RPSBLAST alignment for GI: 254780922 and conserved domain: PRK14353

>gnl|CDD|184642 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional. Length = 446
 Score = 39.8 bits (94), Expect = 8e-04
 Identities = 40/168 (23%), Positives = 66/168 (39%), Gaps = 27/168 (16%)

Query: 4   IVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVLKE 63
           I+LA G GTR++     L K + P+  +PM+ + ++     G   + ++        +  
Sbjct: 9   IILAAGEGTRMK---SSLPKVLHPVAGRPMLAHVLAAAASLGPSRVAVV-VGPGAEAVAA 64

Query: 64  FLGSGEKWGVQFSYIEQL-----VPAGLAQSYILGAEFIGDSSSVLIL-GDNVFYGSDIS 117
                      F   E+L     V A  A+  +  A   GD   VL+L GD       I+
Sbjct: 65  AAAKIAPDAEIFVQKERLGTAHAVLA--AREAL--AGGYGD---VLVLYGDTPL----IT 113

Query: 118 -DIFHKARARR---NSATVVGCHVQNPQRYG-VVEVDSSNQAISIEEK 160
            +   + R R        V+G    +P  YG ++       AI +EEK
Sbjct: 114 AETLARLRERLADGADVVVLGFRAADPTGYGRLIVKGGRLVAI-VEEK 160