BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780923|ref|YP_003065336.1| hypothetical protein
CLIBASIA_04110 [Candidatus Liberibacter asiaticus str. psy62]
         (365 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780923|ref|YP_003065336.1| hypothetical protein CLIBASIA_04110 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040600|gb|ACT57396.1| hypothetical protein CLIBASIA_04110 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 365

 Score =  465 bits (1196), Expect = e-129,   Method: Composition-based stats.
 Identities = 365/365 (100%), Positives = 365/365 (100%)

Query: 1   MPVSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYV 60
           MPVSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYV
Sbjct: 1   MPVSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYV 60

Query: 61  VAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAI 120
           VAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAI
Sbjct: 61  VAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAI 120

Query: 121 VVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDV 180
           VVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDV
Sbjct: 121 VVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDV 180

Query: 181 LPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRT 240
           LPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRT
Sbjct: 181 LPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRT 240

Query: 241 FDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFW 300
           FDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFW
Sbjct: 241 FDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFW 300

Query: 301 VRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRK 360
           VRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRK
Sbjct: 301 VRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRK 360

Query: 361 SLSQN 365
           SLSQN
Sbjct: 361 SLSQN 365


>gi|254780201|ref|YP_003064614.1| hypothetical protein CLIBASIA_00430 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039878|gb|ACT56674.1| hypothetical protein CLIBASIA_00430 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 394

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 144/356 (40%), Positives = 210/356 (58%), Gaps = 4/356 (1%)

Query: 9   GYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWT-LFYKRSKKLCYDENYVVAYGSRS 67
           GY++  S        S   + ++++++  F FW  + L + +  KL +    +  YGSR 
Sbjct: 40  GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99

Query: 68  GKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGW-ESPAMGKVMQIAIKAKIAIVVHLYY 126
            +K F + N +M    + FD ++  +  +L  GW + P+  K   + IK+KIAIVVH YY
Sbjct: 100 EQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYY 159

Query: 127 IDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLIL 186
            D WIEI+++L  L+  FDL VT+V  +   + ++LK FP+A++++MEN GRDV PFL L
Sbjct: 160 QDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYL 219

Query: 187 LETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRD 246
           LE      YDY+CKIHGKKS+R+GY   EG +WRRWLF+DLLG   +  +II TF+ +  
Sbjct: 220 LELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPC 279

Query: 247 IGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEAL 306
           +GMIGSR YR   ++  +       R +I  LA R G   +   LDFF GTMFWV+ + L
Sbjct: 280 LGMIGSRRYRRYKRWSFFAKRSEVYRRVI-DLAKRAGFPTKRLHLDFFNGTMFWVKPKCL 338

Query: 307 DPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRKSL 362
           +P++NL L      +     DG +EHAVER F+ SV+   F I  VDC+  Y + L
Sbjct: 339 EPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLL 393


>gi|315122651|ref|YP_004063140.1| hypothetical protein CKC_04515 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496053|gb|ADR52652.1| hypothetical protein CKC_04515 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 405

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 222/366 (60%), Positives = 282/366 (77%), Gaps = 7/366 (1%)

Query: 1   MPVSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLF-YKRSKKLCYDENY 59
           +PVSGC KGY LF S  ++WNF S+H  I KV+ + GFFFW  +LF +KR + L YDEN 
Sbjct: 38  LPVSGCRKGYLLFVSRRENWNFDSNHLVIRKVSFFLGFFFWIRSLFLFKRYQTLRYDENR 97

Query: 60  VVAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIA 119
           ++AYGSR GKKFFA SN  M+ R + FDG++IH FP+LLHGW+SP+  K+  + I++++A
Sbjct: 98  IIAYGSRIGKKFFACSNKDMLARGVPFDGEKIHRFPRLLHGWDSPSSEKIASVKIQSRVA 157

Query: 120 IVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRD 179
           IVVH+YY DLW EIANLLS L+ SFDLH+TLVTE ASIKSEILK FP A I++MEN+GRD
Sbjct: 158 IVVHIYYADLWAEIANLLSGLNFSFDLHITLVTEIASIKSEILKRFPNAHIYVMENYGRD 217

Query: 180 VLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIR 239
           +  FL LLE  +L +YDYVCKIHGKKSKR G+ WW+GDLWRRWLF+DLLGAPG+  +II+
Sbjct: 218 IRSFLKLLEGGKLDSYDYVCKIHGKKSKRNGHVWWDGDLWRRWLFFDLLGAPGIALEIIK 277

Query: 240 TFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMF 299
           TF+ +  IGMIGSR YRY  K      SLG NRE +C +A +MG++F+D K+DFF GTMF
Sbjct: 278 TFEKYPKIGMIGSRTYRYDQKI-----SLGNNREFVCAIANKMGVSFEDTKIDFFGGTMF 332

Query: 300 WVRTEALDPIKNLRLSRYFEPKVHKA-LDGEIEHAVERCFSLSVKKANFRISDVDCILGY 358
           WVR +ALDPIKNL L++YF+ KV    LDG +EHA+ERCFS+SV+KANF ++ VDC+   
Sbjct: 333 WVRPQALDPIKNLALTQYFKSKVDMVGLDGCLEHAIERCFSISVEKANFDLAYVDCLSEE 392

Query: 359 RKSLSQ 364
             + S 
Sbjct: 393 SDNKSS 398


>gi|315122628|ref|YP_004063117.1| hypothetical protein CKC_04400 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496030|gb|ADR52629.1| hypothetical protein CKC_04400 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 399

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 143/352 (40%), Positives = 207/352 (58%), Gaps = 4/352 (1%)

Query: 9   GYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWT-LFYKRSKKLCYDENYVVAYGSRS 67
           GY++  S  K     S+    E+V  +    FW  + L + +  +L +    +  YGSR 
Sbjct: 45  GYYMLWSLSKEQKITSEDVFFEEVTTFKACLFWLRSFLTFSKYSQLSFPSCRIFFYGSRK 104

Query: 68  GKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGW-ESPAMGKVMQIAIKAKIAIVVHLYY 126
            KK F + N +M    + FDG++  +  +L  GW    ++    +I I +KIAIVVH YY
Sbjct: 105 DKKAFFRLNRFMSNSRMPFDGKKFLYIKELFEGWKNLSSLDNKGKIKINSKIAIVVHCYY 164

Query: 127 IDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLIL 186
            D W EI++LL  L+  FDL +T V ++   + ++LK FP+AR+++MEN GRDVLPFL L
Sbjct: 165 QDTWDEISHLLLRLNFDFDLFITTVKKNKDFEQDVLKNFPSARLYVMENKGRDVLPFLCL 224

Query: 187 LETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRD 246
           LE     +YDY+CKIHGKKS R+ Y  +EG LWRRW+F+DLLG   +  +II  F+ +  
Sbjct: 225 LELGVFYDYDYLCKIHGKKSARRNYHPFEGILWRRWIFFDLLGFSDIALRIINKFEQNPS 284

Query: 247 IGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEAL 306
           IGMIGS  +R   KY  +     K  + +  LA R+    ++  LDFF GTMFWVR + L
Sbjct: 285 IGMIGSGRFRRYKKYSFFKKR-SKVYKRVVDLARRIDFPVEELDLDFFNGTMFWVRPKCL 343

Query: 307 DPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGY 358
           +P++N+ L+     +     DG +EHAVER F LSV++A F +  VDC+  Y
Sbjct: 344 EPLRNIHLTGE-FEEECNLEDGALEHAVERFFPLSVQRAGFSLESVDCVAEY 394


>gi|291516581|emb|CBK70197.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium longum
           subsp. longum F8]
          Length = 688

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 75/392 (19%), Positives = 136/392 (34%), Gaps = 50/392 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLC-YDENYVV 61
           S  +  +      W  Y++     ++     F    F W   + +++ +    Y   Y+ 
Sbjct: 179 SPAFHEYWETMPLWKDYAEVTRKHEMTFTKHFTDLGFTWASYIDWRKYQGYSSYPLLYMP 238

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WES------ 103
               R  +    +   + ++   +FD   GQ      + L           W++      
Sbjct: 239 MQIVRDDRCPIFKRRSFFVDYSAYFDQTAGQPALDLYEYLRDHTDYDVDMIWDAILPSYN 298

Query: 104 --------------PAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
                         P+     Q   + + A + H+Y++DL  +  + +++L    DL++T
Sbjct: 299 IDDIRKAMHLDYVLPSQAINPQTHDRPRSAFIYHVYFMDLLEDTCHYIASLPEETDLYIT 358

Query: 150 LVTESASIKSEILKIF---PAARIHIMENHGRDVLPFLILLETEQLS-NYDYVCKIHGKK 205
              +      E ++       A    + N GRDV   L+      LS  YD +   H KK
Sbjct: 359 STEDKIPQIREYMQQHGISHQATFIPVINRGRDVSALLVAACPVVLSGKYDVIGFAHDKK 418

Query: 206 SKR---KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKY- 261
           S +    G+   E   +   L  + LG+   V  I+  F  +  +G +      +   + 
Sbjct: 419 SSQNQENGHHGTESQGFAYKLMENTLGSEAYVKNILTLFAENPRLGQVTPPPPYHALYFA 478

Query: 262 CDYTCSLGKNREMICTLAG-RMGI--TFQDQKLDFFA-GTMFWVRTEALDPIKNLRLSRY 317
                  G N E+   L   R+GI       K    A G+ +W R EAL P+        
Sbjct: 479 HTIPHDWGANYEITKELLEDRLGIHVPLSPTKPTASAMGSCYWFRVEALKPLFEYGWKYE 538

Query: 318 FE-PKVHKALDGEIEHAVERCFSLSVKKANFR 348
              P+     DG I HA+ER      +   + 
Sbjct: 539 DFLPEGQMGEDGTISHAIERANGYICQSRGYY 570


>gi|322690050|ref|YP_004209784.1| hypothetical protein BLIF_1872 [Bifidobacterium longum subsp.
           infantis 157F]
 gi|320461386|dbj|BAJ72006.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 672

 Score =  355 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 75/392 (19%), Positives = 136/392 (34%), Gaps = 50/392 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLC-YDENYVV 61
           S  +  +      W  Y++     ++     F    F W   + +++ +    Y   Y+ 
Sbjct: 157 SPAFHEYWETMPLWKDYAEVTRKHEMTFTKHFTDLGFTWASYIDWRKYQGYSSYPLLYMP 216

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WES------ 103
               R  +    +   + ++   +FD   GQ      + L           W++      
Sbjct: 217 MQIVRDDRCPIFKRRSFFVDYSAYFDQTAGQPALDLYEYLRDHTDYDVDMIWDAILPSYN 276

Query: 104 --------------PAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
                         P+     Q   + + A + H+Y++DL  +  + +++L    DL++T
Sbjct: 277 IDDIRKAMHLDYVLPSQAINPQTHDRPRSAFIYHVYFMDLLEDTCHYIASLPEETDLYIT 336

Query: 150 LVTESASIKSEILKIF---PAARIHIMENHGRDVLPFLILLETEQLS-NYDYVCKIHGKK 205
              +      E ++       A    + N GRDV   L+      LS  YD +   H KK
Sbjct: 337 STEDKIPQIREYMQQHGISHQATFIPVINRGRDVSALLVAACPVVLSGKYDVIGFAHDKK 396

Query: 206 SKR---KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKY- 261
           S +    G+   E   +   L  + LG+   V  I+  F  +  +G +      +   + 
Sbjct: 397 SSQNQENGHHGTESQGFAYKLMENTLGSEAYVKNILTLFAENPRLGQVTPPPPYHALYFA 456

Query: 262 CDYTCSLGKNREMICTLAG-RMGI--TFQDQKLDFFA-GTMFWVRTEALDPIKNLRLSRY 317
                  G N E+   L   R+GI       K    A G+ +W R EAL P+        
Sbjct: 457 HTIPHDWGANYEITKELLEDRLGIHVPLSPTKPTASAMGSCYWFRVEALKPLFEYGWKYE 516

Query: 318 FE-PKVHKALDGEIEHAVERCFSLSVKKANFR 348
              P+     DG I HA+ER      +   + 
Sbjct: 517 DFLPEGQMGEDGTISHAIERANGYICQSRGYY 548


>gi|189440434|ref|YP_001955515.1| lipopolysaccharide biosynthesis protein [Bifidobacterium longum
           DJO10A]
 gi|317482688|ref|ZP_07941702.1| rhamnan synthesis protein F [Bifidobacterium sp. 12_1_47BFAA]
 gi|189428869|gb|ACD99017.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium longum
           DJO10A]
 gi|316915934|gb|EFV37342.1| rhamnan synthesis protein F [Bifidobacterium sp. 12_1_47BFAA]
          Length = 666

 Score =  355 bits (911), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 75/392 (19%), Positives = 136/392 (34%), Gaps = 50/392 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLC-YDENYVV 61
           S  +  +      W  Y++     ++     F    F W   + +++ +    Y   Y+ 
Sbjct: 157 SPAFHEYWETMPLWKDYAEVTRKHEMTFTKHFTDLGFTWASYIDWRKYQGYSSYPLLYMP 216

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WES------ 103
               R  +    +   + ++   +FD   GQ      + L           W++      
Sbjct: 217 MQIVRDDRCPIFKRRSFFVDYSAYFDQTAGQPALDLYEYLRDHTDYDVDMIWDAILPSYN 276

Query: 104 --------------PAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
                         P+     Q   + + A + H+Y++DL  +  + +++L    DL++T
Sbjct: 277 IDDIRKAMHLDYVLPSQAINPQTHDRPRSAFIYHVYFMDLLEDTCHYIASLPEETDLYIT 336

Query: 150 LVTESASIKSEILKIF---PAARIHIMENHGRDVLPFLILLETEQLS-NYDYVCKIHGKK 205
              +      E ++       A    + N GRDV   L+      LS  YD +   H KK
Sbjct: 337 STEDKIPQIREYMQQHGISHQATFIPVINRGRDVSALLVAACPVVLSGKYDVIGFAHDKK 396

Query: 206 SKR---KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKY- 261
           S +    G+   E   +   L  + LG+   V  I+  F  +  +G +      +   + 
Sbjct: 397 SSQNQENGHHGTESQGFAYKLMENTLGSEAYVKNILTLFAENPRLGQVTPPPPYHALYFA 456

Query: 262 CDYTCSLGKNREMICTLAG-RMGI--TFQDQKLDFFA-GTMFWVRTEALDPIKNLRLSRY 317
                  G N E+   L   R+GI       K    A G+ +W R EAL P+        
Sbjct: 457 HTIPHDWGANYEITKELLEDRLGIHVPLSPTKPTASAMGSCYWFRVEALKPLFEYGWKYE 516

Query: 318 FE-PKVHKALDGEIEHAVERCFSLSVKKANFR 348
              P+     DG I HA+ER      +   + 
Sbjct: 517 DFLPEGQMGEDGTISHAIERANGYICQSRGYY 548


>gi|310286583|ref|YP_003937841.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           S17]
 gi|309250519|gb|ADO52267.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           S17]
          Length = 662

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 70/397 (17%), Positives = 131/397 (32%), Gaps = 50/397 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLC-YDENYVV 61
           S+ +  +  +   W  Y++     ++     F    F W   + +++ K    Y   Y+ 
Sbjct: 158 SQAFHEYWENMPLWKDYAEVTRKHEMTFTKHFAQLGFKWASYIDWRKYKGYSSYPLLYMP 217

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WES------ 103
               R  +    +   + ++   +FD   GQ        L           W++      
Sbjct: 218 MQMLRDDRCPVFKRRSFFVDYSAYFDQTAGQPALDLYDFLKNETDYDVDLIWDAILPNYN 277

Query: 104 --------------PAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
                         P + +  +     + A + H+Y++DL  +    +S L    DL++T
Sbjct: 278 IDDIRKALHLDYVLPTVTRNPRTGADVRSAFIYHIYFLDLLGDTCRYISALPEETDLYIT 337

Query: 150 LVTESASIKSEILKIF---PAARIHIMENHGRDVLPFLILLETEQLS-NYDYVCKIHGKK 205
              +      + +             + N GRDV   L+      LS  YD +   H KK
Sbjct: 338 TTEDKIDAIRDYMASHGVNHPVTFISVVNRGRDVSALLVAACDVVLSGKYDVIGFAHDKK 397

Query: 206 SKR---KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYC 262
           S +    G+   E   +   L  + L +   V  I+  F     +G +      +   + 
Sbjct: 398 SSQNQENGHHGTESQGFAYKLMENTLASRDYVENILTLFSNEPRLGQVAPPPPFHALYFA 457

Query: 263 DYTCS-LGKNREMICTLAG---RMGITFQDQKLDFFA-GTMFWVRTEALDPIKNLRLSRY 317
                  G N E+   L      + +     K    A G+ +W R EAL P+        
Sbjct: 458 HTLPHDWGANFEITKELLEDRFDIHVPLSPGKPSASAIGSCYWFRVEALKPLFEYGWKYE 517

Query: 318 FE-PKVHKALDGEIEHAVERCFSLSVKKANFRISDVD 353
              P+     DG + HA+ER      +   +  + V 
Sbjct: 518 DFLPEGEMGEDGTVSHAIERANGYICQSQGYYPAWVM 554


>gi|224284010|ref|ZP_03647332.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           NCIMB 41171]
 gi|313141164|ref|ZP_07803357.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
 gi|313133674|gb|EFR51291.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
          Length = 662

 Score =  349 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 70/397 (17%), Positives = 131/397 (32%), Gaps = 50/397 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLC-YDENYVV 61
           S+ +  +  +   W  Y++     ++     F    F W   + +++ K    Y   Y+ 
Sbjct: 158 SQAFHEYWENMPLWKDYAEVTRKHEMTFTKHFAQLGFKWASYIDWRKYKGYSSYPLLYMP 217

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WES------ 103
               R  +    +   + ++   +FD   GQ        L           W++      
Sbjct: 218 MQMLRDDRCPVFKRRSFFVDYSAYFDQTAGQPALDLYDFLKDETDYDVDLIWDAILPNYN 277

Query: 104 --------------PAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
                         P + +  +     + A + H+Y++DL  +    +S L    DL++T
Sbjct: 278 IDDIRKALHLDYVLPTVTRNPRTGADVRSAFIYHIYFLDLLGDTCRYISALPEETDLYIT 337

Query: 150 LVTESASIKSEILKIF---PAARIHIMENHGRDVLPFLILLETEQLS-NYDYVCKIHGKK 205
              +      + +             + N GRDV   L+      LS  YD +   H KK
Sbjct: 338 TTEDKIDAIRDYMASHGVNHPVTFISVVNRGRDVSALLVAACDVVLSGKYDVIGFAHDKK 397

Query: 206 SKR---KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYC 262
           S +    G+   E   +   L  + L +   V  I+  F     +G +      +   + 
Sbjct: 398 SSQNQENGHHGTESQGFAYKLMENTLASRDYVENILTLFSNEPRLGQVAPPPPFHALYFA 457

Query: 263 DYTCS-LGKNREMICTLAG---RMGITFQDQKLDFFA-GTMFWVRTEALDPIKNLRLSRY 317
                  G N E+   L      + +     K    A G+ +W R EAL P+        
Sbjct: 458 HTLPHDWGANFEITKELLEDRFDIHVPLSPGKPSASAIGSCYWFRVEALKPLFEYGWKYE 517

Query: 318 FE-PKVHKALDGEIEHAVERCFSLSVKKANFRISDVD 353
              P+     DG + HA+ER      +   +  + V 
Sbjct: 518 DFLPEGEMGEDGTVSHAIERANGYICQSQGYYPAWVM 554


>gi|227546966|ref|ZP_03977015.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|227212567|gb|EEI80455.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis ATCC 55813]
          Length = 631

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 70/384 (18%), Positives = 128/384 (33%), Gaps = 44/384 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCY-DENYVV 61
           S+ +  +  +    N Y D   + +      F    F W   +     +   Y    Y  
Sbjct: 164 SQAFRDYWDNIPPINDYYDSVGLHESLFTKRFADKGFKWDVYVDTSDLEGFTYGPITYAA 223

Query: 62  AYGSRSGKKFFAQSNLYMMERE---LHFDGQRIHHFPQLLHG---------WESPAMGKV 109
                  +    +   +            G       + L           W++      
Sbjct: 224 KRLVAEKRCPIFKRRSFFHGYRDVMTQAVGNAALDLYEYLRDHTDYDVDLIWQNALRTMN 283

Query: 110 M-------------------QIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTL 150
           +                    +    KIA+ +H+YY+DL     + + ++    D+ +T+
Sbjct: 284 VADLMKNLHLDYVLPQSLSVPLPEGKKIALAIHVYYMDLLESTFHYIQSMPEGCDIIITV 343

Query: 151 -VTESASIKSEILKIFP-AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
               +A    E  K FP    + ++EN GRDV   L+    +    YDYVC  H KK  +
Sbjct: 344 GSEANAETVREYCKQFPYNFDVRVIENRGRDVSALLVGCGEDLFQ-YDYVCFAHDKKVTQ 402

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
                  GD +    F ++L +   V  +I  F+ +  +G+       + + +  YT   
Sbjct: 403 LSPQSI-GDGFAYKCFENILASKEYVSNVIDLFERNPRLGIAMPTPPNHASYFPGYTFPW 461

Query: 269 GKNREMICTLAGR---MGITFQ-DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHK 324
           G N         +   M +    D++     GTMFW R EA   + +        P    
Sbjct: 462 GPNFPGTKDFLEQTLNMHVPLNADKEPVAPMGTMFWFRPEAFRGLLDHGWEYTDFPPEPN 521

Query: 325 ALDGEIEHAVERCFSLSVKKANFR 348
            +DG + H +ER +    +   + 
Sbjct: 522 KVDGTLLHFIERAYGYVPQANGYY 545


>gi|331086190|ref|ZP_08335272.1| hypothetical protein HMPREF0987_01575 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406349|gb|EGG85863.1| hypothetical protein HMPREF0987_01575 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 592

