MKCLVIGNNGQIA-QSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAA 59
           MK LV G NGQ+  + +      + E+    R  +D  K +          PD+IIN AA
Sbjct: 1   MKILVTGANGQVGTEIIKRFSSSEHEVYACTRDILDCSKLERVHDVLSEIKPDLIINAAA 60

Query: 60  YTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTN 119
           YTAVDKAEDEP++A  +NAE    +        +P I++STDYVFDG       E    +
Sbjct: 61  YTAVDKAEDEPDLAHIVNAEFVCRLVNYCTLKNVPLIHLSTDYVFDGEKEGAYHETDIPH 120

Query: 120 PLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQF 179
           P++ YG++K  GE+ + S    Y+ILR +WV+   G NF+ ++L LA  R+E+++V DQ 
Sbjct: 121 PVSTYGRTKWEGEQAILSQLKKYIILRVSWVFGEQGKNFVKTILNLASSRKELNIVSDQS 180

Query: 180 GTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG-- 237
           G PTSA  IAR + +I    I +S     G++H  A  G  +W +FA      + E+   
Sbjct: 181 GRPTSARDIARVLFEIVQK-IRHSSFDYWGLYHY-AGQGVTNWHEFANVFLNMAKEKQLL 238

Query: 238 GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNIL 287
              + +  I +++YPT+A RP  S LD +K+     I+  +WK  + +++
Sbjct: 239 LTLTDLNPIKSQEYPTRATRPKNSVLDTTKIETILGIKSCSWKNDLPDVI 288


>gi|30019368|ref|NP_830999.1| dTDP-4-dehydrorhamnose reductase [Bacillus cereus ATCC 14579]
 gi|229126629|ref|ZP_04255641.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus BDRD-Cer4]
 gi|229143930|ref|ZP_04272347.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus BDRD-ST24]
 gi|29894911|gb|AAP08200.1| dTDP-4-dehydrorhamnose reductase [Bacillus cereus ATCC 14579]
 gi|228639493|gb|EEK95906.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus BDRD-ST24]
 gi|228656569|gb|EEL12395.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus BDRD-Cer4]
          Length = 284

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 156/288 (54%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+              P +II+ AAY
Sbjct: 4   RVIITGANGQLGKQLFEELDSEEYDIYPFDKKLLDVTNISRIQQVVQEIKPHIIIHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD AE E ++A+ INA GA  +A A+  +G   +YISTDYVF G      DEF    P
Sbjct: 64  TKVDHAEKEQDLAYRINAIGARNVAVASQLVGAKLVYISTDYVFQGARPDGYDEFHSPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G+NF+ +M+RL KER EISVV DQ G
Sbjct: 124 INIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMMRLGKERDEISVVADQVG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  +    
Sbjct: 184 SPTYVADLNMVINKLIH-------TSLYGTYHVS-NRGSCSWFEFAQKIFSYANMK---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++   A RP YS    + L      ++ +W+EG+    +
Sbjct: 232 VNVLPVSTEEFGAAAARPKYSIFQHNMLRLNGFSQMPSWEEGLERFFI 279


>gi|229132120|ref|ZP_04260979.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus BDRD-ST196]
 gi|228651340|gb|EEL07316.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus BDRD-ST196]
          Length = 284

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 155/288 (53%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSLSS-MCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+              P  I++ AAY
Sbjct: 4   RIIITGANGQLGKQLQEELNSEEYDIYPFDKKLLDVTNISRIKQVVQEIKPHTIVHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD AE E ++A+ INA GA  +A A+  +G   +Y+STDYVF G       EF    P
Sbjct: 64  TKVDGAEKEQDLAYLINAIGARNVAVASQLVGAKLVYVSTDYVFPGDKPDGYHEFHNPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G+NF+ +MLRL KER  ISVV DQ G
Sbjct: 124 INIYGASKFAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMLRLGKERENISVVADQVG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  R    
Sbjct: 184 SPTYVADLITVINKLIH-------TSLYGTYHVS-NRGSCSWFEFAQKIFSHTKIR---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++ + A RP YS      L     +++STW+EG+    +
Sbjct: 232 VNVLPVSTEEFGSAAVRPKYSIFQHKMLQLNGFLQMSTWEEGLERFFI 279


>gi|296501911|ref|YP_003663611.1| dTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis BMB171]
 gi|296322963|gb|ADH05891.1| dTDP-4-dehydrorhamnose reductase [Bacillus thuringiensis BMB171]
          Length = 284

