HHsearch alignment for GI: 254780922 and conserved domain: cd04183

>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule. GT2_BcbE_like: The bcbE gene is one of the genes in the capsule biosynthetic locus of Pasteurella multocida. Its deducted product is likely involved in the biosynthesis of the polysaccharide capsule, which is found on surface of a wide range of bacteria. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
Probab=100.00  E-value=0  Score=311.84  Aligned_cols=222  Identities=22%  Similarity=0.321  Sum_probs=176.2

Q ss_pred             EEEECCCCCCCCCHHHCCCCCCEEEECCEEHHHHHHHHHHHCCCCEEEEEECCCCCCCC--CCCCCCCCCCCCCCCCCCC
Q ss_conf             79924888745533443898222247837479999999997898689999777656431--1122222222111122233
Q gi|254780922|r    3 GIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVL--KEFLGSGEKWGVQFSYIEQ   80 (292)
Q Consensus         3 aiIlAaG~GtRl~P~T~~~pK~Llpi~gkplI~~~l~~l~~~Gi~~I~ii~~~~~~~~~--~~~l~~g~~~g~~i~y~~q   80 (292)
T Consensus         1 iVIlaaG~GtRl~~~t~~~PK~Ll~v~gkp~i~~~i~~l~~~~~~~~i~v~~~~~~~~~~~~~~~~~~-~~~~~i-~~~~   78 (231)
T cd04183           1 IIIPMAGLGSRFKKAGYTYPKPLIEVDGKPMIEWVIESLAKIFDSRFIFICRDEHNTKFHLDESLKLL-APNATV-VELD   78 (231)
T ss_pred             CEEECCCCCCCCCCCCCCCCCEEEEECCEEHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHCCC-CCCCEE-EEEC
T ss_conf             98986788736475679988750179995789999999986499246861454666678887775155-897189-9956


Q ss_pred             CCCCCCCCCCCCCCCCCCCC-CCCEEECCCCCCCCCCCCHHHHHCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHCCC
Q ss_conf             33224468521011123356-75213214432111100001110000011100122221000122212222100010013
Q gi|254780922|r   81 LVPAGLAQSYILGAEFIGDS-SSVLILGDNVFYGSDISDIFHKARARRNSATVVGCHVQNPQRYGVVEVDSSNQAISIEE  159 (292)
Q Consensus        81 ~~p~Gta~Ai~~a~~~i~~~-~~~lilgDni~~~~~l~~~l~~~~~~~~~~ti~~~~v~~p~~yGvv~~d~~~~i~~i~E  159 (292)
T Consensus        79 ~~~~G~a~av~~a~~~i~~~~~~lv~~gD~-~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~-~~g~v~~~~~~~v~~i~E  156 (231)
T cd04183          79 GETLGAACTVLLAADLIDNDDPLLIFNCDQ-IVESDLLAFLAAFRERDLDGGVLTFFSSHP-RWSYVKLDENGRVIETAE  156 (231)
T ss_pred             CCCCCHHHHHHHHHHHCCCCCEEEEEECCC-CCCCCHHHHHHHHHHCCCCEEEEEEEECCC-CCCCEEECCCCCEEECCC
T ss_conf             999967999999998648998099970761-136388999999985699879999991257-776357847984765023


Q ss_pred             CCCCCCCCCCHHHHHHHHHH--HHHHHHHC---CCCCCCCCCCCCCCCHHCCCCCEEEEECCCCEEEECCCCHHHH
Q ss_conf             33332222220245541000--22432200---4675333333343200000132046313541256327845779
Q gi|254780922|r  160 KPNNPKSSFAVTGIYFYDQE--VVNIARNI---RPSARGELEITDVNSYYLDKGLLAVEFLREGSAWFDAGTPESL  230 (292)
Q Consensus       160 KP~~~~sn~a~~GiY~f~~~--i~~~~~~l---~~s~rgE~eitD~~~~~l~~~~~~~~~~~~g~~W~D~Gt~e~l  230 (292)
T Consensus       157 K~--~~s~~~~~GiY~F~~~~~f~~~~~~~~~~~~~~~gE~yltd~i~~li~~g~kv~~~~i~~~~~~d~GtPedl  230 (231)
T cd04183         157 KE--PISDLATAGLYYFKSGSLFVEAAKKMIRKDDSVNGEFYISPLYNELILDGKKVGIYLIDKDDYHSFGTPEDL  230 (231)
T ss_pred             CC--CCCHHHCCEEEEECCHHHHHHHHHHHHHCCCCCCCEEEHHHHHHHHHHCCCEEEEEEECCCEEEECCCHHHC
T ss_conf             58--875002014699746799999999986448655999985899999998889189999789969989696984