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 72/389 (18%), Positives = 138/389 (35%), Gaps = 49/389 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLC-YDENYVV 61
           SK +  +  +      Y+      +      F    + W  ++  +  +    Y      
Sbjct: 106 SKDFQEYWENMSMIEDYAQAVGKHESIFTKVFADKGYKWDVSVDCEDLRNYSGYPLMMCP 165

Query: 62  AYGSRSGKKFFAQSNLYM---MERELHFDGQRIHHFPQLLHG---------WES------ 103
                  +    +   +     +   +  G++     + L           WE+      
Sbjct: 166 RKVLEEKRCPVFKKRSFFHMESDYLRNTTGEQTTELYEFLKEKTNYDVDFIWETILRNCH 225

Query: 104 --------------PAMGKVMQIAIKA----KIAIVVHLYYIDLWIEIANLLSNLSISFD 145
                         P      ++  K     KIA+V+HLY+ DL  E  + +S +    D
Sbjct: 226 QYDIVKNMNLTYVLPTNQYNEELLQKQTTENKIALVMHLYFEDLLEESYHYVSAMPEKAD 285

Query: 146 LHVTLVTESASI-KSEILKIFP--AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIH 202
           +++T  TE       ++    P     + +++N GRDV   L+ ++   +  YD VC  H
Sbjct: 286 IYLTTDTEKKKAAIEKVFAKLPCNKLEVRVIKNRGRDVSSLLVGVKDVIMD-YDLVCFAH 344

Query: 203 GKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYC 262
            KK+ +       G  +    F + L     V  +I TF  +  +G++      +   + 
Sbjct: 345 DKKTAQVKP-GTIGASFAYKCFENTLSNKAYVGNVINTFVNNPRMGLLCPPEPNHSTFFT 403

Query: 263 DYTCSLGKNREMICTLAGRMGITFQ---DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFE 319
                 G N  +   LA ++G+T             GTMFW R +A+ P+ N        
Sbjct: 404 TIGFEWGPNFNITRDLAKKLGLTVPISVASPPVAPLGTMFWFRPKAMKPLYNKDWKYEDF 463

Query: 320 PKVHKALDGEIEHAVERCFSLSVKKANFR 348
           P     +DG + HA+ER +   V+++ + 
Sbjct: 464 PAEPNKIDGTLLHAIERIYPFIVQESGYY 492


>gi|311063512|ref|YP_003970237.1| lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           PRL2010]
 gi|310865831|gb|ADP35200.1| lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           PRL2010]
          Length = 631

 Score =  299 bits (765), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 70/384 (18%), Positives = 126/384 (32%), Gaps = 44/384 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCY-DENYVV 61
           S+ +  +       N Y D   + +      F    F W   +     +   Y    Y  
Sbjct: 164 SQAFRDYWDSIPPINDYYDSVGLHESLFTKRFADKGFKWDVYVDTSDLEGFTYGPITYAA 223

Query: 62  AYGSRSGKKFFAQSNLYMMERE---LHFDGQRIHHFPQLLHG---------WESP----- 104
                  +    +   +            G       + L           W++      
Sbjct: 224 KRLVAEKRCPIFKRRSFFHGYRDVMTQSVGNAALDLYEYLRDHTDYDVDLIWQNALRTMN 283

Query: 105 --------------AMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTL 150
                         +    + +    KIA+ +H+YY+DL       + ++    D+ +T+
Sbjct: 284 VADLMKNLHLDYVLSQSLSVPLPEGKKIALAIHVYYMDLLESTFRYIQSMPEGCDIIITV 343

Query: 151 -VTESASIKSEILKIFP-AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
               +A I  E  K FP    + ++EN GRDV   L+    +    YDYVC  H KK  +
Sbjct: 344 GSEANAEIVREYCKQFPYRFDVRVIENRGRDVSSLLVGCGEDLFQ-YDYVCFAHDKKVTQ 402

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
                  GD +    + ++L +   V  +I  F+ +  +G+       + + +  YT   
Sbjct: 403 LSPQSI-GDGFAYKCYENILASKEYVSNVIDLFEKNPRLGIAMPTPPNHASYFPGYTFPW 461

Query: 269 GKNREMICTLAGR---MGITFQDQK-LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHK 324
           G N         +   M +     K      GTMFW R EA   + +        P    
Sbjct: 462 GPNFPGTKDFLEQTLNMHVPLNANKEPVAPMGTMFWFRPEAFRGLLDHGWKYEDFPPEPN 521

Query: 325 ALDGEIEHAVERCFSLSVKKANFR 348
            +DG + H +ER +    +   + 
Sbjct: 522 KVDGTLLHFIERAYGYVPQANGYY 545


>gi|329944276|ref|ZP_08292535.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 170 str.
           F0386]
 gi|328531006|gb|EGF57862.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 170 str.
           F0386]
          Length = 636

 Score =  298 bits (764), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 76/383 (19%), Positives = 133/383 (34%), Gaps = 45/383 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCY-DENYVV 61
           SK +  +       N Y     + +V     F    F     +  +  +   +    +  
Sbjct: 163 SKAFQDYWDEMPEINGYEQSVGLHEVPFTQRFERLGFTSDVYVNTEDMEGYTFCPILFAP 222

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WES------ 103
               R  +    +   +    +   +   G+        L           W++      
Sbjct: 223 VEVIRDKRCPIFKRRSFFRPYDDVLNQSVGESSIELYAYLRDHTDFDTNLIWDNALRSMN 282

Query: 104 --------------PAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
                         P    V +   K KIA++ HLYY+DL       + N+    D+ ++
Sbjct: 283 MADLVKNLQLTYVLPTQAVVRE-PKKQKIALIAHLYYMDLVEPTLKYIRNMPEGIDIFLS 341

Query: 150 LVT-ESASIKSEILKIFP-AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSK 207
             + E         K  P    + ++EN GRDV PFL+  +     +YD VC  H KK  
Sbjct: 342 TSSPEKVEQVEAACKGLPYNIEVRLVENRGRDVGPFLVAWKDVV-HDYDVVCYTHDKKVT 400

Query: 208 RKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCS 267
           +  Y +  GD +    F +LL     V  +I TFD    +G +      + + +  +T  
Sbjct: 401 QL-YPYSVGDGFAYKCFENLLPTRDFVKNVIATFDAEPRLGFLAPTPPNHADYFPVFTYG 459

Query: 268 LGKNREMICTLAGRMGITFQDQK---LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHK 324
            G N +    L   +G+              G+MFW R +AL P+ +        P    
Sbjct: 460 WGPNFDRTKALLRELGLDVPLDPTKEPIAPLGSMFWFRPQALKPLFDHDWQWEEFPPEPC 519

Query: 325 ALDGEIEHAVERCFSLSVKKANF 347
            +DG + HA+ER      + + +
Sbjct: 520 PIDGTLMHAIERSHGYVAQGSGY 542


>gi|308235695|ref|ZP_07666432.1| hypothetical protein GvagA14_05663 [Gardnerella vaginalis ATCC
           14018]
 gi|311114292|ref|YP_003985513.1| rhamnan synthesis protein F [Gardnerella vaginalis ATCC 14019]
 gi|310945786|gb|ADP38490.1| rhamnan synthesis protein F [Gardnerella vaginalis ATCC 14019]
          Length = 637

 Score =  298 bits (764), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 76/392 (19%), Positives = 146/392 (37%), Gaps = 52/392 (13%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCY-DENYVV 61
           SK +  + ++    N Y +   + +      F    + W   +     +   Y    Y  
Sbjct: 161 SKDFQDYWNNLPPINSYFESVGLHESVFTKRFADKGYKWSVYVDTSDLEGYSYGPITYAA 220

Query: 62  AYGSRSGKKFFAQSNLYMMERE---LHFDGQRIHHFPQLLHG---------WESP----- 104
                  +    +   +  +         G +     + L           WE+      
Sbjct: 221 RQIVEYKRCPIFKRRSFFHDYSDVSTQSVGNQALDLYEYLKDHTDYNTDLIWENALRSMN 280

Query: 105 ----------------------AMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSI 142
                                 +     +   K K+A+ +HLYY+DL  +  + + ++  
Sbjct: 281 MADLMKNLHLRYILPQNHVVENSSTATSESTAKPKVALCMHLYYMDLLDKSLHYIQSMPQ 340

Query: 143 SFDLHVTL-VTESASIKSEILKIFP-AARIHIMENHGRDVLPFLILLETEQLSNYDYVCK 200
             D+ +T+   E+  I  + ++  P    + ++EN GRDV  FL+    + +  YDYVC 
Sbjct: 341 GCDVILTVGSKENQQIVKQRVEHLPYDVDVRLIENRGRDVSAFLVGGGADLM-KYDYVCF 399

Query: 201 IHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK 260
            H KK  +       GD +    F ++L +   V  +I  F+TH  +GM       + + 
Sbjct: 400 AHDKKVTQLSPRSI-GDGFAYKCFENILASKEYVQNVINLFETHPRLGMAMPTPPNHADY 458

Query: 261 YCDYTCSLGKNREMICTLAGR-MGITFQ-DQKLDFFA--GTMFWVRTEALDPIKNLRLSR 316
           +  +T + G N E       + +GI+   D+  D  A  GTMFW RT+A+  + + + + 
Sbjct: 459 FPGFTYTWGPNFEGTKKFLEKTLGISVPLDENKDAIAPLGTMFWFRTKAMRGLLDRKWTY 518

Query: 317 YFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
              P     +DG + H +ER +    +   + 
Sbjct: 519 EDFPAEPLKIDGTLLHFIERAYGYVPQYNGYY 550


>gi|320531350|ref|ZP_08032322.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 171 str.
           F0337]
 gi|320136441|gb|EFW28417.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 171 str.
           F0337]
          Length = 626

 Score =  296 bits (757), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 72/384 (18%), Positives = 135/384 (35%), Gaps = 46/384 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCY-DENYVV 61
           SK +  +  +    N Y +   + +      F    F     +  +  +        +  
Sbjct: 163 SKAFQDYWDNLPQINSYEESVGLHEAPFTQRFERLGFVSDVYVNTEDLEGFTLQPILFTP 222

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WES------ 103
                  +    +   +    E       G       + L           W++      
Sbjct: 223 KQLIAERRCPIFKRRSFFHSYEDVLHQAVGNATVELYEYLRDHTDFDTNLIWDNALRSMN 282

Query: 104 --------------PAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
                         P    V +   + K+A++ HLY++DL         ++    DL +T
Sbjct: 283 MADLVKNLQLTYVLPTQAVVRE-PKQQKVALIAHLYFMDLLDSTLAYARSMPEGTDLILT 341

Query: 150 L-VTESASIKSEILKIFP-AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSK 207
           +   E A +     +  P    + ++EN GRDV   L+  +     +YD VC +H KK  
Sbjct: 342 VGSQEKAELVERACQDLPYNVDVRVIENRGRDVSALLVGCKDIV-DDYDLVCFMHDKKVT 400

Query: 208 RKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCS 267
           +       G+ + R  F +LL     V  ++ TFD+   +G++      + + +  Y+ S
Sbjct: 401 QLSPY-TVGEGFARKCFDNLLPTREFVENVVATFDSEPRLGLLSPTPPNHADYFPIYSYS 459

Query: 268 LGKNREMICTLAGR---MGITFQDQK-LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVH 323
            G N +    L  +   + +     K +    GTMFW R  AL P+ +        P   
Sbjct: 460 WGPNFDRTKMLLEKELNLNVPLDAHKEVIAPLGTMFWFRPAALKPLFDHDWQWEDFPPEP 519

Query: 324 KALDGEIEHAVERCFSLSVKKANF 347
             +DG I HA+ER +    + + +
Sbjct: 520 NDIDGTILHAIERAYGYVAQASGY 543


>gi|325067622|ref|ZP_08126295.1| hypothetical protein AoriK_07369 [Actinomyces oris K20]
          Length = 626

 Score =  295 bits (755), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 75/384 (19%), Positives = 135/384 (35%), Gaps = 46/384 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCY-DENYVV 61
           SK +  +  +    + Y D   + +      F    F     +  +  +   +    +  
Sbjct: 163 SKAFQDYWDNLPQMSSYEDSVGLHEAPFTQRFERLGFTSDVYVNTEDLEGYTFSPVLFAP 222

Query: 62  AYGSRSGKKFFAQSNLYMMERE---LHFDGQRIHHFPQLLHG---------WES------ 103
                  +    +   +  + +       G       + L           W++      
Sbjct: 223 KRLIEEKRCPIFKRRSFFHDYQDLVRQSVGNTSLELYEYLRDHTDFDTNLIWDNALRSMN 282

Query: 104 --------------PAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
                         P    V +     KIA++ HLYY+DL       + ++    DL +T
Sbjct: 283 MADLVKNLHLTYVLPTQAVVHE-PKPQKIALIAHLYYMDLLEPTLAYVKSMPEGTDLILT 341

Query: 150 L-VTESASIKSEILKIFP-AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSK 207
           +   E A +  E  K  P    + ++EN GRDV   L+  +     +YD VC  H KK  
Sbjct: 342 VGSQEKAELVEEACKDLPYNVTVRLIENRGRDVSALLVGCKDII-HDYDLVCFTHDKKVT 400

Query: 208 RKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCS 267
           +       GD +    F +LL     V  +I TFD    +G++      + + +  ++  
Sbjct: 401 QVKPY-SVGDGFAIKCFENLLATRDFVKNVIATFDAEPRLGLLAPTPPNHGDYFPVFSMG 459

Query: 268 LGKNREMICTLAGR-MGITFQ---DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVH 323
            G N E   TL  + + ++      +      GTMFW R  AL P+ +        P   
Sbjct: 460 WGPNFERTKTLLEKELNLSVPIDESRAPIAPLGTMFWFRPAALKPLFDHDWQWEDFPPEP 519

Query: 324 KALDGEIEHAVERCFSLSVKKANF 347
             +DG I HA+ER +    + + +
Sbjct: 520 NNIDGTILHAIERAYGYVAQASGY 543


>gi|225352528|ref|ZP_03743551.1| hypothetical protein BIFPSEUDO_04151 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225156722|gb|EEG70116.1| hypothetical protein BIFPSEUDO_04151 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 648

 Score =  294 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 72/391 (18%), Positives = 135/391 (34%), Gaps = 48/391 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCY-DENYVV 61
           SK +  +  +      Y D   + +      F    F W   +     +   Y    +  
Sbjct: 164 SKSFQDYWDNMPPIKSYYDSVGLHESLFTKRFADKGFKWDTYVNTDDLEGFTYGPITFAA 223

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WES------ 103
                  +    +   +  +     +   G       + L           W++      
Sbjct: 224 KTLVAEKRCPIFKRRSFFHDYMDTMNQSVGNAALDLFEFLRDHTDFDVDLIWQNALRTMN 283

Query: 104 --------------PAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
                         P+      I    +IA+++HLYY+DL  +      ++    D   T
Sbjct: 284 LADLVRNLHLDFVLPSNTIAP-IPTNKRIALIMHLYYMDLLDKTLEYAKSMPEGCDFIFT 342

Query: 150 L-VTESASIKSEILKIFP-AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSK 207
           +   E+A+I  E  K  P    + +++N GRDV   L+    + L  YDYVC  H KK  
Sbjct: 343 VGSEENATIVRERCKDLPYNVDVRVIQNRGRDVSALLVGAGKDCLQ-YDYVCFAHDKKVT 401

Query: 208 RKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCS 267
           +       GD +    F ++LG+  +V  II  F+     G++      + + + ++   
Sbjct: 402 QLSPYSI-GDGFSYKCFENVLGSKALVSNIINHFENDPHAGVLAPAPPNHADYFGNFASL 460

Query: 268 LGKNREMICTLAG-----RMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKV 322
            G N E    +       ++ +    + +    GTMFW R +AL    ++       P  
Sbjct: 461 WGPNYEGTKKMLEETLQVKVPLDKSKEPI-APMGTMFWFRPKALQQFFDIDWKYEDFPPE 519

Query: 323 HKALDGEIEHAVERCFSLSVKKANFRISDVD 353
              +DG + H VER +    +   +    + 
Sbjct: 520 PNKIDGSMLHFVERAYGYVPQANGYYTGYIY 550


>gi|326772082|ref|ZP_08231367.1| rhamnan synthesis protein F [Actinomyces viscosus C505]
 gi|326638215|gb|EGE39116.1| rhamnan synthesis protein F [Actinomyces viscosus C505]
          Length = 652

 Score =  294 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 75/383 (19%), Positives = 134/383 (34%), Gaps = 44/383 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCY-DENYVV 61
           SK +  +  +    N Y D   + +      F    F     +  +  +        +  
Sbjct: 189 SKAFQDYWDNLPQINSYEDSVGLHEAPFTQRFERLGFTSDVYVNTEDLEGFTLQPILFAP 248

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WESP----- 104
                  +    +   +    E       G       + L           W++      
Sbjct: 249 KQLIAERRCPIFKRRSFFHSYEDVLHQAVGNATVELYEYLRDHTDFDTNLIWDNALRSMN 308

Query: 105 --------------AMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTL 150
                             V +     K+A++ HLYY+DL         ++    D  +T+
Sbjct: 309 MADLVKNLQLTYVLPTQAVAREPKPQKVALIAHLYYMDLLEPTLAYARSMPEGTDFILTV 368

Query: 151 -VTESASIKSEILKIFP-AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
              E   +  E  K  P    + ++EN GRDV   L+  +    S+YD VC IH KK  +
Sbjct: 369 GSQEKVELVEEACKDLPYNVTVRLIENRGRDVSALLVGCKDIV-SDYDLVCFIHDKKVTQ 427

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
                  G+ + R  F +LL     V  +I TFD+   +G++      + + +  Y+ S 
Sbjct: 428 LSPY-TVGEGFARKCFDNLLPTREFVENVISTFDSEPRLGLLSPTPPNHADYFPIYSYSW 486

Query: 269 GKNREMICTLAGR-MGITFQDQ---KLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHK 324
           G N +    L  + + ++       ++    GTMFW R  AL P+ +        P    
Sbjct: 487 GPNFDRTKMLLEKELNLSVPLDAHKEVIAPLGTMFWFRPAALKPLFDHDWQWEDFPPEPN 546

Query: 325 ALDGEIEHAVERCFSLSVKKANF 347
            +DG I HA+ER +    + + +
Sbjct: 547 DIDGTILHAIERAYGYVAQASGY 569


>gi|119026520|ref|YP_910365.1| hypothetical protein BAD_1502 [Bifidobacterium adolescentis ATCC
           15703]
 gi|118766104|dbj|BAF40283.1| hypothetical protein [Bifidobacterium adolescentis ATCC 15703]
          Length = 647

 Score =  292 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 74/389 (19%), Positives = 137/389 (35%), Gaps = 44/389 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCY-DENYVV 61
           SK +  + ++    N Y D   + +      F    F W   +     +   Y    +  
Sbjct: 163 SKEFQDYWNNMPQINSYYDSVGMHESLFTKRFADLGFKWDVYVNTDDLEGFTYGPITFAA 222

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WESPAMG-- 107
               +  +    +   +  +     +   G       + L           W++      
Sbjct: 223 KTLIKEKRCPIFKRRSFFHDYMDTLNQSAGNAALDLFEYLRDHTDYDVNLIWQNALRTMN 282

Query: 108 -----------------KVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTL 150
                                I    +IA+++HLYY+DL  +      ++    D   T+
Sbjct: 283 LADLVKNLHLDFVMPSNITTPIPEGKRIALIMHLYYMDLLDKTLEYAKSMPEGCDFIFTV 342

Query: 151 -VTESASIKSEILKIFP-AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
              E+A +  E  K  P    + +++N GRDV   LI    + L  YDYVC  H KK  +
Sbjct: 343 GSEENAKLVRERCKGLPYNVDVRVIQNRGRDVSALLIGAGKDCL-KYDYVCFAHDKKVTQ 401

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
                  GD +    F ++LG+  +V  II  F+     G++   +  + + + ++    
Sbjct: 402 LSPYSI-GDGFAYKCFENILGSKALVSNIINHFEQDPHAGLLAPTSPNHADYFGNFASLW 460

Query: 269 GKNREMICT-LAGRMGITFQ---DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHK 324
           G N E     L   +G+       ++     GTMFW R +AL  + ++       P    
Sbjct: 461 GPNFEGTKKMLEETLGVKVPLNPYKEPIAPLGTMFWFRPKALHQLFDIDWKYEDFPPEPN 520

Query: 325 ALDGEIEHAVERCFSLSVKKANFRISDVD 353
            +DG + H +ER +    +   +    V 
Sbjct: 521 KIDGSMLHFIERAYGYLPQANGYYTGFVY 549


>gi|160894491|ref|ZP_02075267.1| hypothetical protein CLOL250_02043 [Clostridium sp. L2-50]
 gi|156863802|gb|EDO57233.1| hypothetical protein CLOL250_02043 [Clostridium sp. L2-50]
          Length = 646

 Score =  292 bits (749), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 82/389 (21%), Positives = 140/389 (35%), Gaps = 49/389 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKR-SKKLCYDENYVV 61
           S+ +  F         Y D     +      F    + W   +     S K  Y      
Sbjct: 163 SEDFQSFWDEMPMIKGYEDSIGNFESIFTKHFADLGYKWDVYVKTDDISNKTDYPLMNYA 222

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WE------- 102
               R  +    +  ++    E       GQ        L           W+       
Sbjct: 223 KELIRDKRCPIFKRRMFFQPYEYEIFNTLGQPGKELYDYLKSTGLYDVNLIWDNILRTCH 282

Query: 103 -----------------SPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFD 145
                            S    K+ +I  K K+A+V+HLY+ DL  +     SN+    D
Sbjct: 283 QADFVKNLHLNYILSSSSYDQNKMDEILKKRKLALVMHLYFPDLVEDSFQWASNVPKETD 342

Query: 146 LHVTLVT-ESASIKSEILKIFPA--ARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIH 202
           +++T  T E      ++ K  P     + ++ N GRDV   L+ ++     NYDY C +H
Sbjct: 343 VYITTDTVEKKEAILKVFKNLPCNHLEVRVIVNRGRDVSSILVGVKDVI-QNYDYACFVH 401