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 156/288 (54%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+              P +II+ AAY
Sbjct: 4   RVIITGANGQLGKQLFEELDSEEYDIYPFDKKLLDVTNISRIQQVVQEIKPHIIIHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD AE E ++A+ INA GA  +A A+  +G   +YISTDYVF G      DEF    P
Sbjct: 64  TKVDHAEKEQDLAYRINAIGARNVAVASQLVGAKLVYISTDYVFQGARPDGYDEFHSPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G+NF+ +M+RL KER EISVV DQ G
Sbjct: 124 INIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMMRLGKERDEISVVADQVG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  +    
Sbjct: 184 SPTYVADLNMVINKLIH-------TSLYGTYHVS-NRGSCSWFEFAQKIFSYANMK---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++   A RP YS    + L      ++ +W+EG+    +
Sbjct: 232 VNVLPVSTEEFGAAATRPKYSIFQHNMLRLNGFSQMPSWEEGLERFFI 279


>gi|124025563|ref|YP_001014679.1| putative dTDP-4-dehydrorhamnose reductase [Prochlorococcus marinus
           str. NATL1A]
 gi|123960631|gb|ABM75414.1| putative dTDP-4-dehydrorhamnose reductase [Prochlorococcus marinus
           str. NATL1A]
          Length = 297

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 106/296 (35%), Positives = 153/296 (51%), Gaps = 7/296 (2%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK L+ G +GQ+ Q++       VE+I   R ++DL   +          PD +IN  AY
Sbjct: 1   MKVLLTGASGQLGQAIIKSKPSFVELIATTRRELDLADDEACRRAVRQHQPDWVINSGAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAEDE E+A SIN       A+     G   + +STD+VFDG    P        P
Sbjct: 61  TAVDKAEDEKELAMSINTIAPKMFAEELSQTGGKLLQLSTDFVFDGEQNFPYKTGQKKKP 120

Query: 121 LNIYGKSKLAGEE---KVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCD 177
           L +YG +K AGE+    V   +N  +I+RT+W++   G NF+ +M+RL + + EI VV D
Sbjct: 121 LGVYGATKAAGEDAIYDVLGNSNQALIIRTSWLFGAVGKNFMKTMIRLHRSQEEIRVVSD 180

Query: 178 QFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERG 237
           Q G PTS L +A+A  +      +     L    H  +D G  SW +FA+ I  E   R 
Sbjct: 181 QIGCPTSTLTLAKACWRAIEKQKDIEPNVLSPQLHHWSDEGSASWYEFAKVIG-ELGCRI 239

Query: 238 GPY---SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           G     +KV  I +++Y T+A RP YS LDC+      N+    WKE + N++  +
Sbjct: 240 GLIERPAKVIPISSEEYTTRAKRPKYSILDCTTTRQFLNLEGIHWKESILNVMKQV 295


>gi|89899525|ref|YP_521996.1| dTDP-4-dehydrorhamnose reductase [Rhodoferax ferrireducens T118]
 gi|89344262|gb|ABD68465.1| dTDP-4-dehydrorhamnose reductase [Rhodoferax ferrireducens T118]
          Length = 300

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 116/303 (38%), Positives = 155/303 (51%), Gaps = 20/303 (6%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVG-----RPDI---DLLKPKDFASFFLSFSPD 52
           MK L+ G  GQ+   L        E++ +G      PD    D       A       PD
Sbjct: 1   MKILLFGRGGQVGWELQRSLSVLGELVALGSDASHNPDGLCGDFSHLPGLAETIRRVKPD 60

Query: 53  VIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPI 112
           VI+N AA+TAVDKAE EPE A ++NA   G +A  A  +G   ++ STDYVFDG  +   
Sbjct: 61  VIVNAAAHTAVDKAEAEPERARALNALAPGVLAAEAQKLGAWLLHYSTDYVFDGSGQQAW 120

Query: 113 DEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREI 172
            E   T PL++YGK+KL GE  V S    ++I RT+WVY+  G NF  +MLRLA ER  +
Sbjct: 121 REGDATGPLSVYGKTKLEGEHLV-SACAKHLIFRTSWVYAARGGNFAKTMLRLAGERDTL 179

Query: 173 SVVCDQFGTPTSALQIARAIIQIAHNLIENSDT-SLRGIFHMTADGGPVSWADFAEYIFW 231
           +V+ DQ G PTSA  +A      AH L +      L G++H  A GG  SW  +A Y+  
Sbjct: 180 TVIDDQIGAPTSAELLADV---TAHALAKAMRAPELAGLYHCVA-GGETSWYGYARYVLG 235

Query: 232 ESAERG-----GPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
           ++   G     GP  +V    T  YPT A RP  S LD  KL     + +  W++GV  +
Sbjct: 236 QAQALGCQLKAGP-DQVLPTATASYPTPARRPLNSRLDTLKLQAAFGLVLPPWQQGVARM 294

