BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780921|ref|YP_003065334.1| dTDP-4-dehydrorhamnose
reductase [Candidatus Liberibacter asiaticus str. psy62]
         (290 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780921|ref|YP_003065334.1| dTDP-4-dehydrorhamnose reductase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 290

 Score =  600 bits (1548), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 290/290 (100%), Positives = 290/290 (100%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY
Sbjct: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP
Sbjct: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG
Sbjct: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY
Sbjct: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290
           SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI
Sbjct: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI 290


>gi|254780920|ref|YP_003065333.1| dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 358

 Score = 32.0 bits (71), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 51/122 (41%), Gaps = 12/122 (9%)

Query: 34  IDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI 93
           +D+   +   S    F PD I+N AA + VD++    +   + N  G   + +    +  
Sbjct: 57  VDICDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEET-RLWW 115

Query: 94  PCI-----------YISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNY 142
            C+            ISTD V+  L +    E  P NP + Y  +K + +  V ++ + Y
Sbjct: 116 SCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTY 175

Query: 143 VI 144
            I
Sbjct: 176 GI 177


>gi|254780569|ref|YP_003064982.1| phosphoribosylaminoimidazole synthetase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 357

 Score = 30.4 bits (67), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 51/140 (36%), Gaps = 19/140 (13%)

Query: 7   GNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKA 66
           G N  I   L +MCV D+            L       FFL +     +NP   T++ K 
Sbjct: 81  GKNDTIGIDLVAMCVNDI------------LTHGAEPLFFLDYLATSQLNPDQATSIIKG 128

Query: 67  EDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK 126
                IA      G   I    ++  +P +Y   DY   G +   ++     +P N+   
Sbjct: 129 -----IAAGCCQAGCALI--GGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAG 181

Query: 127 SKLAGEEKVASYTNNYVILR 146
             + G      ++N + ++R
Sbjct: 182 DLILGLPSSGLHSNGFALVR 201


>gi|255764513|ref|YP_003065530.2| glutamyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 492

 Score = 22.3 bits (46), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 16/26 (61%)

Query: 47  LSFSPDVIINPAAYTAVDKAEDEPEI 72
           + + P+ +IN  A   V K+ED+ E+
Sbjct: 270 MGYLPEALINFLALLFVHKSEDDDEL 295


>gi|254780474|ref|YP_003064887.1| ubiquinol oxidase, subunit II [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 332

 Score = 22.3 bits (46), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 11/40 (27%), Positives = 18/40 (45%)

Query: 219 PVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRP 258
           P+    F   I W++  R  PY+ + RI   +   K  +P
Sbjct: 102 PLVIVGFLAVITWDATHRMDPYAPLERISESKSIAKNSKP 141


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.320    0.136    0.406 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 185,433
Number of Sequences: 1233
Number of extensions: 7433
Number of successful extensions: 23
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 18
Number of HSP's gapped (non-prelim): 6
length of query: 290
length of database: 328,796
effective HSP length: 73
effective length of query: 217
effective length of database: 238,787
effective search space: 51816779
effective search space used: 51816779
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 38 (19.2 bits)