Query: 203 GKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYC 262
            KK+ +       GD +    + + L     V  +++TF+ +  +G++      +   Y 
Sbjct: 402 DKKTAQAKP-GSVGDSFGYKCWNNTLYNKEFVCNVLQTFEDNERLGILSPPEPNHGPFYQ 460

Query: 263 DYTCSLGKNREMICTLAGRMGITFQ---DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFE 319
                 G N E    +A ++GIT     D++     GT FW R  AL  + +        
Sbjct: 461 TLGNEWGCNFEKSREVADKLGITIPMSEDKEALAPYGTFFWFRPTALKVLFDHDWQYEEF 520

Query: 320 PKVHKALDGEIEHAVERCFSLSVKKANFR 348
           P+     DG I HA+ER + + V++A + 
Sbjct: 521 PEEPNNFDGTILHAIERLYPICVQQAGYY 549


>gi|310829395|ref|YP_003961752.1| hypothetical protein ELI_3842 [Eubacterium limosum KIST612]
 gi|308741129|gb|ADO38789.1| hypothetical protein ELI_3842 [Eubacterium limosum KIST612]
          Length = 627

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 79/387 (20%), Positives = 134/387 (34%), Gaps = 47/387 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCY-DENYVV 61
           S+ +  +  +    N Y D     +      F    F W   +     ++  Y     V 
Sbjct: 163 SESFKNYWENMPMINDYFDAICCHEAIFTQTFEKKGFSWDVYVGTDDLREYTYYPLQMVP 222

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WE------- 102
                + +    +   +      + D   G+  +   + +           W+       
Sbjct: 223 RELVENRRCPIIKRRSFFHNFSDYLDYTAGEPAYELMEYIEHFTTYDTNLIWQNILRTMH 282

Query: 103 ---------------SPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLH 147
                          S       +I  + +IA + HLY+ DL  E    LS++    D++
Sbjct: 283 QADFKRALQLNYILSSEFSYDSKKILCEKRIAAIFHLYFEDLIDETYRYLSSMPEEADIY 342

Query: 148 VTLVTE-SASIKSEILKIF--PAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGK 204
           +T  TE    +  E  K F     ++ +++N GRDV   L+  +   + NYDYVC  H K
Sbjct: 343 ITTDTEPKKKLIQEKFKDFSCRNFKVILIQNRGRDVSALLVATKAFIM-NYDYVCFAHDK 401

Query: 205 KSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDY 264
           K  +       G  +    F + L     V  II  F+ +  +GM+          Y   
Sbjct: 402 KVTQTKPYSI-GGAFAYKCFENTLQNKNFVLNIINAFEKNPRLGMLMPAPPNNGPYYPTL 460

Query: 265 TCSLGKNREMICTLAGRMGITFQDQK---LDFFAGTMFWVRTEALDPIKNLRLSRYFEPK 321
                 N E+   L   +GI              GTMFW R +AL  + +        P+
Sbjct: 461 GNEWMCNYEVTKNLIDELGIKVPMDPGKEPISPLGTMFWFRPKALKVLFDKNWEYSDFPE 520

Query: 322 VHKALDGEIEHAVERCFSLSVKKANFR 348
               +DG + HA+ER + L V+   F 
Sbjct: 521 EPNKVDGTLLHAIERAYGLIVQSEGFY 547


>gi|227497960|ref|ZP_03928140.1| conserved hypothetical protein [Actinomyces urogenitalis DSM 15434]
 gi|226832618|gb|EEH65001.1| conserved hypothetical protein [Actinomyces urogenitalis DSM 15434]
          Length = 626

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 72/384 (18%), Positives = 137/384 (35%), Gaps = 45/384 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCY-DENYVV 61
           S+ +  +  +      Y D     ++     F    F     +     +   Y    +  
Sbjct: 162 SQAFQDYWDNLPEMETYLDSVTKHEIPFTRYFQDRGFKAEAYVNTDDLEGFTYQPIVFAP 221

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WES------ 103
               +  +    +   +  +     D   G         L           WE+      
Sbjct: 222 VTLIKDKRCPIFKRRSFFHDYGDVLDQSVGTTTRELYDYLRDHTDFDTDLIWENLLRTNN 281

Query: 104 --------------PAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
                         P     +Q   ++KIA+V+H+Y++DL  ++ +  +++    DL  T
Sbjct: 282 LADLVKNLELTYILPTQAVAVQ-PEESKIALVMHVYHMDLLPQLLHYAASMPAGCDLIAT 340

Query: 150 LVTESA--SIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSK 207
           + TE+    ++     +       ++EN GRDV   L+      L  YD VC IH KK  
Sbjct: 341 VDTEAKAQQVREATAGLSLNVETILIENRGRDVAALLVGARPRLLD-YDLVCFIHDKKVT 399

Query: 208 RKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCS 267
           +       G+ + +  F ++L  P  V  +I TF     +G++   A  + + +     S
Sbjct: 400 QIRP-GSVGEGFAKRCFENVLATPEFVCNVIATFQAEPRLGVLTPSAPHHGDYFPISAFS 458

Query: 268 LGKNREMICTLAGRMGI---TFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHK 324
            G N +    L    G+      D++     G++FW R +A+ P+   +      P    
Sbjct: 459 WGPNDKNTKELLASFGLHAPIDPDKEAIAPFGSVFWFRPQAIRPLLERKWRYDDFPAEPL 518

Query: 325 ALDGEIEHAVERCFSLSVKKANFR 348
            +DG I HA+ER +    +   + 
Sbjct: 519 PIDGTISHAIERVYCYMAQARGYY 542


>gi|312133751|ref|YP_004001090.1| protein [Bifidobacterium longum subsp. longum BBMN68]
 gi|311773029|gb|ADQ02517.1| Hypothetical protein BBMN68_1492 [Bifidobacterium longum subsp.
           longum BBMN68]
          Length = 641

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 77/383 (20%), Positives = 134/383 (34%), Gaps = 43/383 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCY-DENYVV 61
           SK +  +  +    N Y D   + +      F    + W   +     +   Y    +  
Sbjct: 164 SKEFQNYWDNLPPINSYEDSVGLHESLFTKRFADLGYTWDVYVNTNDLEGYTYGPITFAA 223

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WES------ 103
                       +   +  +     +   G       + L           W++      
Sbjct: 224 KQLIEDRHCPIFKRRSFFHDYHDVLNQSVGNASLGLYEYLRDHTGYDTDLIWQNLLRTVQ 283

Query: 104 -PAMGKVMQI------------AIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTL 150
              + K +Q+              K ++A+V+HLYY+D+  +I     ++    D+ +T+
Sbjct: 284 LSDLTKNLQLVRVLSQDNAQPIPQKFRVALVLHLYYMDILDQILRYARSMPEGCDVIITV 343

Query: 151 -VTESASIKSEILKIFP-AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
              E A I  E  +  P    + ++EN GRDV   L+    + L NYD VC  H KK ++
Sbjct: 344 GSEEKACIVKERCEGMPYNIDVRVIENRGRDVSALLVGAGKDVL-NYDLVCFAHDKKVRQ 402

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
                  GD + +  F + L +   V  II  F  +  +G+    A  + + +  Y  S 
Sbjct: 403 LRP-ETIGDGFAKKCFENTLASKAYVANIINLFADNPRLGVAMPSAPNHADYFYSYAFSW 461

Query: 269 GKNREMICTLAGRMGITFQDQK---LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKA 325
           G N      L   +GI         +    GTMFW R +AL  + +        P     
Sbjct: 462 GPNYRGTKDLLDGLGIKVPLSPHADVIAPLGTMFWFRPKALHGLIDKSWEYSDFPPEPNP 521

Query: 326 LDGEIEHAVERCFSLSVKKANFR 348
            DG   H VER +    +   + 
Sbjct: 522 ADGSFLHFVERAYCYVAQSNGYY 544


>gi|261367011|ref|ZP_05979894.1| putative polysaccharide biosynthesis protein [Subdoligranulum
           variabile DSM 15176]
 gi|282571129|gb|EFB76664.1| putative polysaccharide biosynthesis protein [Subdoligranulum
           variabile DSM 15176]
          Length = 646

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 68/389 (17%), Positives = 134/389 (34%), Gaps = 50/389 (12%)

Query: 13  FTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLC-YDENYVVAYGSRS 67
           + +       Y+D     +      F    F W   +  +  K    Y          R 
Sbjct: 164 YWNEMPMIESYTDSVQRYEAVFTKQFADRGFKWDVYVKTEDLKDFTDYPLLVCPTRLLRD 223

Query: 68  GKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHGW-ESP------------------- 104
            K    +   +M   E + +   G+ +    + L    + P                   
Sbjct: 224 KKCPLFKRRSFMHALEAYLNDTAGEPVRELYEYLRDETDYPMDLIWKNMIRTMHPHEFTR 283

Query: 105 -------------AMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV 151
                           +  ++  + +IA+ +HLY++D+  +     +      D+ V+  
Sbjct: 284 NLGLTRVIQPVVQNAKQAEELCAQRRIALAMHLYFMDMLEQSVAFAAKFPPQTDVFVSTN 343

Query: 152 TESASIKSEIL---KIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
           +E    + E     +   +  + ++EN GRDV  FL  L    L NYDY C +H KK+ +
Sbjct: 344 SEEKKEQIEQAFSGQKLHSVTVMVVENRGRDVGAFLCDLAP-HLRNYDYACFMHDKKAIQ 402

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDY-TCS 267
                  G  +      ++      V  ++  F+    +G++      +   + +  +  
Sbjct: 403 TKP-GSVGASFGYVCNENVCKNAAHVLNVLCEFENDPYLGILCPPYPTHGLYFMNMCSGG 461

Query: 268 LGKNREMICTLAGRMGITFQ---DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHK 324
            G N E    L   +G+      ++      G++FW R +AL+P+          P+   
Sbjct: 462 WGPNFENTKKLLKELGLDVPISGEESPIAPFGSVFWFRPKALEPLFAHGWQHTDFPQEPL 521

Query: 325 ALDGEIEHAVERCFSLSVKKANFRISDVD 353
             DG I HA+ER +    + A +  + V 
Sbjct: 522 PQDGTISHAIERVYPFVAQAAGYYPAVVM 550


>gi|312133752|ref|YP_004001091.1| protein [Bifidobacterium longum subsp. longum BBMN68]
 gi|311773032|gb|ADQ02520.1| Hypothetical protein BBMN68_1493 [Bifidobacterium longum subsp.
           longum BBMN68]
          Length = 651

 Score =  281 bits (720), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 83/384 (21%), Positives = 137/384 (35%), Gaps = 44/384 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCY-DENYVV 61
           SK +  +  +    N Y D   + +      F    + W   +     +   Y   NY  
Sbjct: 164 SKEFQNYWDNLPPINSYEDSVGLHESLFTKRFADLGYTWDVYVNTNDLEGYTYGPINYAP 223

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLHG---------WESPAMGKV 109
               +       +  L+  +     +   G       + L           W++      
Sbjct: 224 KKLVQEKGCPIFKRRLFFQDYGDIIEQSVGNASLDLYEYLRDHTGYDTGLIWQNILRTIN 283

Query: 110 MQIAIK-------------------AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTL 150
           +   +K                     +A+V HLYYIDL       +S++    D+ +T+
Sbjct: 284 LADVVKTLHLNYVLPQDHTSYEPNPKHVALVFHLYYIDLLDSSLQYISSMPEGCDVIITV 343

Query: 151 -VTESASIKSEILKIFP-AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
              E A I  E  +  P    + ++EN GRDV   L+    + L NYD VC  H KK  +
Sbjct: 344 GSEEKACIVKERCEGMPYNIDVRVIENRGRDVSALLVGAGKDVL-NYDLVCFAHDKKVTQ 402

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
                  GD +    F ++L +   V  II  F+    +G++      + N +  +T S 
Sbjct: 403 IKP-LSVGDGFAYKCFENILASKAYVANIIDQFEREPHLGVLMPNPPEHGNYFPVFTLSW 461

Query: 269 GKNREMICTLAGRMGITFQDQK---LDFFAGTMFWVRTEAL-DPIKNLRLSRYFEPKVHK 324
           G N +    L   +  T    K   +    GTMFW R +AL D + N        PK   
Sbjct: 462 GDNFDGTVQLLRDIHKTVPLDKKKEVIAPLGTMFWFRPKALSDGLLNHNWQYSDFPKEPN 521

Query: 325 ALDGEIEHAVERCFSLSVKKANFR 348
            +DG I H +ER +    +   + 
Sbjct: 522 KIDGTILHYIERAYCYVAQANGYY 545


>gi|260890969|ref|ZP_05902232.1| O-antigen export system ATP-binding protein RfbB [Leptotrichia
           hofstadii F0254]
 gi|260859295|gb|EEX73795.1| O-antigen export system ATP-binding protein RfbB [Leptotrichia
           hofstadii F0254]
          Length = 709

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 69/386 (17%), Positives = 132/386 (34%), Gaps = 46/386 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLC-YDENYVV 61
           +K Y     +    N Y++   + +      F    +     +     +    Y    + 
Sbjct: 4   TKDYKDLWENMPMINSYAESVGLYEAIFTKEFNEKGYKSAVYIDTSDLEGYTRYPLMMMS 63

Query: 62  AYGSRSGKKFFAQSNLY---MMERELHFDGQRIHHFPQLLHG---------WESPAMGKV 109
                + +    +   +    M+  +   G    +  + +           W++      
Sbjct: 64  DELIVNRRCPVIKLKSFSQNYMDIIMDTVGSCTLNSYEFIRNNTSYDVDLIWQNILRTSN 123

Query: 110 MQIAIKA---------------------KIAIVVHLYYIDLWIEIANLLSNLSISFDLHV 148
           M    +                      K+ ++ H+Y+ DL  E  + + ++  + DL +
Sbjct: 124 MAAIKRLMHLNYILPTEYELKNYDLSEDKVLLIFHIYFEDLLDESIHYMKSMPETSDLLI 183

Query: 149 TLVTESASIKSEILKI---FPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKK 205
           T   +    K E       F    + ++EN GRDV   L+  +   + NYDYVC +H KK
Sbjct: 184 TTPRKELKEKIEEKVRGLNFRNIEVRVIENRGRDVSSLLVGAKDAVM-NYDYVCFMHDKK 242

Query: 206 SKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYT 265
           + +        D++  +     L     V  +I TF  +  +GM+      + N +    
Sbjct: 243 TAQLKPYSSLNDVYINYC-KGTLATKKYVKNLIGTFKENPRLGMLMPPPPNHGNFFHIIG 301

Query: 266 CSLGKNREMICTLAGRMGITFQDQ---KLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKV 322
                N +    L  ++G+        +     GTMFW R  AL  + +        P+ 
Sbjct: 302 NEWSSNFKKTEKLIKKLGLNVDFHWNLEPISPLGTMFWFRPRALKKLFDYGWEYSDFPEE 361

Query: 323 HKALDGEIEHAVERCFSLSVKKANFR 348
               DG I HAVER +   V+ A + 
Sbjct: 362 PNEHDGTILHAVERVYGFVVQDAGYY 387


>gi|221634566|ref|YP_002523254.1| Lipopolysaccharide biosynthesis protein-like protein [Rhodobacter
           sphaeroides KD131]
 gi|221163439|gb|ACM04401.1| Lipopolysaccharide biosynthesis protein-like protein [Rhodobacter
           sphaeroides KD131]
          Length = 755

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 91/329 (27%), Positives = 141/329 (42%), Gaps = 40/329 (12%)

Query: 53  LCYDENYVVAYGSRSGKKF--------FAQSNLYMMERELHFDGQRIHHFPQLLHGWES- 103
           L Y E + +AYG R G +         + + +  + E  +        H+ ++ H  +  
Sbjct: 54  LKYPEKHYIAYGERLGYRPNPDFSPQAYLRYHPDVAEAGVP----PFLHYVRVGHAEQRL 109

Query: 104 -PAMGKVMQIAIK-------------AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
              + +V+ +  +             A  A+ VH+YY DLW E A  L  L I FDL+VT
Sbjct: 110 TKELPEVVALPARGMPQVRFEHGRQTAPYAVAVHVYYPDLWPEFAARLRRLRIPFDLYVT 169

Query: 150 LV---TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKS 206
           L     E+ ++  EI   FP A +  M N GRD+LPF+ LL       Y  VCK H KKS
Sbjct: 170 LTYRGEETDALAQEIRADFPGAFVTPMPNRGRDILPFVTLLNAGAFDGYRAVCKFHTKKS 229

Query: 207 KRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTC 266
                   +GDLWR+ L   +L   G+  K +  F    + G   +    Y       T 
Sbjct: 230 P----HRQDGDLWRKHLIEGILPETGLEEK-LEAFVEAPEAGFWVADGQHYTG-----TQ 279

Query: 267 SLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKAL 326
             G N E    L  R+ I    + L F AG+++WV+   L  +++L+L           +
Sbjct: 280 WWGSNVEATRHLLQRIEIPLDREALSFPAGSIYWVKPLVLGLLRSLQLRLEDFDIEEGQV 339

Query: 327 DGEIEHAVERCFSLSVKKANFRISDVDCI 355
           DG + HA+ER       +A  ++     +
Sbjct: 340 DGTLAHAIERVLGYLTARAGQKVLQTSEL 368


>gi|126464825|ref|YP_001041801.1| lipopolysaccharide biosynthesis protein-like [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126106640|gb|ABN79165.1| Lipopolysaccharide biosynthesis protein-like [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 751

 Score =  279 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 91/329 (27%), Positives = 141/329 (42%), Gaps = 40/329 (12%)

Query: 53  LCYDENYVVAYGSRSGKKF--------FAQSNLYMMERELHFDGQRIHHFPQLLHGWES- 103
           L Y E + +AYG R G +         + + +  + E  +        H+ ++ H  +  
Sbjct: 50  LKYPEKHYIAYGERLGYRPNPDFSPQAYLRYHPDVAEAGVP----PFLHYVRVGHAEQRL 105

Query: 104 -PAMGKVMQIAIK-------------AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
              + +V+ +  +             A  A+ VH+YY DLW E A  L  L I FDL+VT
Sbjct: 106 TKELPEVVALPARGMPQVRFEHGRQTAPYAVAVHVYYPDLWPEFAARLRRLRIPFDLYVT 165

Query: 150 LV---TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKS 206
           L     E+ ++  EI   FP A +  M N GRD+LPF+ LL       Y  VCK H KKS
Sbjct: 166 LTYRGEETDALAEEIRADFPGAFVTPMPNRGRDILPFVTLLNAGAFDGYRAVCKFHTKKS 225

Query: 207 KRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTC 266
                   +GDLWR+ L   +L   G+  K +  F    + G   +    Y       T 
Sbjct: 226 P----HRQDGDLWRKHLIEGILPETGLEEK-LEAFVEAPEAGFWVADGQHYTG-----TQ 275

Query: 267 SLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKAL 326
             G N E    L  R+ I    + L F AG+++WV+   L  +++L+L           +
Sbjct: 276 WWGSNVEATRHLLQRIEIPLDREALSFPAGSIYWVKPLVLGLLRSLQLRLEDFDIEEGQV 335

Query: 327 DGEIEHAVERCFSLSVKKANFRISDVDCI 355
           DG + HA+ER       +A  ++     +
Sbjct: 336 DGTLAHAIERVLGYLTARAGQKVLQTSEL 364


>gi|125654691|ref|YP_001033885.1| hypothetical protein RSP_3918 [Rhodobacter sphaeroides 2.4.1]
 gi|77386351|gb|ABA81780.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 751

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 91/329 (27%), Positives = 141/329 (42%), Gaps = 40/329 (12%)

Query: 53  LCYDENYVVAYGSRSGKKF--------FAQSNLYMMERELHFDGQRIHHFPQLLHGWES- 103
           L Y E + +AYG R G +         + + +  + E  +        H+ ++ H  +  
Sbjct: 50  LKYPEKHYIAYGERLGYRPNPDFSPQAYLRYHPDVAEAGVP----PFLHYVRVGHAEQRL 105

Query: 104 -PAMGKVMQIAIK-------------AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
              + +V+ +  +             A  A+ VH+YY DLW E A  L  L I FDL+VT
Sbjct: 106 TKELPEVVALPARGMPQVRFEHGRQTAPYAVAVHVYYPDLWPEFAARLRRLRIPFDLYVT 165

Query: 150 LV---TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKS 206
           L     E+ ++  EI   FP A +  M N GRD+LPF+ LL       Y  VCK H KKS
Sbjct: 166 LTYRGEETDALAEEIRADFPGAFVTPMPNRGRDILPFVTLLNAGAFDGYRAVCKFHTKKS 225

Query: 207 KRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTC 266
                   +GDLWR+ L   +L   G+  K +  F    + G   +    Y       T 
Sbjct: 226 P----HRQDGDLWRKHLIEGILPETGLEEK-LEAFVEAPEAGFWVADGQHYTG-----TQ 275

Query: 267 SLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKAL 326
             G N E    L  R+ I    + L F AG+++WV+   L  +++L+L           +
Sbjct: 276 WWGSNVEATRHLLQRIEIPLDREALSFPAGSIYWVKPLVLGLLRSLQLRLEDFDLEEGQV 335

Query: 327 DGEIEHAVERCFSLSVKKANFRISDVDCI 355
           DG + HA+ER       +A  ++     +
Sbjct: 336 DGTLAHAIERVLGYLTARAGQKVLQTSEL 364


>gi|332561391|ref|ZP_08415706.1| hypothetical protein RSWS8N_20164 [Rhodobacter sphaeroides WS8N]
 gi|332274190|gb|EGJ19507.1| hypothetical protein RSWS8N_20164 [Rhodobacter sphaeroides WS8N]
          Length = 751

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 91/329 (27%), Positives = 141/329 (42%), Gaps = 40/329 (12%)