Query: 287 LVN 289
           L  
Sbjct: 295 LAE 297


>gi|170720582|ref|YP_001748270.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas putida W619]
 gi|169758585|gb|ACA71901.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas putida W619]
          Length = 301

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 160/299 (53%), Gaps = 14/299 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI---------DLLKPKDFASFFLSFSP 51
           MK L++G NGQ+   L        E++ + R            DL   +   +   S +P
Sbjct: 1   MKILLLGKNGQVGWELQRALSVLGEVVALDRHRASTPYGELAGDLSDLEGLRATIRSVAP 60

Query: 52  DVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTP 111
            VI+N AAYTAVDKAE E E+A ++NA  +  +A+ A  +    ++ STDYVFDG    P
Sbjct: 61  QVIVNAAAYTAVDKAESERELAHTVNALASQVMAEEAKRLDAWLVHYSTDYVFDGSGSAP 120

Query: 112 IDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERRE 171
             E  P  P+N YG +KL GE+ + +    ++I RT+WVY+  G+NF  +MLRLAK+R  
Sbjct: 121 WKETDPVAPVNYYGATKLEGEQLIQASGCKHLIFRTSWVYAARGNNFAKTMLRLAKDRAT 180

Query: 172 ISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFW 231
           ++V+ DQ G PT A  +A   +      +   +  L GI+H+ A  G  +W  +A  +  
Sbjct: 181 LNVIADQVGVPTGADLLADVAVAALQQALHKPE--LAGIYHL-APAGETTWHAYASDVIA 237

Query: 232 ESAERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
            + ++G   +   +  I T +YPT A RP  S L  +KL N+ ++ +  W+ GV  +L+
Sbjct: 238 FARDQGETLAVEAINPIATTEYPTPAKRPLNSRLSTAKLRNSFSLHLPDWQSGVTRMLM 296


>gi|329119276|ref|ZP_08247963.1| dTDP-4-dehydrorhamnose reductase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327464623|gb|EGF10921.1| dTDP-4-dehydrorhamnose reductase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 289

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 117/291 (40%), Positives = 166/291 (57%), Gaps = 11/291 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M  L+ G NGQ+ + L +       I+  GR  +D+  P        +F P VIIN AAY
Sbjct: 1   MNILITGANGQVGRELVARLQDRATILAAGRDTLDITDPAAVERTAAAFRPHVIINAAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAE +   A+++N +    +A+AA       +++STDYVFDG    P  E  P  P
Sbjct: 61  TAVDKAESDAATAYAVNRDAVRHLARAAAEHNAALLHLSTDYVFDGTLNRPYRETDPATP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
            +IYG+SKLAGE+  A+    ++ILRTAWV+   G NF+ +MLRLA+ER  + +V DQ+G
Sbjct: 121 QSIYGQSKLAGEQAAAA-CPRHIILRTAWVFGAHGRNFVKTMLRLARERDSLGIVADQYG 179

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGP-VSWADFAEYIFWESAER--- 236
            PT+A  IA A+I IA     +  T   GI+H +  G P +SW  FA+ IF  +A +   
Sbjct: 180 APTAAADIAAALITIAERTQFHRFTDW-GIYHFS--GNPYLSWYGFAKTIFQAAAAQNLL 236

Query: 237 -GGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNI 286
              P  K   + T+ YPT A RPA S LDC+K+ +T  I  S W+  + ++
Sbjct: 237 PAAPQLKA--LATEDYPTPARRPANSRLDCTKIRDTFGIAPSDWQAALADL 285


>gi|229189410|ref|ZP_04316427.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus ATCC 10876]
 gi|228594001|gb|EEK51803.1| DTDP-4-dehydrorhamnose reductase [Bacillus cereus ATCC 10876]
          Length = 284

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 155/288 (53%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSL-SSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+              P +II+ AAY
Sbjct: 4   RVIITGANGQLGKQLFEELDSEEYDIYPFDKKLLDVTNISRIQQVVQEIKPHIIIHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD AE E + A+ INA GA  +A A+  +G   +YISTDYVF G      DEF    P
Sbjct: 64  TKVDHAEKEQDFAYRINAIGARNVAVASQLVGAKLVYISTDYVFQGARPDGYDEFHSPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G+NF+ +M+RL KER EISVV DQ G
Sbjct: 124 INIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMMRLGKERDEISVVADQVG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  +    
Sbjct: 184 SPTYVADLNMVINKLIH-------TSLYGTYHVS-NSGSCSWFEFAQKIFSYANMK---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++   A RP YS    + L      ++ +W+EG+    +
Sbjct: 232 VNVLPVSTEEFGAAAARPKYSVFQHNMLRLNGFSQMPSWEEGLERFFI 279


