HHsearch alignment for GI: 254780922 and conserved domain: COG1210

>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].
Probab=100.00  E-value=0  Score=362.02  Aligned_cols=233  Identities=27%  Similarity=0.486  Sum_probs=196.1

Q ss_pred             CEEEEECCCCCCCCCHHHCCCCCCEEEECCEEHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCC-----------C
Q ss_conf             90799248887455334438982222478374799999999978986899997776564311122222-----------2
Q gi|254780922|r    1 MKGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVLKEFLGSG-----------E   69 (292)
Q Consensus         1 MkaiIlAaG~GtRl~P~T~~~pK~Llpi~gkplI~~~l~~l~~~Gi~~I~ii~~~~~~~~~~~~l~~g-----------~   69 (292)
T Consensus         5 rKAViPaAGlGTRfLPATKaiPKEMLPIvdKP~IqYiVeEa~~aGIe~i~iVTgr~K~~I-eDhFD~s~ELE~~L~~~~K   83 (291)
T COG1210           5 RKAVIPAAGLGTRFLPATKAIPKEMLPIVDKPLIQYIVEEAVAAGIEEILIVTGRGKRAI-EDHFDTSYELENTLEKRGK   83 (291)
T ss_pred             CEEEEECCCCCCCCCCCCCCCCHHHCCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHH-HHHCCCCHHHHHHHHHHCH
T ss_conf             179887467645546600357664436667221999999999869977999966983568-8867686999999987277


Q ss_pred             ----------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCC--CCCCHHHHHCCCHHHHHCCCCCC
Q ss_conf             ----------221111222333322446852101112335675213214432111--10000111000001110012222
Q gi|254780922|r   70 ----------KWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGS--DISDIFHKARARRNSATVVGCHV  137 (292)
Q Consensus        70 ----------~~g~~i~y~~q~~p~Gta~Ai~~a~~~i~~~~~~lilgDni~~~~--~l~~~l~~~~~~~~~~ti~~~~v  137 (292)
T Consensus        84 ~~~L~~v~~i~~~~~i~~vRQ~e~~GLGhAVl~A~~~vg~EpFaVlL~Ddl~~~~~~~l~qmi~~y~~~g~-svi~v~ev  162 (291)
T COG1210          84 RELLEEVRSIPPLVTISFVRQKEPLGLGHAVLCAKPFVGDEPFAVLLPDDLVDSEKPCLKQMIELYEETGG-SVIGVEEV  162 (291)
T ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCCEEEEECCEEECCCCHHHHHHHHHHHHHCC-CEEEEEEC
T ss_conf             99999997235775399986587676017888535432898569981772632780699999999998599-27999988


Q ss_pred             --CCCCCCCCCC----CCCC-CCHHHCCCCC--CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHCCCC
Q ss_conf             --1000122212----2221-0001001333--33222222024554100022432200467533333334320000013
Q gi|254780922|r  138 --QNPQRYGVVE----VDSS-NQAISIEEKP--NNPKSSFAVTGIYFYDQEVVNIARNIRPSARGELEITDVNSYYLDKG  208 (292)
Q Consensus       138 --~~p~~yGvv~----~d~~-~~i~~i~EKP--~~~~sn~a~~GiY~f~~~i~~~~~~l~~s~rgE~eitD~~~~~l~~~  208 (292)
T Consensus       163 ~~e~v~kYGvi~~g~~~~~~~~~v~~~VEKP~~~~APSnlai~GRYil~p~IF~~L~~~~~G~ggEiQLTDai~~L~~~~  242 (291)
T COG1210         163 PPEDVSKYGVIDPGEPVEKGVYKVKGMVEKPKPEEAPSNLAIVGRYVLTPEIFDILEETKPGAGGEIQLTDAIKKLLKKE  242 (291)
T ss_pred             CHHHCCCCCEEECCCCCCCCEEEEEEEEECCCCCCCCCCEEEEEEEECCHHHHHHHHHCCCCCCCEEEHHHHHHHHHHHC
T ss_conf             87877656267248503577289977776699999985415765465689999999627999998766799999998538


Q ss_pred             CEEEEECCCCEEEECCCCHHHHHHHHHHH
Q ss_conf             20463135412563278457799999999
Q gi|254780922|r  209 LLAVEFLREGSAWFDAGTPESLLDTAVFV  237 (292)
Q Consensus       209 ~~~~~~~~~g~~W~D~Gt~e~l~~As~~i  237 (292)
T Consensus       243 ~-v~a~~~~G-kryD~G~k~Gyi~a~v~~  269 (291)
T COG1210         243 P-VLAYVFEG-KRYDCGSKLGYIKANVEF  269 (291)
T ss_pred             C-EEEEEECC-CEECCCCCCCHHHHHHHH
T ss_conf             5-79999456-276168712489999999