Query: 53  LCYDENYVVAYGSRSGKKF--------FAQSNLYMMERELHFDGQRIHHFPQLLHGWES- 103
           L Y E + +AYG R G +         + + +  + E  +        H+ ++ H  +  
Sbjct: 50  LKYPEKHYIAYGERLGYRPNPDFSPQAYLRYHPDVAEAGVP----PFLHYVRVGHAEQRL 105

Query: 104 -PAMGKVMQIAIK-------------AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
              + +V+ +  +             A  A+ VH+YY DLW E A  L  L I FDL+VT
Sbjct: 106 TKELPEVVALPARGMPQVRFEHGRQTAPYAVAVHVYYPDLWPEFAARLRRLRIPFDLYVT 165

Query: 150 LV---TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKS 206
           L     E+ ++  EI   FP A +  M N GRD+LPF+ LL       Y  VCK H KKS
Sbjct: 166 LTYRGEETDALAEEIRADFPGAFVTPMPNRGRDILPFVTLLNAGAFDGYRAVCKFHTKKS 225

Query: 207 KRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTC 266
                   +GDLWR+ L   +L   G+  K +  F    + G   +    Y       T 
Sbjct: 226 P----HRQDGDLWRKHLIEGILPETGLEEK-LEAFVEAPEAGFWVADGQHYTG-----TQ 275

Query: 267 SLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKAL 326
             G N E    L  R+ I    + L F AG+++WV+   L  +++L+L           +
Sbjct: 276 WWGSNVEATRHLLQRIEIPLDREALSFPAGSIYWVKPLVLGLLRSLQLRLEDFDLEEGQV 335

Query: 327 DGEIEHAVERCFSLSVKKANFRISDVDCI 355
           DG + HA+ER       +A  ++     +
Sbjct: 336 DGTLAHAIERVLGYLTARAGQKVLQTSEL 364


>gi|289662624|ref|ZP_06484205.1| hypothetical protein XcampvN_05932 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 945

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 77/280 (27%), Positives = 129/280 (46%), Gaps = 16/280 (5%)

Query: 76  NLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIAN 135
             ++    L    Q   H        ++P    V    ++ K+ ++VH++Y DL  E A 
Sbjct: 47  RGFLERVRLAGRKQPAAHRL----ADQAPFGRPVPSAQLQLKVGVMVHVFYPDLIDEFAQ 102

Query: 136 LLSNLSISFDLHVTLVTESASIKSE----ILKIFPAARIHIMENHGRDVLPFLILLETEQ 191
            L  + + +DL V+++  +A  ++      L+      I I+ N GRD+ P L+    + 
Sbjct: 103 SLQQMPVGYDLLVSVMDNAAEAQARDRFSKLQQIEKLDIRIVPNRGRDIAPLLVTFREQI 162

Query: 192 LSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIG 251
           L+  D V  +H KKS   G    E   WRR+L   L+G+   +   +  F     +GM+ 
Sbjct: 163 LAL-DVVGHLHTKKSLYTG---SEQGQWRRYLVSSLMGSAERIAWQLGMFQAEPRLGMLY 218

Query: 252 SRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQ-DQKLDFFAGTMFWVRTEALDPIK 310
             +Y        +  +   N E+  TLA R+G      + +DF AG+MFW + +AL P+ 
Sbjct: 219 PESYERV---PLWAHTWLSNFEVCRTLAQRLGFDINASEYIDFPAGSMFWAKVDALRPLY 275

Query: 311 NLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRIS 350
            L L     P+ H  +DG + HA+ER F   V+  ++RI 
Sbjct: 276 ALNLELKDFPEEHGQIDGTLHHAMERMFVAVVRHQHYRIG 315


>gi|289668432|ref|ZP_06489507.1| hypothetical protein XcampmN_08015 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 945

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 77/280 (27%), Positives = 129/280 (46%), Gaps = 16/280 (5%)

Query: 76  NLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIAN 135
             ++    L    Q   H        ++P    V    ++ K+ ++VH++Y DL  E A 
Sbjct: 47  RGFLERVRLAGRKQPAAHRL----ADQAPFGRPVPSAQLQVKVGVMVHVFYPDLIDEFAQ 102

Query: 136 LLSNLSISFDLHVTLVTESASIKSE----ILKIFPAARIHIMENHGRDVLPFLILLETEQ 191
            L  + + +DL V+++  +A  ++      L+      I I+ N GRD+ P L+    + 
Sbjct: 103 SLQQMPVGYDLLVSVMDNAAEAQARDRFSKLQQIEKLDIRIVPNRGRDIAPLLVTFREQI 162

Query: 192 LSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIG 251
           L+  D V  +H KKS   G    E   WRR+L   L+G+   +   +  F     +GM+ 
Sbjct: 163 LAL-DVVGHLHTKKSLYTG---SEQGQWRRYLVSSLMGSAERIAWQLGMFQAEPRLGMLY 218

Query: 252 SRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQ-DQKLDFFAGTMFWVRTEALDPIK 310
             +Y        +  +   N E+  TLA R+G      + +DF AG+MFW + +AL P+ 
Sbjct: 219 PESYERV---PLWAHTWLSNFEVCRTLAQRLGFDINASEYIDFPAGSMFWAKVDALRPLY 275

Query: 311 NLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRIS 350
            L L     P+ H  +DG + HA+ER F   V+  ++RI 
Sbjct: 276 ALNLELKDFPEEHGQIDGTLHHAMERMFVAVVRHQHYRIG 315


>gi|13476280|ref|NP_107850.1| hypothetical protein mlr7559 [Mesorhizobium loti MAFF303099]
 gi|14027041|dbj|BAB53995.1| mlr7559 [Mesorhizobium loti MAFF303099]
          Length = 644

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 77/394 (19%), Positives = 136/394 (34%), Gaps = 54/394 (13%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCYDENYVVA 62
           S  +  +         Y++   + +    G F    +     L   +     Y     V 
Sbjct: 154 SIAFRNYWERMPKITDYAESVLLHESRFTGFFENLGYKSETYLDSDKYNS-AYPVMIDVD 212

Query: 63  YGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLH----------------------- 99
               + +    +  L+  +    F  +     P+ L                        
Sbjct: 213 QIY-NDRSPILKRRLFFNDPT--FLDKNAVDLPRALRVLKETSDYDLNLIWRNVLRSSDL 269

Query: 100 ---GWESPAMGKVMQIAIKA--------KIAIVVHLYYIDLWIEIANLLSNLSISFDLHV 148
                 +  M  +    IK         KIA+  H+YY D+  EI  L  N+ + +D   
Sbjct: 270 RTLNTNAALMSVLPDKRIKGDGAAADYGKIAVCAHIYYTDMLDEILGLTGNIPVPYDFIA 329

Query: 149 TL--VTESASIKSEILKI--FPAARIHIME-NHGRDVLPFLILLETEQ-LSNYDYVCKIH 202
           T     + A I++ +          + ++E N GRD+    I L        YD VC++H
Sbjct: 330 TTNTPEKKAEIETALANRPGVKNVIVRVVEQNRGRDMSSLFISLRDLLVDDRYDLVCRLH 389

Query: 203 GKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYC 262
            KKS +   S   G+L++R +  +LL + G V  ++  F  +  +G+     +     Y 
Sbjct: 390 TKKSPQVQSSM--GNLFKRHMVDNLLNSRGYVHNVLDMFHDNPSVGLAIPPIFHI--SYP 445

Query: 263 DYTCSLGKNREMICTLAGRMGI--TFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEP 320
               S   N+  +   A  + I   F +       GTMFW R  AL  +   +       
Sbjct: 446 TMGFSWFANKPKVEETARLLNINVKFDENTPVAAYGTMFWFRPRALRKMFEHKWKWEEFN 505

Query: 321 KVHKALDGEIEHAVERCFSLSVKKANFRISDVDC 354
                +DG   HA+ER  + +V+ A +    + C
Sbjct: 506 AEPDHVDGGFAHALERLIAYAVQNAGYTTQHIMC 539


>gi|262038042|ref|ZP_06011449.1| lipopolysaccharide biosynthesis protein [Leptotrichia goodfellowii
           F0264]
 gi|261747934|gb|EEY35366.1| lipopolysaccharide biosynthesis protein [Leptotrichia goodfellowii
           F0264]
          Length = 629

 Score =  271 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 75/392 (19%), Positives = 134/392 (34%), Gaps = 48/392 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLC-YDENYVV 61
           S  +       K  N Y +  +  +      F    F W   +     K    +      
Sbjct: 157 SYEFKKHWEKMKMINTYFESVSFHEAIFTKKFNDKGFKWTTYIDSDYLKNFTDHPIIDYP 216

Query: 62  AYGSRSGKKFFAQSNLYMMERELHFD---GQRIHHFPQLLH------------------- 99
               R  +    +   +            G+   +    +                    
Sbjct: 217 REIIRDKRCPIFKRRSFFNPYYDFLSRSSGKSSLNLFNYIKTHTSYDVNLIWDNLLRTEN 276

Query: 100 ----------GWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
                      +         +I    K+ +  H+Y+ DL  E      N+    D+ +T
Sbjct: 277 MYDIKNSLHLNYNLSENQVTKKIENSPKVGLFFHIYFEDLIEECYRYALNMPEYADIFIT 336

Query: 150 LVTESASIKSE--ILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSK 207
              E    K E    K+     I +++N GRDV  FLI  + E L  YDY C  H KK+K
Sbjct: 337 TDKEEKKEKIEKIFSKMKNKIDIKVIQNRGRDVSAFLIPNKEEIL-KYDYACFAHDKKTK 395

Query: 208 RKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCS 267
           +      +G+ ++   F ++LG+  +V  II  F  +  +G++   +  +   Y +    
Sbjct: 396 QLQP-EIKGEDFKFRCFENILGSKELVENIIGLFIENPRLGLLSPPSPNHAEFYGNLGRE 454

Query: 268 LG----KNREMICTLAGRMGITFQ---DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEP 320
            G     N E  C L   + I       +      GT+FW R ++L+ +          P
Sbjct: 455 WGHSGNDNYEETCNLLKELVIEVNVDISKAPVAPYGTIFWFRPKSLEKLLKKGWKYEDFP 514

Query: 321 KVHKALDGEIEHAVERCFSLSVKKANFRISDV 352
           K    +DG + HA+ER +   V+ A +  +++
Sbjct: 515 KEPNKVDGTLLHAIERVYPFVVQGAGYYSANI 546


>gi|258591058|emb|CBE67353.1| protein of unknown function [NC10 bacterium 'Dutch sediment']
          Length = 1460

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 115/240 (47%), Gaps = 12/240 (5%)

Query: 114 IKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV-TESASIKSEILKIFPAAR--- 169
           I ++IA+  H YY DL  E+A+ L N+  +FDL V++   E+  +  +     P AR   
Sbjct: 589 ISSRIAVHAHAYYPDLTKELASYLKNMPFAFDLFVSVSNDEARDVCRQAFAGLPQARRVI 648

Query: 170 IHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLG 229
           + ++ N GRD+ P +      +L+ YDY+C +H KKS          D W  +L   L+G
Sbjct: 649 VDVVANRGRDIAPMVCHFG-GRLATYDYICHLHTKKSMYAQGKM---DGWLEYLLRQLMG 704

Query: 230 APGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGI-TFQD 288
           +   V +I   F +    G+I  + Y Y   +     +   N+ +   +  +MGI    +
Sbjct: 705 SEDQVRRIFSMFQSDPRAGIIYPQNYEYLPYW---GNTWLSNKALGAQMCRQMGITDVPE 761

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
              D+ AG+MFW R+EA+  + +  +     P+     DG + H +ER   L  + A ++
Sbjct: 762 GYFDYPAGSMFWARSEAIRNLFSADIRLTDFPEEAGQTDGSLAHCIERLLVLVARHAGYK 821


>gi|13474020|ref|NP_105588.1| hypothetical protein mll4799 [Mesorhizobium loti MAFF303099]
 gi|14024772|dbj|BAB51374.1| mll4799 [Mesorhizobium loti MAFF303099]
          Length = 386

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 95/253 (37%), Positives = 137/253 (54%), Gaps = 2/253 (0%)

Query: 95  PQLLHGWESPAMGKVMQIA-IKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE 153
             L   +  P      ++  ++ KIA+ +HL+Y DLW E   LL      F L +TL   
Sbjct: 117 KTLSRHFNGPQAEAPERLPTVEPKIAVALHLHYPDLWPEFEALLEATGRQFQLFLTLTRP 176

Query: 154 SASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSW 213
            A++   +   FP A I + EN GRDV PF+ LL   +   +D +CK+HGKKS + G   
Sbjct: 177 DAALAQRVQARFPGAEITVYENRGRDVGPFIQLLREGKFDPFDLICKLHGKKSGQSGPRM 236

Query: 214 WEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNRE 273
             G++WR+   +DL+G+ GVV +II  F+   D  MIGSR +R PN++     + G+NR 
Sbjct: 237 VLGEIWRQVSAFDLIGSRGVVDRIIANFERSPDTQMIGSRRFRLPNEWKGEKSAWGENRA 296

Query: 274 MICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHA 333
           M   L   MG+     +LDFFAGTMFWVR  AL+P++ L L     P+     DG ++HA
Sbjct: 297 MALNLLETMGMPSSS-RLDFFAGTMFWVRRGALEPLRRLDLPLAAFPEETGQQDGTLQHA 355

Query: 334 VERCFSLSVKKAN 346
           +ER   +   K  
Sbjct: 356 LERVLGMICTKIG 368


>gi|13476281|ref|NP_107851.1| hypothetical protein mlr7560 [Mesorhizobium loti MAFF303099]
 gi|14027042|dbj|BAB53996.1| mlr7560 [Mesorhizobium loti MAFF303099]
          Length = 637

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 70/398 (17%), Positives = 132/398 (33%), Gaps = 62/398 (15%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCYDENYVVA 62
           S+ +  +  +  +   Y D   + +      F    +     +   +         +  A
Sbjct: 154 SRAFKTYWENLPAIKTYIDAIMLHESQFTKHFTDLGYSAEAYVDPDKYGS------HYPA 207

Query: 63  YGSRSG----KKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKA-- 116
           + +       +    +   +  +    F   +    P+ L   E  +   +  I      
Sbjct: 208 FINVDETIINRFPLLKRRPFFHDPT--FLNAQGIDLPRALRVLEETSDYDLNLIWRNVLR 265

Query: 117 --------------------------------KIAIVVHLYYIDLWIEIANLLSNLSISF 144
                                           KIA+  H+YY D+  EI  L  N+ + +
Sbjct: 266 TSELRNLNTNAALMSVLPDERAKDDDAPSDYGKIAVCAHIYYTDMLEEILALTGNIPVPY 325

Query: 145 DLHVTL--VTESASIKSEILKI--FPAARIHIME-NHGRDVLPFLILLETEQ-LSNYDYV 198
           D   T     + A I++ + K        + ++E N GRD+    I L        YD V
Sbjct: 326 DFIATTDTPDKKAEIEATLAKRPGVKNVIVRVVEKNRGRDMSSLFISLRDLLVDDRYDLV 385

Query: 199 CKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYP 258
           C++H KKS +   S    +L++R +  +LL   G V  ++  F  +  +G+         
Sbjct: 386 CRLHTKKSPQVQASRS--NLFKRHMLENLLNTRGYVHNVLDMFHDNPSVGLAVPPVVHI- 442

Query: 259 NKYCDYTCSLGKNREMICTLAGRMGITFQDQK--LDFFAGTMFWVRTEALDPIKNLRLSR 316
             Y     +   NR  +   A  + I  +          GTMFW R  AL  +   +   
Sbjct: 443 -SYPTMGHAWFFNRPKVEETARLLNIKVKFDHDTPVAAYGTMFWFRPRALRKMFEHKWKW 501

Query: 317 YFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDC 354
                    +DG + H +ER  + + + A +    + C
Sbjct: 502 EDFNAEPNHVDGGLAHVLERLIAYAAQDAGYTTRHIMC 539


>gi|90425670|ref|YP_534040.1| glycosyl transferase, group 1 [Rhodopseudomonas palustris BisB18]
 gi|90107684|gb|ABD89721.1| glycosyl transferase, group 1 [Rhodopseudomonas palustris BisB18]
          Length = 846

 Score =  262 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 74/252 (29%), Positives = 112/252 (44%), Gaps = 16/252 (6%)

Query: 107 GKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTL--VTESASIKSEILK- 163
            +    A + +IAI  H YY DL      L++  + S DL +T     ++A I+  +   
Sbjct: 586 PRRESNAARPRIAIHGHFYYPDLLESFLKLIAANASSVDLFLTTSGPEQAAQIRKSLRAF 645

Query: 164 IFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWL 223
               A +  + N GRD+ PFL  +   +L +YD V   HGK+SK        GD WR + 
Sbjct: 646 GIQNADVWSVPNRGRDIGPFLKEMPD-KLGSYDIVGHFHGKRSKHVD--STVGDQWRDFA 702

Query: 224 FYDLLGAP-GVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRM 282
           +  L+G    ++  I   F     +G++ +           Y     +NR++   LA RM
Sbjct: 703 WQHLIGDAFPMIDVIADAFAEDAKLGLVFAEDP--------YLNGWDENRDLAERLAQRM 754

Query: 283 GITFQ-DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLS 341
            I     +  DF  GTMFW R  AL P+  L L     P     +DG I HA+ER    +
Sbjct: 755 KIEAPLPEHFDFPIGTMFWARVAALQPLFQLNLDWNDYPHEPLPIDGTILHALERIVPFA 814

Query: 342 VKKANFRISDVD 353
           V+K+ F  +   
Sbjct: 815 VQKSGFEYATTY 826


>gi|84501312|ref|ZP_00999517.1| hypothetical protein OB2597_13143 [Oceanicola batsensis HTCC2597]
 gi|84390603|gb|EAQ03091.1| hypothetical protein OB2597_13143 [Oceanicola batsensis HTCC2597]
          Length = 741

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 89/327 (27%), Positives = 132/327 (40%), Gaps = 39/327 (11%)

Query: 54  CYDENYVVAYGSRSGKKF--------FAQSNLYMMERELHFDGQRIHHFPQLLHGWES-- 103
            +   + V +G R G +         +   N  + E  L      +HHF  L  G     
Sbjct: 48  AFPMRHYVLWGERMGLEPHPDFSPGAYLGLNPDVAEAGLP----PLHHFLTLGRGEGRGT 103

Query: 104 ------------PAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV 151
                         + +      +A+ AI +HLYY DLW E +  L  L +SFDL+VTL 
Sbjct: 104 RAQPVESLPPIRTTIPRFDPRRPRARFAIHLHLYYPDLWPEFSERLDRLDLSFDLYVTLT 163

Query: 152 T---ESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
               E+  +   I +  P A++  + N GRD+LPFL LL       Y+ +CK+HGKKS  
Sbjct: 164 WRGPETEWLADIIREAHPRAQVFPVANRGRDILPFLRLLNAGAFDGYEAICKLHGKKSP- 222

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
                 +GD WRR L   +L    + +  +  F    D  +  +   RY           
Sbjct: 223 ---HRDDGDAWRRHLVDGVLPGKAL-WTSLSAFLADEDAALWVADGQRY-----SVRKWW 273

Query: 269 GKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDG 328
           G NR     L  R+ +   D   DF AG+M+W++   L  I+ L L+           DG
Sbjct: 274 GSNRARTDALLRRVELDRSDTDFDFPAGSMYWMKPLLLGMIRALDLTEDLFEPESGQTDG 333

Query: 329 EIEHAVERCFSLSVKKANFRISDVDCI 355
            + HA ER      K A   +     +
Sbjct: 334 TLAHAFERAIGALAKAAGQEVRQTSEL 360


>gi|260890973|ref|ZP_05902236.1| conserved hypothetical protein [Leptotrichia hofstadii F0254]
 gi|260859000|gb|EEX73500.1| conserved hypothetical protein [Leptotrichia hofstadii F0254]
          Length = 319

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 62/243 (25%), Positives = 105/243 (43%), Gaps = 8/243 (3%)

Query: 112 IAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKI---FPAA 168
           I +K K+ ++ H+Y+ DL  E  + + ++  + DL +T   +    K E       F   
Sbjct: 2   IYLKYKVLLIFHIYFEDLLDESIHYMKSMPETSDLLITTPRKELKEKIEEKVRGLNFRNI 61

Query: 169 RIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLL 228
            + ++EN GRDV   L+  +   + NYDYVC +H KK+ +       G  +R   + + L
Sbjct: 62  EVRVIENRGRDVSSLLVGAKDAVM-NYDYVCFMHDKKTAQLKPY-SSGQGFRYKCYENNL 119

Query: 229 GAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQD 288
                V  +I TF  +  +GM+      + N +         N +    L  ++G+    
Sbjct: 120 ATKKYVKNLIGTFKENPRLGMLMPPPPNHGNFFHIIGNEWSSNFKKTEKLIKKLGLNVDF 179

Query: 289 Q---KLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKA 345
               +     GTMFW R  AL  + +        P+     DG I HAVER +  +V+ A
Sbjct: 180 HWNLEPISPLGTMFWFRPRALKKLFDYGWEYSDFPEEPNEHDGTILHAVERVYGFAVQDA 239

Query: 346 NFR 348
            + 
Sbjct: 240 GYY 242


>gi|310816773|ref|YP_003964737.1| lipopolysaccharide biosynthesis protein-like protein
           [Ketogulonicigenium vulgare Y25]
 gi|308755508|gb|ADO43437.1| lipopolysaccharide biosynthesis protein-like protein
           [Ketogulonicigenium vulgare Y25]
          Length = 726

 Score =  256 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 71/250 (28%), Positives = 112/250 (44%), Gaps = 14/250 (5%)

Query: 106 MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIF 165
             +    A    I + +HLYY +L    A  L+ + +   L+V+  T   +  ++I +  
Sbjct: 455 QPRREAPAPARPIGVFLHLYYQELAPVFAKRLAQIPLPLSLYVSTDTAEKA--AQIERAL 512

Query: 166 PAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFY 225
           P A++ ++ N GRD+ P L          +D V  +HGKKS          D W   +  
Sbjct: 513 PQAQVRVLPNRGRDIFPKLYGFGDAYAD-HDIVLHLHGKKSL----HSSMLDEWLSHILD 567

