RPSBLAST alignment for GI: 254780922 and conserved domain: TIGR01105

>gnl|CDD|130175 TIGR01105, galF, UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit. GalF is a non-catalytic subunit of the UTP-glucose pyrophosphorylase modulating the enzyme activity to increase the formation of UDP-glucose. Length = 297
 Score = 60.0 bits (145), Expect = 6e-10
 Identities = 57/237 (24%), Positives = 94/237 (39%), Gaps = 38/237 (16%)

Query: 1   MKGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPV 60
           +K ++   G G  + P T  + K+MLPI +KPMI Y V  ++ AGI+EI++++      V
Sbjct: 4   LKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASKNAV 63

Query: 61  LKEFLGSGE---------------------KWGVQFSYIEQLVPAGLAQSYILGAEFIGD 99
              F  S E                       GV    + Q  P GL  S +     +GD
Sbjct: 64  ENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPVVGD 123

Query: 100 SSSVLILGDNVFYGSDISDIFHKAR---ARRN----SATVVGCHVQNPQRYGVVE----V 148
           +  V++L D +   +    + +      AR N    S  +      +   Y V++    +
Sbjct: 124 NPFVVVLPDIIIDDATADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTKEPL 183

Query: 149 DSSNQAISIE---EKPNNPK---SSFAVTGIYFYDQEVVNIARNIRPSARGELEITD 199
           D   +   I    EKP+ P+   S     G Y    ++        P A G +++TD
Sbjct: 184 DREGKVSRIVEFIEKPDQPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQLTD 240