RPSBLAST alignment for GI: 254780921 and conserved domain: COG1087

>gnl|CDD|31284 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane]. Length = 329
 Score = 58.3 bits (141), Expect = 2e-09
 Identities = 35/117 (29%), Positives = 53/117 (45%), Gaps = 5/117 (4%)

Query: 35  DLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI- 93
           DLL      + F     D +++ AA  +V ++   P   +  N  G   + +A    G+ 
Sbjct: 52  DLLDRALLTAVFEENKIDAVVHFAASISVGESVQNPLKYYDNNVVGTLNLIEAMLQTGVK 111

Query: 94  PCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTN----NYVILR 146
             I+ ST  V+   + +PI E SP  P+N YG+SKL  EE +           VILR
Sbjct: 112 KFIFSSTAAVYGEPTTSPISETSPLAPINPYGRSKLMSEEILRDAAKANPFKVVILR 168