Query: 226 DLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGIT 285
            LLG P  V +I+  FD+   +G++        ++        G NR++   LA RMG+ 
Sbjct: 568 CLLGDPADVNRILSLFDSVPRLGIVMP----VVHRSVLNAAHWGFNRDIGAELAYRMGMA 623

Query: 286 FQ---DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSV 342
                +  L F AG+MFW RT AL PI +L L     P     +DG + HAVER   +  
Sbjct: 624 TPLPENDALQFPAGSMFWARTAALQPILDLALEASHFPPEAGQVDGTLAHAVERMLGVVC 683

Query: 343 KKANFRISDV 352
           +   + +  V
Sbjct: 684 RAGGYYMLPV 693


>gi|83582737|ref|YP_425043.1| glycosyl transferase, group 1 [Rhodospirillum rubrum ATCC 11170]
 gi|83578053|gb|ABC24603.1| Glycosyl transferase, group 1 [Rhodospirillum rubrum ATCC 11170]
          Length = 1236

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 71/262 (27%), Positives = 113/262 (43%), Gaps = 18/262 (6%)

Query: 100  GWESPAMGKVMQIAIKA---KIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESAS 156
             W  P +     +       K+ +  H YY+DL  +    +     S DL +T   E  +
Sbjct: 967  NWTHPVIDLETSLPSPIEGGKVLLHGHFYYVDLIDDFLKKIIINDFSCDLIITTTDEDRA 1026

Query: 157  I-KSEILKIFPA--ARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSW 213
            +   + L+ +      + ++ N GRDV  F   L   + S+YD V  IHGKKS       
Sbjct: 1027 VFLRKKLEEYKNGSVEVRVVPNIGRDVGAFFTGLSDLKNSDYDVVGHIHGKKSIHLSD-- 1084

Query: 214  WEGDLWRRWLFYDLLGAPGVVFKI-IRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNR 272
              G+ WR +L+  L+G       I +     + DIG++ +                 KN+
Sbjct: 1085 GTGNKWRNFLWEHLIGGEKKAAAIAVSALIRNPDIGLVFAEEPFLF--------GWDKNK 1136

Query: 273  EMICTLAGRMGITFQ-DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
            E+   LA +MGI     +  D+  GTMFW + +AL+PI +L L     P     + G + 
Sbjct: 1137 ELANDLAKKMGIEKSLPRFFDWPIGTMFWAKRKALEPIFDLNLRWEDYPPEPIPVYGTML 1196

Query: 332  HAVERCFSLSVKKANFRISDVD 353
            HA+ER    +V+KA F  +   
Sbjct: 1197 HALERLLPFAVEKAGFSFATTY 1218


>gi|21111631|gb|AAM39945.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575237|gb|AAY50647.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 296

 Score =  255 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 74/276 (26%), Positives = 118/276 (42%), Gaps = 17/276 (6%)

Query: 96  QLLHGW---ESPAMGKVMQIAI---KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
           +L + W      A+ +   +A         +V+H +Y+D+  E+ + +        + +T
Sbjct: 21  RLGYAWLDATRQALTRAPDVATEICSPSACVVLHAWYLDVLDEMLDAIVECGTPLRIIIT 80

Query: 150 LV-TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
              T+   +   I +    A +   EN GRD+LPFL +       N   V K+H KKS  
Sbjct: 81  TDLTKVIEVTKCIQRRGIQAEVEGFENRGRDILPFLHVANRLLDENVQLVLKLHTKKST- 139

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
                 +G+ WR  +   LLG P  V  I+  F T    G+     +  P      T  +
Sbjct: 140 ---HRDDGNAWRGEMLTALLG-PQRVDAIVNAFSTDPLAGLAAPEDHLLP-----VTEFI 190

Query: 269 GKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDG 328
           G N + +  L  R G    D    F +G+MFW R EAL P+ +  L           +DG
Sbjct: 191 GGNADALDYLTVRTGSDAPDTNSLFASGSMFWARLEALRPLLDAHLHASEFESEQGQIDG 250

Query: 329 EIEHAVERCFSLSVKKANFRISDVDCILGYRKSLSQ 364
            + HA+ER   L+V  +  R++ V+  LG  K+ S 
Sbjct: 251 TLAHAIERFVGLAVTHSGHRVTTVEQTLGITKTPSA 286


>gi|82703518|ref|YP_413084.1| glycosyl transferase, group 1 [Nitrosospira multiformis ATCC 25196]
 gi|82411583|gb|ABB75692.1| Glycosyl transferase, group 1 [Nitrosospira multiformis ATCC 25196]
          Length = 828

 Score =  255 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 67/239 (28%), Positives = 108/239 (45%), Gaps = 13/239 (5%)

Query: 111 QIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE-SASIKSEILKIFPA-- 167
            ++   ++A+ +H+YY +L+ EI   L   ++  DL +++ TE + +  + +L  +P   
Sbjct: 585 PLSSSIRVALHLHVYYSELFPEIMARLKVNNVRPDLFISVPTECTRNEVTGLLNDYPGKV 644

Query: 168 ARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDL 227
             I I+ N GRD+ P L    +  L +YD +  +H KK+         G  W  +L  +L
Sbjct: 645 VDIQIVPNRGRDIGPLLTAFGSVFLDDYDAIGHLHTKKTADLSDEMI-GKRWYTFLLENL 703

Query: 228 LGAP-GVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITF 286
           LG    +   I+        IG++        +         G N+    +LA ++G+  
Sbjct: 704 LGGKRNMADIILGRMTADPAIGIVFPDDPHVFD--------WGNNKAHADSLASKLGLGK 755

Query: 287 QDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKA 345
             +   F  GTMFW RTEAL P+  L LS    P      DG I HA+ER   L   K 
Sbjct: 756 LQENFVFPMGTMFWARTEALRPLFTLDLSWQDYPAEPLPYDGTILHALERLLPLIAAKQ 814


>gi|320095829|ref|ZP_08027469.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 178 str.
           F0338]
 gi|319977239|gb|EFW08942.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 178 str.
           F0338]
          Length = 619

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 76/389 (19%), Positives = 132/389 (33%), Gaps = 47/389 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVAYGSR 66
           S  +  +       + Y+D     +      F             +  Y     V   + 
Sbjct: 155 SADFREYWRSMPRISSYNDSIQWHETRFTEHFTK-LGYAHKVAYPREDYPSRNPVFDNAA 213

Query: 67  S---GKKFFAQSNLYMMERELHFDGQRIH--HFPQLL--HGWES---------------- 103
                     +      +  L+ D   I      +L    G+++                
Sbjct: 214 QLLADGCPILKRRNLFHD-PLYLDRYAIVGADMLELAARSGYDTDLILTNLARTSKPRDL 272

Query: 104 -----------PAM-GKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV 151
                      P+   +  + A   ++  + H++Y D+  EI + LS L   + L  T  
Sbjct: 273 VTNAGLTTVVPPSAAPEAREKAASLRVVAIAHIFYADMADEIIDRLSVLPDGWRLVATTA 332

Query: 152 TESAS--IKSEILKIFPAARIHIM-ENHGRDVLPFLILLETEQL-SNYDYVCKIHGKKSK 207
            E     I+  + +     ++ ++  N GRD+  FL+         +YD V KIH KKS 
Sbjct: 333 DEERKAAIEETMARRGAVGQVRVVASNRGRDISAFLVDCSDVLAGDDYDVVVKIHSKKSV 392

Query: 208 RKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCS 267
           +   +     L++  L+ +LL +   V  I+  F  H  +GM  +        Y     +
Sbjct: 393 QDEANAA--QLFKDHLYENLLDSKDHVANILAEFADHPGLGMALAPMPHMG--YPTMGHA 448

Query: 268 LGKNREMICTLAGRMGI--TFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKA 325
              NR     LA R+GI   F D +     G+MF  R  AL P+    L+    P     
Sbjct: 449 WFANRPPARELAKRIGITVPFDDHQPLAPYGSMFIARPRALRPLVEAGLTHDDFPPEGGY 508

Query: 326 LDGEIEHAVERCFSLSVKKANFRISDVDC 354
            DG + H +ER  + +V    +    V  
Sbjct: 509 QDGSLAHVIERLLAYAVLSEGYYARPVMT 537


>gi|33862360|ref|NP_893920.1| glycosyltransferase [Prochlorococcus marinus str. MIT 9313]
 gi|33640473|emb|CAE20262.1| glycosyltransferase [Prochlorococcus marinus str. MIT 9313]
          Length = 738

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 75/370 (20%), Positives = 134/370 (36%), Gaps = 33/370 (8%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWT------LFYKRSKKLCYDENYV 60
           ++ +F  + + K     ++    E+  L   F              +K SK     E   
Sbjct: 373 AQEWFNMSHYIKELKSIAEETVKEEKILKEEFKILASKRIIDQEFCFKNSKLSKRSEILH 432

Query: 61  VAYGSRSG---KKFFAQSNLYMMERELHFDG---QRIHHFPQLLH---GWESPAMGKVMQ 111
                R+    +K F   +  + + ++  D      + H+ +       W  P +     
Sbjct: 433 YLVSWRNEVWPRKPFPGFHPGIYKEQILEDAPCPDPLIHYLKENQPKGEWNVPMITPASS 492

Query: 112 IAIK---AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAA 168
           +  +     IA+ VH++Y +L   I N L+   I  DL ++        + +        
Sbjct: 493 LQQQDSETTIALHVHVHYPELLDTILNALNYNKIRPDLFLSCTNHENHSEIQCKSAGANC 552

Query: 169 R---IHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFY 225
               I    N GRD+ P L  +  E  + Y+    +H KKS         G  WR +L  
Sbjct: 553 TLKSIITTPNRGRDIGPLLTEIGKELDTKYEIYGHLHTKKSALLPGKQ--GCSWRDFLIS 610

Query: 226 DLLGAPGVV--FKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMG 283
           +L+G   +    +I+     +  +G++ +                  NR+    LA ++ 
Sbjct: 611 NLVGMQDIAMADRIVTALKKNPKLGLVFADDPTCV--------GWSGNRKHADILANKLN 662

Query: 284 ITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVK 343
           +    +  DF  GTMFW +  AL  + NL L     P+     DG I HA+ER   +   
Sbjct: 663 LGPLPRCFDFPVGTMFWAKKGALTELYNLNLGWEDYPQEPLGYDGTILHAIERLLPIIAA 722

Query: 344 KANFRISDVD 353
           K  F  +  +
Sbjct: 723 KQGFTYNLTN 732


>gi|154509526|ref|ZP_02045168.1| hypothetical protein ACTODO_02058 [Actinomyces odontolyticus ATCC
           17982]
 gi|153799160|gb|EDN81580.1| hypothetical protein ACTODO_02058 [Actinomyces odontolyticus ATCC
           17982]
          Length = 620

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 79/389 (20%), Positives = 131/389 (33%), Gaps = 47/389 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVA---Y 63
           S  +  +         Y+D     +      +F            +  Y     V     
Sbjct: 155 SPDFRKYWDEMPPIRSYNDSIQWHESRFTE-YFGNLGYTHVVAYPREDYPSRNPVFDNAS 213

Query: 64  GSRSGKKFFAQSNLYMMERELHFD-------------GQRIHHFPQLLHGWESPAMGK-- 108
              +      +      +  L+ D             G+  +    +L      +  +  
Sbjct: 214 MLLADGCPILKRRNLFHD-PLYLDRHAIIGADMLELAGKAGYDTDLILTNLARTSRPRDL 272

Query: 109 -----------------VMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV 151
                             +  A   KI  V H++Y D+  EI + LS L   + L  T  
Sbjct: 273 VTNAGLTTVISPRADQATLDAAASLKILAVAHIFYADMADEILDRLSVLPAGYHLVATTS 332

Query: 152 TESAS--IKSEILKIFPAARIHIME-NHGRDVLPFLILLETEQLSN-YDYVCKIHGKKSK 207
            E     I++   +    A + ++  N GRD+  FL+       S  YD V KIH KKS 
Sbjct: 333 NEENKALIEARAQERGVDADVRVVSSNRGRDIGAFLVDCNDVLTSGEYDIVVKIHSKKSV 392

Query: 208 RKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCS 267
           +  Y+     L++  L+ +LL +   V  I+  F  H  +GM+ +        Y     +
Sbjct: 393 QDDYNAA--QLFKEHLYDNLLASSDHVASILAEFAAHPGLGMVIAPMPHMG--YPTMGHA 448

Query: 268 LGKNREMICTLAGRMGI--TFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKA 325
              NR      A ++GI   F D +     G+MF  R EAL  +    L     P+    
Sbjct: 449 WFANRAPARDFAKKVGITVPFDDHQPLAPYGSMFIARPEALSLLTGAGLVPEDFPEEGGY 508

Query: 326 LDGEIEHAVERCFSLSVKKANFRISDVDC 354
            DG + H +ER  S +V    + +  V  
Sbjct: 509 KDGSLAHVIERLLSYAVLSRGYYVRPVMT 537


>gi|78184210|ref|YP_376645.1| lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9902]
 gi|78168504|gb|ABB25601.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9902]
          Length = 1161

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 60/265 (22%), Positives = 110/265 (41%), Gaps = 15/265 (5%)

Query: 105 AMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKI 164
             GK++    + K  + +H++Y +L   IA+ +  + +  D+H++   ++ S  +EI K 
Sbjct: 190 NDGKLISSIGQKKFGVFLHIFYPELAPIIADYIRKIPVKIDIHISTTHDAISGLTEIFKG 249

Query: 165 FPA---ARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRR 221
                  ++    N GRDV PF++    E    YDY+ K+H KKS            W  
Sbjct: 250 LENSLNVQVKSFPNIGRDVAPFIVGFREEI-PKYDYILKLHSKKSP----HSNALSGWFE 304

Query: 222 WLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLG---KNREMICTL 278
               +L+G+  V +  I+  +   DI ++        +    +    G    N     TL
Sbjct: 305 HCLDNLIGSIDVFYTNIQELNKE-DISIVYPVENYALSLGIKHDSCWGHEDGNYNKAKTL 363

Query: 279 AGRMGITF--QDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVER 336
             ++G+    ++ +  F  G MFW + + L PI +  L           +DG + H++ER
Sbjct: 364 LKKLGLEQINRNSEFLFPTGNMFWCKPDILKPILDWDLKFEDFDNEGGQIDGTLAHSIER 423

Query: 337 CFSLSV-KKANFRISDVDCILGYRK 360
              L   +  + +I    C     K
Sbjct: 424 LIGLCCTEYFHKKIITSYCGYAESK 448


>gi|291520004|emb|CBK75225.1| Lipopolysaccharide biosynthesis protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 984

 Score =  252 bits (643), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 60/236 (25%), Positives = 99/236 (41%), Gaps = 12/236 (5%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSE----ILKIFPAARIH 171
             +A+ +HL+Y+DL  E  +  +N+   FDL+++    +     +     LK+     I 
Sbjct: 327 PSVAVHLHLFYVDLLPEFVSYFANIPFRFDLYISCQEGADVSVIKSGVKELKMANKVVIR 386

Query: 172 IMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAP 231
            + N GRD+ P  +    E    +DY   +H KKS   G    E   WR++    LLG+P
Sbjct: 387 PLPNRGRDLAPLYVGFADEI-RQHDYFLHVHSKKSLYSG---AEKGGWRQFSLELLLGSP 442

Query: 232 GVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKL 291
             V  I   F  +++ G++    +           S   N  +   L     +       
Sbjct: 443 EKVNSIFNLF-KNKNAGLVYPDIHEEV---PMIAYSWLANAGLGRKLFDEFELGEMPTVF 498

Query: 292 DFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANF 347
           ++ AG+ FW RT+AL PI N        P+     DG + HA+ER      +K  +
Sbjct: 499 NYPAGSFFWARTDALMPIFNRNYIYEDFPEEAGQTDGTLAHALERIIPFVSRKLGY 554


>gi|116071143|ref|ZP_01468412.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           BL107]
 gi|116066548|gb|EAU72305.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           BL107]
          Length = 1161

 Score =  251 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 60/267 (22%), Positives = 109/267 (40%), Gaps = 15/267 (5%)

Query: 103 SPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEIL 162
           SP   K+ Q   + K  + +H++Y +L   IA+ L+ + +  D++++   +     ++  
Sbjct: 188 SPHPQKLTQAIEQKKFGVFLHIFYPELAKTIADYLAKIPVKIDIYISTTEKEVDELAKTF 247

Query: 163 KIFPA---ARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLW 219
           +        ++    N GRDV PF++    E L  YD++ K+H KKS            W
Sbjct: 248 RRLDNSEHVQVKSFSNTGRDVAPFVVGFREEIL-KYDFILKLHSKKSP----HSDALSGW 302

Query: 220 RRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLG---KNREMIC 276
                 +L+G+  V +  I     +    +I        +    +    G    N +   
Sbjct: 303 FEHCLDNLIGSKDVFYTNIFELMNNE-TAIIYPVENYALSLGIKHDSCWGHEDGNYDKAK 361

Query: 277 TLAGRMGIT--FQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAV 334
            L  ++ +    +D K  F  GTMFW ++  L PI +  L  +        +DG + H++
Sbjct: 362 PLLDKLNLKHIDRDSKFLFPTGTMFWCKSYILQPILDWNLGFHDFDNEGGQIDGTLAHSI 421

Query: 335 ERCFSLSV-KKANFRISDVDCILGYRK 360
           ER   L   +K + RI    C     K
Sbjct: 422 ERLIGLCCTEKFHKRIITSYCGYANSK 448


>gi|13476282|ref|NP_107852.1| hypothetical protein mlr7561 [Mesorhizobium loti MAFF303099]
 gi|14027043|dbj|BAB53997.1| mlr7561 [Mesorhizobium loti MAFF303099]
          Length = 609

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 75/390 (19%), Positives = 137/390 (35%), Gaps = 50/390 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCYDENYVVA 62
           SK +  + +   S N Y +     +      F    +     L  +R +   Y       
Sbjct: 155 SKAFRDYWTRMVSINSYIESVAKHETVFTAHFQALGYTCSVLLDPERYRT-PYPVFMEPD 213

Query: 63  YGSRSGKKFFAQSNLYMMER----ELHFDGQRIHHFPQLLHGWE------------SP-- 104
                 +    +  L+  +         +  R     +    ++            SP  
Sbjct: 214 KTL-EDRSPILKRRLFFHDTLSLERAAINLPRALEIIENQSDYDLSLIWKSVGRLGSPRT 272

Query: 105 --------AMGKVMQIAIKA-----KIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV 151
                   ++   +Q+  +      +IA++ H+Y++D+  EI     N+   +DL VT  
Sbjct: 273 LNGNAALLSVLPDVQVGPQRNWDDCRIAVLAHVYHLDMIDEILGYAENVPKGYDLIVTTD 332

Query: 152 TESAS--IKSEILKIFP--AARIHIMENHGRDVLPFLILLETEQL-SNYDYVCKIHGKKS 206
                  I+  I K      A + ++ N GRD    L+      L   YD +C++H K+S
Sbjct: 333 NADKQALIQQAIAKATNASNAVVLVVRNDGRDTSALLVGCRDYVLEDRYDLICRVHSKRS 392

Query: 207 KRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTC 266
            + G     G+L++   F +LL  PG V  ++  F  +  +G++          Y     
Sbjct: 393 PQDGPR---GELFKLHTFENLLHTPGYVSNLLELFANNPALGLVMP--PLVHIGYPTIGN 447

Query: 267 SLGKNREMICTLAGRMGITF--QDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHK 324
           S   N+  +  LA ++G+     D       G M+W R  AL  +   R +         
Sbjct: 448 SWAGNKANVAKLARQLGLIVHLDDSTPVAPYGGMYWFRPAALRKLFEERWNWNDF-ANMD 506

Query: 325 ALDGEIEHAVERCFSLSVKKANFRISDVDC 354
             DG + HA+ER  +     A +    V  
Sbjct: 507 YRDGSLVHAIERIIAYVAIDAGYTFRHVMT 536


>gi|293189412|ref|ZP_06608132.1| rhamnan synthesis protein F [Actinomyces odontolyticus F0309]
 gi|292821502|gb|EFF80441.1| rhamnan synthesis protein F [Actinomyces odontolyticus F0309]
          Length = 620

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 78/389 (20%), Positives = 130/389 (33%), Gaps = 47/389 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVA---Y 63
           S  +  +         Y+D     +      +F            +  Y     V     
Sbjct: 155 SPDFRKYWDEMPPIRSYNDSIQWHESRFTE-YFGNLGYTHVVAYPREEYPSRNPVFDNAS 213

Query: 64  GSRSGKKFFAQSNLYMMERELHFD-----GQRIHHFPQ--------LLHGWESPAMGK-- 108
              +      +      +  L+ D     G  +             +L      +  +  
Sbjct: 214 MLLADGCPILKRRNLFHD-PLYLDRHAIIGADMLELADRAGYDTDLILTNLARTSRPRDL 272

Query: 109 -----------------VMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV 151
                             +  A   K+  V H++Y D+  EI + LS L   + L  T  
Sbjct: 273 VTNAGLTTVISPRADQATLDAAASLKVLAVAHIFYADMADEILDRLSVLPAGYHLVATTS 332

Query: 152 TESAS--IKSEILKIFPAARIHIME-NHGRDVLPFLILLETEQLSN-YDYVCKIHGKKSK 207
            E     I++   +    A + ++  N GRD+  FL+       S  YD V KIH KKS 
Sbjct: 333 NEENKALIEAHAQERGVDADVRVVSSNRGRDIGAFLVDCNDVLTSGEYDIVVKIHSKKSV 392

Query: 208 RKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCS 267
           +  Y+     L++  L+ +LL +   V  I+  F  H  +GM+ +        Y     +
Sbjct: 393 QDDYNAA--QLFKEHLYDNLLASSDHVASILAKFAAHPGLGMVIAPMPHMG--YPTMGHA 448

