PSIBLAST alignment of GI: 254780922 and protein with PDB id: 1fxo

gi|12084194|pdb|1FXO|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tmp Complex. Length = 293
>gi|12084195|pdb|1FXO|B Chain B, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tmp Complex. Length = 293
 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 158/287 (55%), Positives = 210/287 (73%)

Query: 2   KGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVL 61
           KGI+LAGGSGTRL P T  +SKQ+LP+Y+KPMIYYP+STLM AGIREILIISTP+D P  
Sbjct: 4   KGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRF 63

Query: 62  KEFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSDISDIFH 121
           ++ LG G  WG+   Y  Q  P GLAQ++++G  FIG+  S L+LGDN++YG D  ++  
Sbjct: 64  QQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLG 123

Query: 122 KARARRNSATVVGCHVQNPQRYGVVEVDSSNQAISIEEKPNNPKSSFAVTGIYFYDQEVV 181
            A  R+  A+V   HV +P+RYGVVE D   +AIS+EEKP  PKS++AVTG+YFYDQ+VV
Sbjct: 124 SASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVV 183

Query: 182 NIARNIRPSARGELEITDVNSYYLDKGLLAVEFLREGSAWFDAGTPESLLDTAVFVRNIE 241
           +IAR+++PS RGELEITDVN  YL++G L+VE +  G AW D GT +SLL+   F+  +E
Sbjct: 184 DIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLE 243

Query: 242 NRLGLYVACPEEIAYRHDFINESQFFQLIDHFGNSPYGLYLRQVVEK 288
           NR GL VACPEEIAYR  +I+ +Q  +L      + YG YL++++ +
Sbjct: 244 NRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTE 290