>gi|42780412|ref|NP_977659.1| dTDP-4-dehydrorhamnose reductase [Bacillus cereus ATCC 10987]
 gi|42736331|gb|AAS40267.1| dTDP-4-dehydrorhamnose reductase [Bacillus cereus ATCC 10987]
          Length = 284

 Score =  179 bits (453), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 158/288 (54%), Gaps = 13/288 (4%)

Query: 2   KCLVIGNNGQIAQSLSS-MCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           + ++ G NGQ+ + L   +  ++ +I    +  +D+              P +II+ AAY
Sbjct: 4   RIIITGANGQLGKQLQEELNPEEYDIYPFDKKLLDITNISKVQQVVQEIRPHIIIHCAAY 63

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VD+AE E ++A+ INA GA  +A A+  +G   +YISTDYVF G      DEF    P
Sbjct: 64  TKVDQAEKERDLAYRINAIGARNVAVASQLVGAKLVYISTDYVFQGDRPEGYDEFHNPAP 123

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           +NIYG SK AGE+ V    N Y I+RT+W+Y  +G+NF+ +M+RL KER E+SVV DQ G
Sbjct: 124 INIYGASKYAGEQFVKELHNKYFIVRTSWLYGKYGNNFVKTMMRLGKEREEVSVVADQIG 183

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           +PT    +   I ++ H       TSL G +H++ + G  SW +FA+ IF  +  +    
Sbjct: 184 SPTYVADLNVMINKLIH-------TSLYGTYHIS-NRGSCSWFEFAKKIFSYANMK---- 231

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
             V  + T+++   A RP YS    + L     +++ +W+EG+    +
Sbjct: 232 VDVLPVSTEEFGAAAARPKYSIFQHNMLRLNGFLQMPSWEEGLERFFI 279


>gi|298485663|ref|ZP_07003742.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298159689|gb|EFI00731.1| dTDP-4-dehydrorhamnose reductase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 301

 Score =  179 bits (453), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 163/299 (54%), Gaps = 14/299 (4%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDI---------DLLKPKDFASFFLSFSP 51
           MK L++G NGQ+   L        E++ + R  +         DL   +   +   S  P
Sbjct: 1   MKILLLGKNGQVGWELQRSLAVVGEVVALDRHTVSTAYGELCGDLSDLESLRNTIRSVKP 60

Query: 52  DVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTP 111
            VI+N AAYTAVDKAE E E+A  +NA  +  +A+ A ++    ++ STDYVFDG   T 
Sbjct: 61  QVIVNAAAYTAVDKAETERELAHRVNALASQVLAEEARTLDALLVHYSTDYVFDGSGNTA 120

Query: 112 IDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERRE 171
             E    +P+N YG +KL GE+ +A+    ++I RT+WVY+  G+NF  +MLRLAK+R  
Sbjct: 121 WKESDVVSPVNYYGATKLEGEQLIAASGCKHLIFRTSWVYAARGNNFAKTMLRLAKDRPT 180

Query: 172 ISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFW 231
           ++V+ DQ G PT A  +A   I  A  L   +   L GI+++ A  G VSW  +A+Y+  
Sbjct: 181 LNVIADQIGAPTGAELLAD--IATAALLQTLAKPELCGIYNL-APAGEVSWHAYAQYVID 237

Query: 232 ESAERGGPYS--KVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
            +   G P +   +  I T +YPT A RP  S L+  KL +  ++ +  W+ GV  +L+
Sbjct: 238 FARANGEPLAVETINPIGTIEYPTPAQRPLNSRLNTEKLRHNFSLHLPDWQSGVARMLM 296


>gi|332878816|ref|ZP_08446531.1| dTDP-4-dehydrorhamnose reductase [Capnocytophaga sp. oral taxon 329
           str. F0087]
 gi|332683167|gb|EGJ56049.1| dTDP-4-dehydrorhamnose reductase [Capnocytophaga sp. oral taxon 329
           str. F0087]
          Length = 279

 Score =  179 bits (453), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 153/286 (53%), Gaps = 9/286 (3%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           M  LV G NGQ+   + +   +           +D+ +  +  SF       +I+N AAY
Sbjct: 1   MHVLVTGANGQLGSEIKANADRKARYFFTDADVLDITQIDEIRSFVHQNHIGLIVNCAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           T VDKAED+  +A SIN      +A     + IP I+ISTDYVF G   TP  E   T P
Sbjct: 61  TNVDKAEDDTAVAESINHTAVAHLATVCAEVSIPLIHISTDYVFGGNGNTPYTEADNTCP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSI-FGSNFLLSMLRLAK