Query: 268 LGKNREMICTLAGRMGI--TFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKA 325
              NR      A ++GI   F D +     G+MF  R EAL  +    L     P+    
Sbjct: 449 WFANRAPARDFAKKVGITVPFDDHQPLAPYGSMFIARPEALSLLTGAGLVPEDFPEEGGY 508

Query: 326 LDGEIEHAVERCFSLSVKKANFRISDVDC 354
            DG + H +ER  S +V    + +  V  
Sbjct: 509 KDGSLAHVIERLLSYAVLSRGYYVRPVMT 537


>gi|317047360|ref|YP_004115008.1| family 2 glycosyl transferase [Pantoea sp. At-9b]
 gi|316948977|gb|ADU68452.1| glycosyl transferase family 2 [Pantoea sp. At-9b]
          Length = 1419

 Score =  249 bits (635), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 71/304 (23%), Positives = 120/304 (39%), Gaps = 32/304 (10%)

Query: 53  LCYDENYVVAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQI 112
             + E    +   R  +  F +      E      G+ +          ++P +      
Sbjct: 549 YGHAEGRQPSATPRMLEAPFFRYGP--SEYGA--KGRPLLI--------DAP-VQLNEGF 595

Query: 113 AIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV------TESASIKSEILKIFP 166
           A    I + +HLYY+DL  E    L+ +   FDL ++L        E        +K   
Sbjct: 596 AR--TIGVHLHLYYVDLADEFIKHLNTIPTGFDLFISLPRGKHNVEECERKFRSGIKTLK 653

Query: 167 AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYD 226
              +   EN GRD+ PF++    E LS Y+ +  IH KKS +          WRR+L + 
Sbjct: 654 KLVVRETENKGRDIYPFIVEFGAELLS-YELILHIHSKKSPQALS-----KGWRRFLLHY 707

Query: 227 LLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITF 286
            LG   +  +I+ +FD    +G++    +    +      + G NRE++     R+G ++
Sbjct: 708 TLGTESITTQILNSFDNDPKLGVLFPAYFYGVTRQP----NWGGNREIVKQQLARLGFSY 763

Query: 287 QDQK-LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKA 345
                 D+ AG+ FW R++AL P+ N         +     DG + H  ER F       
Sbjct: 764 DMTYCPDYPAGSFFWSRSDALRPLLNGEYRLEDFDEEAGQYDGTLAHGFERLFGTIPLLQ 823

Query: 346 NFRI 349
           N+  
Sbjct: 824 NYST 827


>gi|261868364|ref|YP_003256286.1| lipopolysaccharide biosynthesis protein [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|3132260|dbj|BAA28137.1| unnamed protein product [Actinobacillus actinomycetemcomitans]
 gi|261413696|gb|ACX83067.1| lipopolysaccharide biosynthesis protein [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 632

 Score =  249 bits (635), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 74/400 (18%), Positives = 141/400 (35%), Gaps = 48/400 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRS-KKLCYDENYVVAYGS 65
           S  +  +  +    N Y+D   + +      F        Y        +  NY      
Sbjct: 154 SYEFQDYWKNMPMINSYTDSVLMHESKFTDYFL--SKGYSYSVYISSDNFPVNYPTFLSI 211

Query: 66  R---SGKKFFAQSNLYMME-------------RELHFDGQRIHHFPQLLHGWESPAMGK- 108
                 +    +   +  +                + +    +    +          K 
Sbjct: 212 EETLKHRCPILKRRPFFHDPIYHDVECLFLRRSIEYVENNTTYDTSLIFKNILRTTKPKD 271

Query: 109 ---------------VMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE 153
                          V ++    KI +V H+YY D+  EI +   N+  S+DL +T   E
Sbjct: 272 LATNLTLLKVFDSSKVEKVRSDIKILVVAHIYYSDMLDEIISYTQNIPCSYDLLITTANE 331

Query: 154 SASIKSE---ILKIF--PAARIHIME-NHGRDVLPFLILLETEQLS-NYDYVCKIHGKKS 206
            + ++ E   ILK+       + ++E N GRD+    I  + E +S  YD+VC++H KKS
Sbjct: 332 KSKLEIESNPILKMSGAKGINVKVVEQNRGRDMSSLFITCKQEIISERYDWVCRLHSKKS 391

Query: 207 KRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTC 266
            +  ++      ++  ++ ++L     + K+I   D ++ IG          +       
Sbjct: 392 PQNSHNMS--IHFKEMMYLNILKDKAYISKVINYLDKNKSIGFAMPSMVHIGH--PTLGH 447

Query: 267 SLGKNREMICTLAGRMGITFQDQKLDFFA--GTMFWVRTEALDPIKNLRLSRYFEPKVHK 324
           +   NR++   +A R+GI      +  FA  GTMFW R EAL  +           K   
Sbjct: 448 AWFTNRDLAIKIAERVGIKLPFDDISPFAAYGTMFWFRPEALKKLFEYNWKFEDFNKEPM 507

Query: 325 ALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRKSLSQ 364
             D  + H +ER    +   A +   ++        + ++
Sbjct: 508 HQDSSLAHILERLLVYAAHDAGYLACNIMSAEMMELNYTK 547


>gi|77747764|ref|NP_636021.2| hypothetical protein XCC0629 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|77761299|ref|YP_244667.2| hypothetical protein XC_3605 [Xanthomonas campestris pv. campestris
           str. 8004]
          Length = 546

 Score =  248 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 74/276 (26%), Positives = 118/276 (42%), Gaps = 17/276 (6%)

Query: 96  QLLHGW---ESPAMGKVMQIAI---KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
           +L + W      A+ +   +A         +V+H +Y+D+  E+ + +        + +T
Sbjct: 271 RLGYAWLDATRQALTRAPDVATEICSPSACVVLHAWYLDVLDEMLDAIVECGTPLRIIIT 330

Query: 150 LV-TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
              T+   +   I +    A +   EN GRD+LPFL +       N   V K+H KKS  
Sbjct: 331 TDLTKVIEVTKCIQRRGIQAEVEGFENRGRDILPFLHVANRLLDENVQLVLKLHTKKST- 389

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
                 +G+ WR  +   LLG P  V  I+  F T    G+     +  P      T  +
Sbjct: 390 ---HRDDGNAWRGEMLTALLG-PQRVDAIVNAFSTDPLAGLAAPEDHLLP-----VTEFI 440

Query: 269 GKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDG 328
           G N + +  L  R G    D    F +G+MFW R EAL P+ +  L           +DG
Sbjct: 441 GGNADALDYLTVRTGSDAPDTNSLFASGSMFWARLEALRPLLDAHLHASEFESEQGQIDG 500

Query: 329 EIEHAVERCFSLSVKKANFRISDVDCILGYRKSLSQ 364
            + HA+ER   L+V  +  R++ V+  LG  K+ S 
Sbjct: 501 TLAHAIERFVGLAVTHSGHRVTTVEQTLGITKTPSA 536


>gi|220924211|ref|YP_002499513.1| Lipopolysaccharide biosynthesis protein-like protein
           [Methylobacterium nodulans ORS 2060]
 gi|219948818|gb|ACL59210.1| Lipopolysaccharide biosynthesis protein-like protein
           [Methylobacterium nodulans ORS 2060]
          Length = 1366

 Score =  248 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 64/246 (26%), Positives = 112/246 (45%), Gaps = 14/246 (5%)

Query: 111 QIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILK---IFPA 167
            + +  ++A++ H++Y D   E++  L+ +    DL ++  TE    +            
Sbjct: 696 GLELPERVAVIAHVFYTDFCSELSAYLARIPTQADLFISTDTEDKRQQIAFALQSYNMGK 755

Query: 168 ARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDL 227
             + +M N GRD+ P L+    +  ++Y+Y   IH KKS            WR +L  +L
Sbjct: 756 LTVRVMPNIGRDIAPMLVGF-DDVFNSYEYFLHIHSKKSPHDPAFG----SWREFLLENL 810

Query: 228 LGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGIT-F 286
           LG+  ++  I+     H   G++ S+ +        +  + G N E +  L GR GI   
Sbjct: 811 LGSEDIIRSILYLLHAH-KTGIVFSQHFE----PVRHLLNFGYNFETMKGLLGRCGIKIS 865

Query: 287 QDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKAN 346
            D  L+F + + FW R+ AL P+ +L L           +DG + HA+ER     V+K+ 
Sbjct: 866 NDLVLEFPSSSFFWGRSSALKPLLDLNLDWSDFAAEAGQIDGTLAHAIERSVLYIVEKSG 925

Query: 347 FRISDV 352
           FR + V
Sbjct: 926 FRWAKV 931


>gi|188993121|ref|YP_001905131.1| conserved protein involved in carbohydrate biosynthesis
           [Xanthomonas campestris pv. campestris str. B100]
 gi|189030067|sp|B0RVK2|WXCX_XANCB RecName: Full=Uncharacterized protein wxcX
 gi|167734881|emb|CAP53093.1| conserved protein involved in carbohydrate biosynthesis
           [Xanthomonas campestris pv. campestris]
          Length = 695

 Score =  247 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 74/276 (26%), Positives = 119/276 (43%), Gaps = 17/276 (6%)

Query: 96  QLLHGW---ESPAMGKVMQIAI---KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
           +L + W      A+ +   +A         +V+H +Y+D+  E+ + +        + +T
Sbjct: 420 RLGYAWLDATRQALTRAPDVATEICSPSACVVLHAWYLDVLDEMLDAIVECGTPLRIIIT 479

Query: 150 LV-TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
              T+   +   I +    A +   EN GRD+LPFL +       N   V K+H KKS  
Sbjct: 480 TDLTKVIEVTKCIQRRGIQAEVEGFENRGRDILPFLHVANRLLDENVQLVLKLHTKKST- 538

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
                 +G+ WR  +   LLG P  V  I+  F T   +G+     +  P      T  +
Sbjct: 539 ---HRDDGNAWRGEMLTALLG-PQRVDAIVNAFSTDPLVGLAAPEDHLLP-----VTEFI 589

Query: 269 GKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDG 328
           G N + +  L  R G    D    F +G+MFW R EAL P+ +  L           +DG
Sbjct: 590 GGNADALDYLTVRTGSDAPDTNSLFASGSMFWARLEALRPLLDAHLHASEFESEQGQIDG 649

Query: 329 EIEHAVERCFSLSVKKANFRISDVDCILGYRKSLSQ 364
            + HA+ER   L+V  +  R++ V+  LG  K+ S 
Sbjct: 650 TLAHAIERFVGLAVTHSGHRVTTVEQTLGITKTPSA 685


>gi|269219069|ref|ZP_06162923.1| glycosyl transferase, group 2 family [Actinomyces sp. oral taxon
           848 str. F0332]
 gi|269211216|gb|EEZ77556.1| glycosyl transferase, group 2 family [Actinomyces sp. oral taxon
           848 str. F0332]
          Length = 687

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 62/243 (25%), Positives = 115/243 (47%), Gaps = 9/243 (3%)

Query: 112 IAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIH 171
           IA  ++IA+V+H +Y DL  E+ + L NL   FDL VT  + +     + L+    + + 
Sbjct: 71  IADPSRIAVVIHCFYADLMPELFDRLRNLPTDFDLFVTNASGADVAVPKDLERMRHSVVV 130

Query: 172 IMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYS---WWEGDLWRRWLFYDLL 228
            +ENHGRD+ P + L+ +  L  YD + K+H KKS  +         G  W+     DL+
Sbjct: 131 EVENHGRDIFPTVQLVNSGILDPYDLILKLHTKKSPWREEHADLDGSGAAWKDQFLSDLV 190

Query: 229 GAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQD 288
           G+   V +I+  F     +G++ +       ++       G ++ ++  L  R+ ++   
Sbjct: 191 GSREKVEEILNAFAADPTLGLVTAADSIVGKEF------WGGDQRIVEQLMLRIEMSIDP 244

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
            +L+F +G+M+W R   L  ++   L+     +    +D    HA+ER   +   +A  R
Sbjct: 245 DELEFASGSMYWTRAFVLQGLRAFNLTSADFDEEKGQVDATTAHAIERIVGIVTDEAGLR 304

Query: 349 ISD 351
             +
Sbjct: 305 TVE 307


>gi|323138318|ref|ZP_08073389.1| Rhamnan synthesis F [Methylocystis sp. ATCC 49242]
 gi|322396401|gb|EFX98931.1| Rhamnan synthesis F [Methylocystis sp. ATCC 49242]
          Length = 754

 Score =  247 bits (630), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 61/247 (24%), Positives = 114/247 (46%), Gaps = 13/247 (5%)

Query: 110 MQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT-ESASIKSEILKIFPA- 167
             I +   +A +VH +Y DL   I   L N+  + DL+++  + E A I  ++++ +   
Sbjct: 363 PDINMDKPVAAIVHAFYPDLLEHILGYLENIPCAVDLYISTDSAEKAEIIGKVVRNWSKG 422

Query: 168 -ARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYD 226
              + IMEN GRD+ P ++       + +D    +H K+S   G   +    WR +L   
Sbjct: 423 STDVRIMENRGRDIAPMIVGFRD-VFAKHDIFLHVHTKRSPHAGDLLY---HWRDYLLNT 478

Query: 227 LLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITF 286
           L G   +   ++  F     IG++  + +    +      + G + ++   L  R+G+  
Sbjct: 479 LFGTGDIARSVLSLF-NDPKIGVVFPQHFFEVRR----MLNWGFDYDLARNLLARVGVQL 533

Query: 287 Q-DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKA 345
             D  L+F +G+MFW RT+A+ P+ +L L     P+    +DG + HA+ER   +  +  
Sbjct: 534 NKDLVLEFPSGSMFWGRTDAIRPLLDLDLQFSDFPEEAGQIDGTLAHAIERTLLMVAESK 593

Query: 346 NFRISDV 352
            +    V
Sbjct: 594 GYEWFKV 600


>gi|189030068|sp|P0C7J1|WXCX_XANCP RecName: Full=Uncharacterized protein wxcX
          Length = 695

 Score =  247 bits (630), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 74/276 (26%), Positives = 118/276 (42%), Gaps = 17/276 (6%)

Query: 96  QLLHGW---ESPAMGKVMQIAI---KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
           +L + W      A+ +   +A         +V+H +Y+D+  E+ + +        + +T
Sbjct: 420 RLGYAWLDATRQALTRAPDVATEICSPSACVVLHAWYLDVLDEMLDAIVECGTPLRIIIT 479

Query: 150 LV-TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
              T+   +   I +    A +   EN GRD+LPFL +       N   V K+H KKS  
Sbjct: 480 TDLTKVIEVTKCIQRRGIQAEVEGFENRGRDILPFLHVANRLLDENVQLVLKLHTKKST- 538

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
                 +G+ WR  +   LLG P  V  I+  F T    G+     +  P      T  +
Sbjct: 539 ---HRDDGNAWRGEMLTALLG-PQRVDAIVNAFSTDPLAGLAAPEDHLLP-----VTEFI 589

Query: 269 GKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDG 328
           G N + +  L  R G    D    F +G+MFW R EAL P+ +  L           +DG
Sbjct: 590 GGNADALDYLTVRTGSDAPDTNSLFASGSMFWARLEALRPLLDAHLHASEFESEQGQIDG 649

Query: 329 EIEHAVERCFSLSVKKANFRISDVDCILGYRKSLSQ 364
            + HA+ER   L+V  +  R++ V+  LG  K+ S 
Sbjct: 650 TLAHAIERFVGLAVTHSGHRVTTVEQTLGITKTPSA 685


>gi|190572676|ref|YP_001970521.1| putative glycosyltransferase, fusion protein [Stenotrophomonas
           maltophilia K279a]
 gi|190010598|emb|CAQ44207.1| putative glycosyltransferase, fusion protein [Stenotrophomonas
           maltophilia K279a]
          Length = 566

 Score =  246 bits (629), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 81/253 (32%), Positives = 117/253 (46%), Gaps = 11/253 (4%)

Query: 102 ESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT--ESASIKS 159
           +   +G +    +K++ AIV+HLY++DL   I   + N+ +  DL V++ +  +      
Sbjct: 301 QRYGVGAIPADKLKSRFAIVLHLYHLDLIESIQGYMKNMIVDHDLFVSVKSVADRRVAVR 360

Query: 160 EILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLW 219
              +    A + +  N GRDV PF+ LL T  L  YD VCKIH KKS         G  W
Sbjct: 361 FFEERKVRAFVFVHPNIGRDVGPFVSLLNTGLLDRYDAVCKIHSKKSVYHDG----GGQW 416

Query: 220 RRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLA 279
           R  L   LLG+   V KI+R F      G++G       + Y       G N E +  LA
Sbjct: 417 RDELMKSLLGSSHTVLKILRAFRHDSSCGIVGPE-----HAYVSNARFWGGNEERLRRLA 471

Query: 280 GRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFS 339
              GI     +L FFAGTMFW R  AL  ++   L+          LD  + H +ER F 
Sbjct: 472 AETGIDDARIRLGFFAGTMFWFRPAALYALRERALALSEFDPEAGQLDATLAHVIERLFV 531

Query: 340 LSVKKANFRISDV 352
           L V++A +  +  
Sbjct: 532 LWVEQAGYFAATT 544


>gi|297538440|ref|YP_003674209.1| Rhamnan synthesis F [Methylotenera sp. 301]
 gi|297257787|gb|ADI29632.1| Rhamnan synthesis F [Methylotenera sp. 301]
          Length = 782

 Score =  246 bits (628), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 72/256 (28%), Positives = 114/256 (44%), Gaps = 17/256 (6%)

Query: 103 SPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEIL 162
            P   +V        +A++ HL+Y  +  +    LSN+  +FD+++T  TE    K+ I 
Sbjct: 497 VPFSYQVESPQNNPSLAVICHLFYHQMCEDYKVYLSNIPFNFDIYITTDTEDK--KAYIE 554

Query: 163 KIFP-----AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGD 217
           K F         + +  N GRD+ P LI       S Y+Y+  IH K S           
Sbjct: 555 KSFSGWQRGKVEVRLAVNQGRDIAPKLIACRDIY-SAYEYILHIHSKNSPYSSIH----T 609

Query: 218 LWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICT 277
            WR ++   LLG+   V  I   F  + ++G+I  + ++             +N ++   
Sbjct: 610 GWRDYILDTLLGSQKTVSSIFEAFQLNSNLGIIAPQHFKALK----LDIGWDRNFKIAKK 665

Query: 278 LAGRMGITFQDQ-KLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVER 336
           LAGRMG     +  +DF +G+MFW R+ AL P+ N  LS    P+     DG   H++ER
Sbjct: 666 LAGRMGFDISRKAPIDFPSGSMFWARSAALLPLLNCSLSLQDFPREDGQKDGTTAHSIER 725

Query: 337 CFSLSVKKANFRISDV 352
            +    +KA F    V
Sbjct: 726 LYFFICEKAGFSWIKV 741


>gi|219670466|ref|YP_002460901.1| Rhamnan synthesis F [Desulfitobacterium hafniense DCB-2]
 gi|219540726|gb|ACL22465.1| Rhamnan synthesis F [Desulfitobacterium hafniense DCB-2]
          Length = 606

 Score =  245 bits (627), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 67/391 (17%), Positives = 121/391 (30%), Gaps = 42/391 (10%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYV--VAYG 64
           S  + L+  +        +   + +      F    +T          Y +  +      
Sbjct: 148 SDVWKLYWENLCPVYSREECILLHETKFTQYFADKGFTYDVYCHNTPDYIDLTIEAPDKL 207

Query: 65  SRSGKKFFAQSNLYMMERELHFD------GQRIHHFPQLLHGWES--------------- 103
               +    +   +  E             +R+  + Q    +++               
Sbjct: 208 VIDQRCPIIKRKAFCAEYNRFLSYHRGSASKRVFDYIQKNDLYDTNIILDDLLATQHYAF 267

Query: 104 -----------PAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT 152
                      P+   V  +  + K+ +  H+YY DL     + + ++    D+ +T   
Sbjct: 268 IKNCLHLNYFLPSDYVVKPLKRQPKVVVCFHVYYEDLLDSCFHYMQSIPQFADIVITTPK 327

Query: 153 ESA--SIKSEILKI-FPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRK 209
           +     I+ +I         I ++   GR    FL+  +   L  YDY C +H KKS   
Sbjct: 328 KELVGIIEEKIKSYELNNTTIKVINARGRAESAFLVATKDFILD-YDYACIVHDKKSSFL 386

Query: 210 GYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLG 269
                 G  +       LL     V  I+  F+ +  IG +      + N    Y    G
Sbjct: 387 RP-GCVGVEFGLQNLDALLATSAYVENILSIFEDNPRIGALEPVHLLHANFRDLYGGEWG 445

Query: 270 KNREMICTLAGRMGIT---FQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKAL 326
            N +       R GI      D       G MFW R   +  I ++       P+    L
Sbjct: 446 ANYKGTEEFLKRAGIDLLISPDVPPLAPMGAMFWFRPICMKRILDMEWEYEDFPEEPLPL 505

Query: 327 DGEIEHAVERCFSLSVKKANFRISDVDCILG 357
           DG + H +ER +   V+ A +    V  I  
Sbjct: 506 DGSLIHIIERAYPFIVQDAGYLTGWVSTIED 536


>gi|299133415|ref|ZP_07026610.1| Rhamnan synthesis F [Afipia sp. 1NLS2]
 gi|298593552|gb|EFI53752.1| Rhamnan synthesis F [Afipia sp. 1NLS2]
          Length = 408

 Score =  245 bits (625), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 87/236 (36%), Positives = 132/236 (55%), Gaps = 5/236 (2%)

Query: 104 PAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILK 163
           P   K +Q+  +    I+VHL+Y D+W +    L NL+  F L VTL   +    + +  
Sbjct: 153 PGAPKPLQLNGRIATGIIVHLHYCDVWPDFEKRLRNLTCPFSLIVTLNESNPDFAARVAG 212

