HHsearch results for GI: 254780923 and protein with PDBid: 1qg8_A

>1qg8_A Protein (spore coat polysaccharide biosynthesis protein SPSA); glycosyltransferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A*
Probab=95.21  E-value=0.16  Score=28.07  Aligned_cols=115  Identities=16%  Similarity=0.267  Sum_probs=68.4

Q ss_pred             CCEEEEEEEC-CHHHHHHHHHHHHHCCC-CCCEEEEECCCHHHHHHHHHHHCC--CCEEEEECCCC-----CHHHHHHHH
Q ss_conf             7559999943-67779999999981899-831899808631799999985258--83799945667-----317899975
Q gi|254780923|r  116 AKIAIVVHLY-YIDLWIEIANLLSNLSI-SFDLHVTLVTESASIKSEILKIFP--AARIHIMENHG-----RDVLPFLIL  186 (365)
Q Consensus       116 ~KIAV~lHly-Y~DLl~Ei~~~L~~ip~-~~DL~ITt~~~~~~~~~~i~~~~~--~~~I~vv~NRG-----RDI~PfLv~  186 (365)
                      |||.|++=.| -++.+.++++-+.+-.. .++++|.-..........+.+..+  ++++...+|.|     +..+.- ..
T Consensus         1 P~vSIiip~yN~~~~l~~~l~Si~~qt~~~~eiiivdd~S~d~t~~~~~~~~~~~~i~~~~~~~~~~~~~~~n~g~~-~a   79 (255)
T 1qg8_A            1 PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYA-AL   79 (255)
T ss_dssp             CCEEEEEEESSCTTTHHHHHHHHHTCSCCCEEEEEEECSCCHHHHHHHGGGGGSTTEEEEECCCCSHHHHHSSCHHH-HH
T ss_pred             CEEEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHCCCCCHHHCCCCCCCCCCCCCCHH-HH
T ss_conf             97999995389889999999999828899859999989797318999999732011110002344320011335599-99


Q ss_pred             HCH-HHHCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             064-4526868899965686767777733447899999987559999999999998628964898156
Q gi|254780923|r  187 LET-EQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSR  253 (365)
Q Consensus       187 ~~~-~~l~~YD~v~kiHTKKS~~~~~h~~~G~~WR~~Ll~~LLGs~~~V~~Il~~F~~np~lGlv~P~  253 (365)
                      .+. ....+.|+|+.+++=                     .++ +++.++.+++.|+++|++++|++.
T Consensus        80 ~N~gi~~a~g~~i~~lD~D---------------------d~~-~p~~l~~~~~~~~~~~~~~~v~~~  125 (255)
T 1qg8_A           80 INQAIEMAEGEYITYATDD---------------------NIY-MPDRLLKMVRELDTHPEKAVIYSA  125 (255)
T ss_dssp             HHHHHHHCCCSEEEEEETT---------------------EEE-CTTHHHHHHHHHHHCTTCCEEEEE
T ss_pred             HHHHHHCCCCCEEEEECCC---------------------CCC-CCCHHHHHHHHHHHCCCEEEEEEE
T ss_conf             9855431587546773266---------------------431-123799999999868981699933