Query: 164 IFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWL 223
            FP A++ +  N GRDV PF+ LL    L +++ +CK+HGKK+   G     G++WRR L
Sbjct: 213 QFPNAKVLVYPNRGRDVGPFIQLLREGHLDDFELICKLHGKKTVSLGPRMIFGEIWRRLL 272

Query: 224 FYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMG 283
             DL+G+  +V  I++ F +   +G++GS  +R      +Y  +  +N  +   LA R+G
Sbjct: 273 LNDLVGSDELVRAILQRFISQPGLGLVGSSHFR-----GNYLGTWPRNAALTLELAKRLG 327

Query: 284 ITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFS 339
              +  KLDFFAGTMFWVR E LD +K+L LS+   P      DG ++HA+ER F 
Sbjct: 328 CPEERFKLDFFAGTMFWVRRELLDLLKSLNLSQDDFPVEAGQTDGTLQHALERIFG 383


>gi|78213552|ref|YP_382331.1| lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9605]
 gi|78198011|gb|ABB35776.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9605]
          Length = 1162

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 54/236 (22%), Positives = 96/236 (40%), Gaps = 14/236 (5%)

Query: 114 IKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPA---ARI 170
           I  K+ I +H++Y +L   IA  L N+  S D+ ++   +S +   +I           +
Sbjct: 201 INKKVGIFLHIFYPELGETIAAYLKNIPCSIDVFISTREDSVAALEKIFARVENTQKIEV 260

Query: 171 HIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGA 230
               N GRDV PF++    + L NYDY+ K+H KKS            W      +L+G+
Sbjct: 261 RHFSNIGRDVAPFIVGFRDQIL-NYDYILKLHSKKSP----HSNALSGWFLHCLDNLIGS 315

Query: 231 PGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLG---KNREMICTLAGRMGI--T 285
             +    ++      ++G++        +    +    G    N         R  +   
Sbjct: 316 EAITATNLKAL-QSPEVGIVYPIENYALSLGIQHDSCWGHEDGNYAKARPFLNRYNLRQI 374

Query: 286 FQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLS 341
            ++ +  F  GTMFW +   L  I +  L+     +    +DG I H++ER   +S
Sbjct: 375 KRESQFQFPTGTMFWCKPAVLQSILDWGLNWNNFDEEGGQIDGTIAHSIERLIGIS 430


>gi|160936495|ref|ZP_02083863.1| hypothetical protein CLOBOL_01386 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440580|gb|EDP18318.1| hypothetical protein CLOBOL_01386 [Clostridium bolteae ATCC
           BAA-613]
          Length = 674

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 64/250 (25%), Positives = 107/250 (42%), Gaps = 15/250 (6%)

Query: 114 IKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFP-----AA 168
              KIA+V HL+Y DL  E    L N+  + DL++T+   +   K ++   F        
Sbjct: 289 RNKKIAVVAHLFYPDLMDETLRYLQNIQENIDLYITV--ANIETKYKVYNYFESIRRSNV 346

Query: 169 RIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLL 228
           ++ +  N GRD    L+    E L  Y+Y+C +H KK+ R G     G  +    + + L
Sbjct: 347 KVLLSGNRGRDAGSLLVACR-EYLMQYEYLCFVHDKKTTRGGGPVTVGKAFMYHAWENTL 405

Query: 229 GAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK-----YCDYTCSLGKNREMICTLAGRMG 283
            + G V  II+ F+ +  +G++                 ++TC   K +E+   L+  + 
Sbjct: 406 RSGGFVSSIIKLFEKNDRLGILTPPVPALGGYLTELVGNEWTCCYQKTKELAEILS--LK 463

Query: 284 ITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVK 343
           +    QK  F   T FW R  AL P+          P+   A DG + HA+ER      +
Sbjct: 464 VPMSPQKQPFALATAFWCRPAALKPLFEYPWRYEDFPEEPLASDGTLNHAIERIIIYVAQ 523

Query: 344 KANFRISDVD 353
              +  + V+
Sbjct: 524 SEGYYTAMVE 533


>gi|225350704|ref|YP_002720664.1| putative glycosyl transferase, group 1 [Brachyspira hyodysenteriae
           WA1]
 gi|225216388|gb|ACN85121.1| putative glycosyl transferase, group 1 [Brachyspira hyodysenteriae
           WA1]
          Length = 342

 Score =  243 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 68/245 (27%), Positives = 105/245 (42%), Gaps = 10/245 (4%)

Query: 110 MQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV-TESASIKSEILKIFP-- 166
            +   K KI I +HLYYID+       L +  I FDL +T    E+  I        P  
Sbjct: 19  TEEIKKLKIGIHIHLYYIDMMDMFIKYLKDSPIEFDLFITTSKEENKDICLNAFNKLPKL 78

Query: 167 -AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFY 225
               I I+EN GRD+ P+LI     Q +NYD  C +H KKS      W   + W  +L  
Sbjct: 79  KNITIFIVENIGRDIAPWLIECNNIQ-NNYDLFCHLHTKKSL----HWESINEWGEYLIE 133

Query: 226 DLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGIT 285
           +L+ +   +  I+  F    +IG+I    Y Y   Y  Y      +   +      +   
Sbjct: 134 NLI-SEEAINNILSNFILDNNIGIISPHIYYYLFPYILYIDKDDMHHIKLLLNKLNINFE 192

Query: 286 FQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKA 345
            + +   F  G+M W R + L P+ +L L     P+      G I HA+ER   +  +++
Sbjct: 193 PKPENFVFPVGSMLWYRPKVLKPLFDLNLKYSDFPQEPIPKTGTIAHAIERIIGIICEQS 252

Query: 346 NFRIS 350
           N++  
Sbjct: 253 NYKFK 257


>gi|218455303|gb|AAX19606.2| WxocB [Xanthomonas oryzae pv. oryzicola]
          Length = 568

 Score =  242 bits (619), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 87/284 (30%), Positives = 135/284 (47%), Gaps = 19/284 (6%)

Query: 79  MMERELHFDGQRIHHFPQLLHGWESPAMGKVMQI--------AIKAKIAIVVHLYYIDLW 130
           M+ERE+    Q   +   ++ G +SPA  ++ +         ++ ++ AIV+HL++IDL 
Sbjct: 272 MIEREVARMRQTRKNIMPIVTGDDSPASDELERYGVGAIDAESLSSRFAIVLHLFHIDLI 331

Query: 131 IEIANLLSNLSISFDLHVTL--VTESASIKSEILKIFPAARIHIMENHGRDVLPFLILLE 188
             I   + N+ + +D+ V++  +++         +    A + I  N GRDV PF+ LL 
Sbjct: 332 DAICAYMRNVIVDYDVFVSVKSISDRRMAVRYFQEHKIRASVFIHPNIGRDVGPFISLLN 391

Query: 189 TEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIG 248
           T  L  YD VCKIH KKS  +      G  WR  L   LLG+   V +++R FD H   G
Sbjct: 392 TGLLDRYDAVCKIHSKKSVYRDG----GGQWRDDLMKALLGSSFDVLRVLRAFDDHPACG 447

Query: 249 MIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDP 308
           ++G       + Y       G N E +  LA   GI  +  +L FFAGTMFW R  AL  
Sbjct: 448 IVGPE-----SAYLSNARFWGGNEERLRVLAAETGIEEKRIRLGFFAGTMFWFRPAALSA 502

Query: 309 IKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDV 352
           ++   +            D  + H +ER F L V++A F  +  
Sbjct: 503 LRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGFFAATT 546


>gi|260434430|ref|ZP_05788400.1| glycosyltransferase [Synechococcus sp. WH 8109]
 gi|260412304|gb|EEX05600.1| glycosyltransferase [Synechococcus sp. WH 8109]
          Length = 772

 Score =  242 bits (619), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 63/300 (21%), Positives = 110/300 (36%), Gaps = 27/300 (9%)

Query: 69  KKFFAQSNLYMMERELHFDG---QRIHHFPQLLHG---WESPAMGKVMQI--AIKAKIAI 120
           +K F   +  +       +      + H+         W +  +     +   I  K+ +
Sbjct: 479 RKPFPSFHPGIYRERAMSETNKQDPLIHYINNGEPEGPWNTKLIIPTEDVLMNIDEKVGL 538

Query: 121 VVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPA-----ARIHIMEN 175
            +H++Y +L  EI   +S   I  +++++    + +I+   +K          +I +  N
Sbjct: 539 HIHVHYPELLDEILKAISMNKIRPEIYISCT--NQAIRDLAIKNINEHGLILKKIILTPN 596

Query: 176 HGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPG--V 233
            GRD+ P L  L  E    Y     IH KKS            WR +L  +L+G     +
Sbjct: 597 RGRDIGPLLTCLGQELDEKYRIYGHIHTKKSIHIARHQSY--SWRTFLIENLIGNEENHM 654

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDF 293
           +  II      + IG+        P            N      LA ++ I     + +F
Sbjct: 655 MDCIISAMIKDKTIGLAFPSDPHCP--------GWDANYRQAKLLAEKLNIKSLTNEFNF 706

Query: 294 FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVD 353
             GTMFW R  AL P+ +L L     P      DG + H++ER      +   F  +  +
Sbjct: 707 PIGTMFWARKNALSPLYSLNLGWDDYPSEPIGYDGTLLHSIERLIPFVAESQGFSYTMTN 766


>gi|227875198|ref|ZP_03993340.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Mobiluncus mulieris
           ATCC 35243]
 gi|227844103|gb|EEJ54270.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Mobiluncus mulieris
           ATCC 35243]
          Length = 613

 Score =  242 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 87/390 (22%), Positives = 143/390 (36%), Gaps = 51/390 (13%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF--FFWFWTLFYKRSKKLCYDENYVVAYG 64
           S  +  + +     N Y+D     +      F    W + + +       Y   + +   
Sbjct: 154 STDFRQYWATMPPINSYTDSVVHHESRFTKHFADLGWRYEVAWPAEN---YPAVHPIFDN 210

Query: 65  SRS---GKKFFAQSNLYMMERELHFDGQRIHH-----------FPQLLHGWESPAMGK-- 108
           +           +  L+  +  L+ D Q I             +P+ L         K  
Sbjct: 211 AALMLADGCPILKRRLFFHD-PLYLDKQAIIGADIMREVRRAGYPEELIWQNVSHNAKPR 269

Query: 109 -------------------VMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
                              V+    K +IA V H++Y D+  EI    S L     + +T
Sbjct: 270 VLSTNFNLTQVLDDNAEESVLAANAKLRIAGVAHVFYADMTAEIMKRFSYLGDHAQIFLT 329

Query: 150 L--VTESASIKSEILKIFPAARIHIME-NHGRDVLPFLILLETEQLSN-YDYVCKIHGKK 205
                +   I+ ++  +   A + I+E N GRDV  FL+          +D V KIH KK
Sbjct: 330 TSTPEKKTQIEQQLQTMGRQAEVRIVESNRGRDVSAFLVTCADVLEPGCFDVVAKIHSKK 389

Query: 206 SKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYT 265
           S +  Y+    +L++R LF +LL +PG    ++  F T   +GM+   A      Y    
Sbjct: 390 SAQDAYNAA--ELFKRHLFENLLPSPGYTANLLHLFATEPYLGMVFPPAVSLG--YPTLG 445

Query: 266 CSLGKNREMICTLAGRMGI--TFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVH 323
            +   N++    L  R+GI   F D       G+MF+ R EAL P+     +    P+  
Sbjct: 446 HAWFANKKPALALCERLGIKLPFDDTTPLSPYGSMFFARPEALLPLTKAHFTFNDFPEEG 505

Query: 324 KALDGEIEHAVERCFSLSVKKANFRISDVD 353
           +  DG + H +ER FS S          V 
Sbjct: 506 QYSDGSLAHVIERIFSYSSLSEGLICKSVM 535


>gi|21109952|gb|AAM38419.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 296

 Score =  242 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 69/241 (28%), Positives = 113/241 (46%), Gaps = 11/241 (4%)

Query: 119 AIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV-TESASIKSEILKIFPAARIHIMENHG 177
            +V+H +Y+D+  E  + +++  +S  L VT   T    ++  + +    A++   EN G
Sbjct: 50  CVVLHAWYLDVLDEALDAIADCGLSLRLVVTTDITMVEQVRQRLQQRGVQAQVDGFENRG 109

Query: 178 RDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKI 237
           RD+LPFL +           V K+H KKS        +GD WRR +F  LL  P     I
Sbjct: 110 RDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDAWRREMFSALL-TPQHADAI 164

Query: 238 IRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGT 297
           +R F     +G+     +  P      T  +G N + +  LA R G    D+   F +G+
Sbjct: 165 MRGFTDDPLLGLAAPAQHLLP-----VTDFIGGNADALDYLAVRTGTDAIDEHSVFASGS 219

Query: 298 MFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILG 357
           MFWV+ EAL P+ +  L           +DG + HA+ER  +++V      ++ +D +LG
Sbjct: 220 MFWVKLEALRPLLDANLHPSEFENEQGQIDGTLAHAIERFLAVAVSHCGHHVATIDQLLG 279

Query: 358 Y 358
            
Sbjct: 280 I 280


>gi|259414984|ref|ZP_05738907.1| glycosyl transferase, group 1 [Silicibacter sp. TrichCH4B]
 gi|259349435|gb|EEW61182.1| glycosyl transferase, group 1 [Silicibacter sp. TrichCH4B]
          Length = 680

 Score =  242 bits (618), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 79/311 (25%), Positives = 131/311 (42%), Gaps = 31/311 (9%)

Query: 71  FFAQSNLYMMERELHFDGQRIHHFPQLLHGWES-------------PAMGKVMQIAIKAK 117
            + + N  + +       +   HF +     +               A+  +    I   
Sbjct: 17  AYLRHNHDVAKSG----QRPFEHFLRAGRHEQRVTREHSATIAESGSAVAPLRGAGINQN 72

Query: 118 I-AIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT---ESASIKSEILKIFPAARIHIM 173
           + A+V+HLYY DLW E  + L +   +FDL+VTL     E+   ++ I + +P AR+ ++
Sbjct: 73  LQAVVIHLYYTDLWDEFRDRLRSARFTFDLYVTLTEQGPETEETRARIAEDWPEARVLVL 132

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            N GRD+ PFL LL    L +Y  VCK+H KKS        +GD+WR  L   +L   G 
Sbjct: 133 PNRGRDIYPFLHLLNAGWLDHYRAVCKLHSKKSP----HRQDGDVWRTHLTEGIL-PEGE 187

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDF 293
             +++  F    D G+  +    Y     +     G N E    L  R+ +      LDF
Sbjct: 188 TAELLERFLAAEDCGLWVADGQHY-----EGARWWGSNLERCRNLLARLELAASADTLDF 242

Query: 294 FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVD 353
            AG+++W++   LD ++ L L            DG + HA+ER   +       +I    
Sbjct: 243 PAGSIYWLKPAILDMLRGLALGFDDFDIEQGQTDGTLAHALERALGMICAAGGLQILQTT 302

Query: 354 CILGYRKSLSQ 364
            +   + + S 
Sbjct: 303 QLRDLQPAPSS 313


>gi|269978088|ref|ZP_06185038.1| lipopolysaccharide biosynthesis protein [Mobiluncus mulieris 28-1]
 gi|306818459|ref|ZP_07452182.1| rhamnan synthesis protein F [Mobiluncus mulieris ATCC 35239]
 gi|307700705|ref|ZP_07637730.1| rhamnan synthesis protein F [Mobiluncus mulieris FB024-16]
 gi|269933597|gb|EEZ90181.1| lipopolysaccharide biosynthesis protein [Mobiluncus mulieris 28-1]
 gi|304648632|gb|EFM45934.1| rhamnan synthesis protein F [Mobiluncus mulieris ATCC 35239]
 gi|307613700|gb|EFN92944.1| rhamnan synthesis protein F [Mobiluncus mulieris FB024-16]
          Length = 613

 Score =  242 bits (618), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 87/390 (22%), Positives = 143/390 (36%), Gaps = 51/390 (13%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF--FFWFWTLFYKRSKKLCYDENYVVAYG 64
           S  +  + +     N Y+D     +      F    W + + +       Y   + +   
Sbjct: 154 STDFRQYWATMPPINSYTDSVVHHESRFTKHFADLGWRYEVAWPAEN---YPAVHPIFDN 210

Query: 65  SRS---GKKFFAQSNLYMMERELHFDGQRIHH-----------FPQLLHGWESPAMGK-- 108
           +           +  L+  +  L+ D Q I             +P+ L         K  
Sbjct: 211 AALMLADGCPILKRRLFFHD-PLYLDKQAIIGADIMREVRRAGYPEELIWQNVSHNAKPR 269

Query: 109 -------------------VMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
                              V+    K +IA V H++Y D+  EI    S L     + +T
Sbjct: 270 VLSTNFNLTQVLDDNAEESVLAANAKLRIAGVAHVFYADMTAEIMKRFSYLGDHAQIFLT 329

Query: 150 L--VTESASIKSEILKIFPAARIHIME-NHGRDVLPFLILLETEQLSN-YDYVCKIHGKK 205
                +   I+ ++  +   A + I+E N GRDV  FL+          +D V KIH KK
Sbjct: 330 TSTPEKKTQIEQQLQTMGRQAEVRIVESNRGRDVSAFLVTCADVLEPGRFDVVAKIHSKK 389

Query: 206 SKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYT 265
           S +  Y+    +L++R LF +LL +PG    ++  F T   +GM+   A      Y    
Sbjct: 390 SAQDAYNAA--ELFKRHLFENLLPSPGYTANLLHLFATEPYLGMVFPPAVSLG--YPTLG 445

Query: 266 CSLGKNREMICTLAGRMGI--TFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVH 323
            +   N++    L  R+GI   F D       G+MF+ R EAL P+     +    P+  
Sbjct: 446 HAWFANKKPALALCERLGIKLPFDDTTPLSPYGSMFFARPEALLPLTKAHFTFNDFPEEG 505

Query: 324 KALDGEIEHAVERCFSLSVKKANFRISDVD 353
           +  DG + H +ER FS S          V 
Sbjct: 506 QYSDGSLAHVIERIFSYSSLSEGLICKSVM 535


>gi|166713474|ref|ZP_02244681.1| hypothetical protein Xoryp_19045 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 568

 Score =  242 bits (617), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 87/284 (30%), Positives = 134/284 (47%), Gaps = 19/284 (6%)

Query: 79  MMERELHFDGQRIHHFPQLLHGWESPAMGKVMQI--------AIKAKIAIVVHLYYIDLW 130
           M+ERE+    Q   +   ++ G +SPA  ++ +         ++ ++ AIV+HL++IDL 
Sbjct: 272 MIEREVARMRQTRKNIMPIVTGDDSPASDELERYGVGAIDAESLSSRFAIVLHLFHIDLI 331

Query: 131 IEIANLLSNLSISFDLHVTL--VTESASIKSEILKIFPAARIHIMENHGRDVLPFLILLE 188
             I   + N+ + +D+ V++  +++         +    A + I  N GRDV PF+ LL 
Sbjct: 332 DAICAYMRNVIVDYDVFVSVKSISDRRMAVRYFQEHKIRASVFIHPNIGRDVGPFISLLN 391

Query: 189 TEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIG 248
           T  L  YD VCKIH KKS         G  WR  L   LLG+   V +++R FD H   G
Sbjct: 392 TGLLDRYDAVCKIHSKKSVYHDG----GGQWRDDLMKALLGSSFDVLRVLRAFDDHPACG 447

Query: 249 MIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDP 308
           ++G       + Y       G N E +  LA   GI  +  +L FFAGTMFW R  AL  
Sbjct: 448 IVGPE-----SAYLSNARFWGGNEERLRVLAAETGIEEKRIRLGFFAGTMFWFRPAALSA 502

Query: 309 IKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDV 352
           ++   +            D  + H +ER F L V++A F  +  
Sbjct: 503 LRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGFFAATT 546


>gi|218455307|gb|AAX19610.2| WxocB [Xanthomonas oryzae pv. oryzicola]
 gi|218455309|gb|AAX19612.2| WxocB [Xanthomonas oryzae pv. oryzicola]
          Length = 568

 Score =  242 bits (617), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 87/284 (30%), Positives = 134/284 (47%), Gaps = 19/284 (6%)

Query: 79  MMERELHFDGQRIHHFPQLLHGWESPAMGKVMQI--------AIKAKIAIVVHLYYIDLW 130
           M+ERE+    Q   +   ++ G +SPA  ++ +         ++ ++ AIV+HL++IDL 
Sbjct: 272 MIEREVARMRQTRKNIMPIVTGGDSPASDELERYGVGAIDAESLSSRFAIVLHLFHIDLI 331

Query: 131 IEIANLLSNLSISFDLHVTL--VTESASIKSEILKIFPAARIHIMENHGRDVLPFLILLE 188
             I   + N+ + +D+ V++  +++         +    A + I  N GRDV PF+ LL 
Sbjct: 332 DAICAYMRNVIVDYDVFVSVKSISDRRMAVRYFQEHKIRASVFIHPNIGRDVGPFISLLN 391

Query: 189 TEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIG 248
           T  L  YD VCKIH KKS         G  WR  L   LLG+   V +++R FD H   G
Sbjct: 392 TGLLDRYDAVCKIHSKKSVYHDG----GGQWRDDLMKALLGSSFDVLRVLRAFDDHPACG 447

Query: 249 MIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDP 308
           ++G       + Y       G N E +  LA   GI  +  +L FFAGTMFW R  AL  
Sbjct: 448 IVGPE-----SAYLSNARFWGGNEERLRVLAAETGIEEKRIRLGFFAGTMFWFRPAALSA 502

Query: 309 IKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDV 352
           ++   +            D  + H +ER F L V++A F  +  
Sbjct: 503 LRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGFFAATT 546


>gi|218455296|gb|AAV67426.2| glycosyltransferase [Xanthomonas oryzae pv. oryzicola]
 gi|218455299|gb|AAX19602.2| WxocB [Xanthomonas oryzae pv. oryzicola]
 gi|218455301|gb|AAX19604.2| WxocB [Xanthomonas oryzae pv. oryzicola]
          Length = 568

 Score =  241 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 87/284 (30%), Positives = 134/284 (47%), Gaps = 19/284 (6%)

Query: 79  MMERELHFDGQRIHHFPQLLHGWESPAMGKVMQI--------AIKAKIAIVVHLYYIDLW 130
           M+ERE+    Q   +   ++ G +SPA  ++ +         ++ ++ AIV+HL++IDL 
Sbjct: 272 MIEREVARMRQTRKNIMPIVTGDDSPASDELERYGVGAIDAESLSSRFAIVLHLFHIDLI 331

Query: 131 IEIANLLSNLSISFDLHVTL--VTESASIKSEILKIFPAARIHIMENHGRDVLPFLILLE 188
             I   + N+ + +D+ V++  +++         +    A + I  N GRDV PF+ LL 
Sbjct: 332 DAICAYMRNVIVDYDVFVSVKSISDRRMAVRYFQEHKIRASVFIHPNIGRDVGPFISLLN 391

Query: 189 TEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIG 248
           T  L  YD VCKIH KKS         G  WR  L   LLG+   V +++R FD H   G
Sbjct: 392 TGLLDRYDAVCKIHSKKSVYHDG----GGQWRDDLMKALLGSSFDVLRVLRAFDDHPACG 447

Query: 249 MIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDP 308
           ++G       + Y       G N E +  LA   GI  +  +L FFAGTMFW R  AL  
Sbjct: 448 IVGPE-----SAYLSNARFWGGNEERLRVLAAETGIEEKRIRLGFFAGTMFWFRPAALSA 502

Query: 309 IKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDV 352
           ++   +            D  + H +ER F L V++A F  +  
Sbjct: 503 LRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGFFAATT 546


>gi|163853098|ref|YP_001641141.1| lipopolysaccharide biosynthesis protein-like protein
           [Methylobacterium extorquens PA1]
 gi|163664703|gb|ABY32070.1| Lipopolysaccharide biosynthesis protein-like protein
           [Methylobacterium extorquens PA1]
          Length = 916

 Score =  241 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 72/303 (23%), Positives = 129/303 (42%), Gaps = 17/303 (5%)

Query: 56  DENYVVAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIK 115
              + + YG + G K  A+   Y   + ++ +G      P+  + + + ++    ++   
Sbjct: 189 PFIHYIRYGRKKGYKG-AREEYYYSNQLVYPNGVVPSRRPRNENDY-AFSIPLPERLRSH 246

Query: 116 A--KIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIKSEILKIFP-AARI 170
              K A +VH +Y +L  EI   L   +   D++V+         I S   K       +
Sbjct: 247 PYKKAAAIVHGFYPELMEEILIYLGKSNFPIDIYVSTDDSKKAEQIISMGKKYHNGQLDV 306

Query: 171 HIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGA 230
            I+ N GRD+ P L         NY+    IH KKS   G        WR +LF +L+G+
Sbjct: 307 RIISNRGRDIGPMLTGFSD-VFDNYEAFLHIHTKKSPHGGDGLS---SWRDYLFKNLIGS 362

Query: 231 PGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGIT-FQDQ 289
             ++   +    T R++G +  +             + G N + + +L  R+G+   +D 
Sbjct: 363 AEIIDSNLHILGT-RNVGFVYPQHLYALRGI----LNWGYNFDTVSSLLRRVGVRLSKDM 417

Query: 290 KLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRI 349
            L+F +G+MFW RT AL  + +L L           +DG + HA+ER F    + + +  
Sbjct: 418 VLEFPSGSMFWARTAALHGLLSLDLKLEDFDNEAGQVDGTLGHAIERSFLYFAETSGYSW 477

Query: 350 SDV 352
           + V
Sbjct: 478 AKV 480


>gi|83950907|ref|ZP_00959640.1| hypothetical protein ISM_07395 [Roseovarius nubinhibens ISM]
 gi|83838806|gb|EAP78102.1| hypothetical protein ISM_07395 [Roseovarius nubinhibens ISM]
          Length = 752

 Score =  241 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 77/320 (24%), Positives = 123/320 (38%), Gaps = 40/320 (12%)

Query: 59  YVVAYGSRSGKKF--------FAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVM 110
           + V +G + G +         + + N  +    +      + H+     G       +  
Sbjct: 55  HYVTWGEKMGLRPRADFAPEEYLRLNPDVAGSGIP----PLMHYLTSGQGEGRSGQPRYA 110

Query: 111 QIAI---------------KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV---T 152
              +               KA+ A+  H+YY DLW E A     +    DL++TL     
Sbjct: 111 TRPLPSCPLPRLRFDPGRPKARFALHAHIYYPDLWPEFATRFDEIGDGIDLYITLTWRGE 170

Query: 153 ESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYS 212
           E+  +  EI + FP A +  + N GRD+LPFL+L        YD +CKIH KKS      
Sbjct: 171 ETRWLADEITERFPRAFVTPVPNRGRDILPFLLLANAGAFDGYDALCKIHTKKSP----H 226

Query: 213 WWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNR 272
             +GD WRR L   +L A G+  ++              +  +    +        G NR
Sbjct: 227 RDDGDQWRRHLIDGVLPATGLQERLQHFLADD------AAAFWVADGQAYAARDWWGINR 280

Query: 273 EMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           +    +  R+ +      L F AG+++W++   L  IK L L           +DG + H
Sbjct: 281 DKTAAVLRRVELDPLLDALRFPAGSIYWMKPLMLGMIKALDLDAPMFEPEKGQVDGTLAH 340

Query: 333 AVERCFSLSVKKANFRISDV 352
           AVER        A   I + 
Sbjct: 341 AVERAIGGLALAAGQEIRET 360


>gi|298290915|ref|YP_003692854.1| Rhamnan synthesis F [Starkeya novella DSM 506]
 gi|296927426|gb|ADH88235.1| Rhamnan synthesis F [Starkeya novella DSM 506]
          Length = 633

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 77/321 (23%), Positives = 128/321 (39%), Gaps = 30/321 (9%)

Query: 46  FYKRSKKLCYDENYVVAYGSRSGKKFFAQSNLYMMERELH---FDGQ--RIHHFPQLLHG 100
            ++R   L    N          ++ ++  +  +         FD +   + H+ +    
Sbjct: 321 AWRRKALLKRHPNRPPL------RRPYSGFHPLIYAEHHPVACFDERRYPLSHWIEKGRP 374

Query: 101 ---WESPAM-GKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA- 155
              W  P        +A   K+ +  H +Y DL  E+   L+  +   DL +T  T +  
Sbjct: 375 EGPWAVPVFGPPAAPVASPLKVGLHGHFFYPDLLPELLERLAANASRPDLFLTTDTPAKV 434

Query: 156 SIKSEILKIFP-AARIHIMENHGRDVLPFLILLETEQLSN-YDYVCKIHGKKSKRKGYSW 213
                +   +P   RI ++ N GRD+ PFL  L        YD +  +HGKK+K  G   
Sbjct: 435 EQLRALTAAWPAKVRIDVVPNSGRDIGPFLTALRDVLTGGEYDVLLHLHGKKTK--GRRR 492

Query: 214 WEGDLWRRWLFYDLLGAP-GVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNR 272
             GD WR +L+ +L+G    ++  ++     H  +G++        +          +N 
Sbjct: 493 AIGDPWRNFLWENLIGGDHPMLDAVLAYMAAHPQVGLVYPEDTHLLD--------WARNG 544

Query: 273 EMICTLAGRMGITFQD-QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
            ++  L   MG+T      +DF  G MF VR  AL P+  L L     P     LDG + 
Sbjct: 545 RVVEELRRDMGLTEPMGTYVDFPVGNMFAVRPAALAPVLALDLKWSDYPVEPIPLDGTVL 604

Query: 332 HAVERCFSLSVKKANFRISDV 352
           H +ER     V+KA F  + V
Sbjct: 605 HGIERLLPTVVRKAGFTTAAV 625


>gi|218455305|gb|AAX19608.2| WxocB [Xanthomonas oryzae pv. oryzicola]
          Length = 568

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 86/284 (30%), Positives = 134/284 (47%), Gaps = 19/284 (6%)

Query: 79  MMERELHFDGQRIHHFPQLLHGWESPAMGKVMQI--------AIKAKIAIVVHLYYIDLW 130
           M+ERE+    Q   +   ++ G +SPA  ++ +         ++ ++ AIV+HL++IDL 
Sbjct: 272 MIEREVARMRQTRKNIMPIVTGDDSPASDELERYGVGAIDAESLSSRFAIVLHLFHIDLI 331

Query: 131 IEIANLLSNLSISFDLHVTL--VTESASIKSEILKIFPAARIHIMENHGRDVLPFLILLE 188
             I   + N+ + +D+ V++  +++         +    A + I  N GRDV PF+ LL 
Sbjct: 332 DAICAYMRNVIVDYDVFVSVKSISDRRMAVRYFQEHKIRASVFIHPNIGRDVGPFISLLN 391

Query: 189 TEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIG 248
           T  L  YD VCK+H KKS         G  WR  L   LLG+   V +++R FD H   G
Sbjct: 392 TGLLDRYDAVCKVHSKKSVYHDG----GGQWRDDLMKALLGSSFNVLRVLRAFDDHPACG 447

Query: 249 MIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDP 308
           ++G       + Y       G N E +  LA   GI  +  +L FFAGTMFW R  AL  
Sbjct: 448 IVGPE-----SAYLSNARFWGGNEERLRVLAAETGIEEKRIRLGFFAGTMFWFRPAALSA 502

Query: 309 IKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDV 352
           ++   +            D  + H +ER F L V++A F  +  
Sbjct: 503 LRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGFFAATT 546


>gi|290580710|ref|YP_003485102.1| rhamnan synthesis protein F [Streptococcus mutans NN2025]
 gi|254997609|dbj|BAH88210.1| RgpFc protein [Streptococcus mutans NN2025]
          Length = 557

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 80/380 (21%), Positives = 137/380 (36%), Gaps = 44/380 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKR---SKKLCYDENY 59
           S  +  F  + K +       +  +  +        F +       +   S  L  D +Y
Sbjct: 123 STAFRDFWENIKEYQDVQKVIDQYETKVTTTLLDAGFQYDVVFDTTKEDASHMLHADFSY 182

Query: 60  VVAYGSRSGKKFFAQ--------------SNLYMMERELHFDGQRIH----HFPQLLHGW 101
                  + +  F +               N          D    H    ++P   +  
Sbjct: 183 YNPTAILNHRVPFIKVKAIDNNQHITPYLLNDIQKNSTYPIDLIVSHMSEINYPDFSYLL 242

Query: 102 ESPAMGKVMQIAIK-AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIK 158
               + K  ++ +K  K+A+ +H++Y+DL  E          S+DL +T  ++     I+
Sbjct: 243 GHKYVKKRERVDLKNQKVAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIE 302

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
             +      A++ +  N GRDVLP L L     LS YD+V   H KKSK   +  W G  
Sbjct: 303 EILSANSQEAQVFVTGNIGRDVLPMLKLKN--YLSAYDFVGHFHTKKSKEADF--WAGQS 358

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK-YCDYTCSLGKNREMICT 277
           WR  L   L+        I+     +  IG++ +    +          +       + T
Sbjct: 359 WREELIDMLVKPAD---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNT 415

Query: 278 LAGRMGITFQDQKLDF-----FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L  +MG+T +     F       GT  W + +AL P+ +L L+    P+        I H
Sbjct: 416 LWQKMGMTKKIDFNAFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLP-QNSILH 474

Query: 333 AVERCFSLSV--KKANFRIS 350
           A+ER        +  +FRIS
Sbjct: 475 AIERLLIYIAWNEHYDFRIS 494


>gi|3399709|dbj|BAA32094.1| rgpFc [Streptococcus mutans]
          Length = 583

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 80/380 (21%), Positives = 137/380 (36%), Gaps = 44/380 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKR---SKKLCYDENY 59
           S  +  F  + K +       +  +  +        F +       +   S  L  D +Y
Sbjct: 149 STAFRDFWENIKEYQDVQKVIDQYETKVTTTLLDAGFQYDVVFDTTKEDASHMLHADFSY 208

Query: 60  VVAYGSRSGKKFFAQ--------------SNLYMMERELHFDGQRIH----HFPQLLHGW 101
                  + +  F +               N          D    H    ++P   +  
Sbjct: 209 YNPTAILNHRVPFIKVKAIDNNQHITPYLLNDIQKNSTYPIDLIVSHMSEINYPDFSYLL 268

Query: 102 ESPAMGKVMQIAIK-AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIK 158
               + K  ++ +K  K+A+ +H++Y+DL  E          S+DL +T  ++     I+
Sbjct: 269 GHKYVKKRERVDLKNQKVAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIE 328

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
             +      A++ +  N GRDVLP L L     LS YD+V   H KKSK   +  W G  
Sbjct: 329 EILSANGQEAQVFVTGNIGRDVLPMLKLKN--YLSAYDFVGHFHTKKSKEADF--WAGQS 384

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK-YCDYTCSLGKNREMICT 277
           WR  L   L+        I+     +  IG++ +    +          +       + T
Sbjct: 385 WREELIDMLVKPAD---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNT 441

Query: 278 LAGRMGITFQDQKLDF-----FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L  +MG+T +     F       GT  W + +AL P+ +L L+    P+        I H
Sbjct: 442 LWQKMGMTKKIDFNAFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLP-QNSILH 500

Query: 333 AVERCFSLSV--KKANFRIS 350
           A+ER        +  +FRIS
Sbjct: 501 AIERLLIYIAWNEHYDFRIS 520


>gi|30024644|dbj|BAC75698.1| rhamnosyltransferase [Streptococcus mutans]
          Length = 583

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 80/380 (21%), Positives = 137/380 (36%), Gaps = 44/380 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKR---SKKLCYDENY 59
           S  +  F  + K +       +  +  +        F +       +   S  L  D +Y
Sbjct: 149 STAFRDFWENIKEYQDVQKVIDQYETKVTTTLLDAGFQYDVVFDTTKEDASHMLHADFSY 208

Query: 60  VVAYGSRSGKKFFAQ--------------SNLYMMERELHFDGQRIH----HFPQLLHGW 101
                  + +  F +               N          D    H    ++P   +  
Sbjct: 209 YNPTAILNHRVPFIKVKAIDNNQHITPYLLNDIQKNSTYPIDLIVSHMSEINYPDFSYLL 268

Query: 102 ESPAMGKVMQIAIK-AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIK 158
               + K  ++ +K  K+A+ +H++Y+DL  E          S+DL +T  ++     I+
Sbjct: 269 GHKYVKKRERVDLKNQKVAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIE 328

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
             +      A++ +  N GRDVLP L L     LS YD+V   H KKSK   +  W G  
Sbjct: 329 EILSANSQEAQVFVTGNIGRDVLPMLKLKN--YLSTYDFVGHFHTKKSKEADF--WAGQS 384

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK-YCDYTCSLGKNREMICT 277
           WR  L   L+        I+     +  IG++ +    +          +       + T
Sbjct: 385 WREELIDMLVKPAD---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNT 441

Query: 278 LAGRMGITFQDQKLDF-----FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L  +MG+T +     F       GT  W + +AL P+ +L L+    P+        I H
Sbjct: 442 LWQKMGMTKKIDFNAFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLP-QNSILH 500

Query: 333 AVERCFSLSV--KKANFRIS 350
           A+ER        +  +FRIS
Sbjct: 501 AIERLLIYIAWNEHYDFRIS 520


>gi|30024633|dbj|BAC75688.1| rhamnosyltransferase [Streptococcus mutans]
          Length = 583

 Score =  239 bits (609), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 81/380 (21%), Positives = 137/380 (36%), Gaps = 44/380 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKR---SKKLCYDENY 59
           S  +  F  + K +       +  +  +        F +       +   S  L  D +Y
Sbjct: 149 STAFRDFWENIKEYQDVQKVIDQYETKVTTTLLDAGFQYDVVFDTTKEDASNMLHADFSY 208

Query: 60  VVAYGSRSGKKFFAQ--------------SNLYMMERELHFDGQRIH----HFPQLLHGW 101
                  + +  F +               N          D    H    ++P   +  
Sbjct: 209 YNPTAILNHRVPFIKVKAIDNNQHITPYLLNDIQKNSTYPIDLIVSHMSEINYPDFSYLL 268

Query: 102 ESPAMGKVMQIAIK-AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSE 160
               + K  ++ +K  K+A+ +H++Y+DL  E          S+DL +T  ++    + E
Sbjct: 269 GHKYVKKRERVDLKNQKVAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIE 328

Query: 161 --ILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
             +      A+I +  N GRDVLP L L     LS YD+V   H KKSK   +  W G  
Sbjct: 329 EVLSANSQEAQIFVTGNIGRDVLPMLKLKN--YLSTYDFVGHFHTKKSKEADF--WAGQS 384

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK-YCDYTCSLGKNREMICT 277
           WR  L   L+        I+     +  IG++ +    +          +       + T
Sbjct: 385 WREELIDMLVKPAD---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNT 441

Query: 278 LAGRMGITFQDQKLDF-----FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L  +MG+T +     F       GT  W + +AL P+ +L L+    P+        I H
Sbjct: 442 LWQKMGMTKKIDFNAFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLP-QNSILH 500

Query: 333 AVERCFSLSV--KKANFRIS 350
           A+ER        +  +FRIS
Sbjct: 501 AIERLLIYIAWNEHYDFRIS 520


>gi|258654317|ref|YP_003203473.1| Rhamnan synthesis F [Nakamurella multipartita DSM 44233]
 gi|258557542|gb|ACV80484.1| Rhamnan synthesis F [Nakamurella multipartita DSM 44233]
          Length = 631

 Score =  238 bits (608), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 80/387 (20%), Positives = 134/387 (34%), Gaps = 53/387 (13%)

Query: 10  YFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCYDENYVVAYGS 65
           +  +         Y+D     +      F    F +       R     Y   + V   +
Sbjct: 159 FAWYWDKMPMVTSYTDSILQHESKFTQHFADRGFRYSILFDPSR-----YPTTHPVFDSA 213

Query: 66  RS---GKKFFAQSNLYMME----RELHFDGQRIHHFPQ--------LLHGWESPAMGKVM 110
                 +    +  ++  E          G+R+             +       A  + +
Sbjct: 214 DLMLGDRCPILKRRMFFHEPTYLERNAILGRRVMEIVSRTDYPVDLIWRNVVRSAEPRTL 273

Query: 111 QIAIK-----------------AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE 153
              +                   +I ++ H++Y D+  E+   + N+ + FDL VT  + 
Sbjct: 274 YTNMSMLSVVPDVDTGFRPDPPLRICVLAHIFYEDMTDEMMGWIGNIPVPFDLVVTTTSA 333

Query: 154 SAS--IKSEILKI-FPAARIHIME-NHGRDVLPFLILLETEQLSN-YDYVCKIHGKKSKR 208
           +    I+S +      +  + ++E N GR    FLI       S  YD V KIH KKS +
Sbjct: 334 AKKEAIESALEAYALKSVEVRLVESNRGRAESAFLIACRDVLTSGEYDLVLKIHSKKSPQ 393

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
            G +   G L++     +LL +PG V  I+  F +   +GM+          +     S 
Sbjct: 394 NGANL--GQLFKHHSVDNLLSSPGYVASILGMFQSQPSLGMVFPPVVNIG--FPTLGHSW 449

Query: 269 GKNREMICTLAGRMGI--TFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKV-HKA 325
             NRE    LA ++GI   F         GTMFW R E+L  +                 
Sbjct: 450 FTNREAAHELADQLGIHTIFDRTTPLAPNGTMFWARPESLAKLARHDFDYSQFAAEHEGW 509

Query: 326 LDGEIEHAVERCFSLSVKKANFRISDV 352
            DG + H +ER +  +V  A  RI  V
Sbjct: 510 SDGMLGHVIERLYGYAVLDAGLRIQCV 536


>gi|298346187|ref|YP_003718874.1| hypothetical protein HMPREF0573_11061 [Mobiluncus curtisii ATCC
           43063]
 gi|304390053|ref|ZP_07372007.1| group 2 glycosyl transferase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|298236248|gb|ADI67380.1| conserved hypothetical protein [Mobiluncus curtisii ATCC 43063]
 gi|304326535|gb|EFL93779.1| group 2 glycosyl transferase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
          Length = 680

 Score =  237 bits (606), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 63/248 (25%), Positives = 113/248 (45%), Gaps = 14/248 (5%)

Query: 117 KIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA-----SIKSEILKIFPAARIH 171
           ++A+V+H+YY DL  EI   LSN+ + FD+ +T  + +          E L +     + 
Sbjct: 51  RLAVVMHVYYPDLVTEIVQRLSNIPVEFDMFITNASGADLPLLPQQIHERLPLLKHLVVV 110

Query: 172 IMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSW---WEGDLWRRWLFYDLL 228
            +ENHGRD+ P + L+    L  Y  + K+H KKS  +         G  W+      LL
Sbjct: 111 PVENHGRDIFPLVQLVNFGALDPYQLILKVHTKKSAWRENHPDLEGSGAQWKDEFLDALL 170

Query: 229 GAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQD 288
           G+   V KI+  F     +G++ +       ++       G ++ +   L  R+ +  + 
Sbjct: 171 GSKDSVEKIMSAFGADPWLGLVTAPGNIVGPQF------WGGDQALTAELLRRLEMQLKP 224

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
            KL F AG+M+WVR   +  +++L LS          +D    HA+ER   +   +A  +
Sbjct: 225 SKLKFAAGSMYWVRGFVIQGLRSLGLSATDFETEAGQIDATTAHALERAIGILTTEAGLK 284

Query: 349 ISDVDCIL 356
           + + + + 
Sbjct: 285 LRETNQLA 292


>gi|315654770|ref|ZP_07907675.1| group 2 glycosyl transferase [Mobiluncus curtisii ATCC 51333]
 gi|315490731|gb|EFU80351.1| group 2 glycosyl transferase [Mobiluncus curtisii ATCC 51333]
          Length = 680

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 63/248 (25%), Positives = 114/248 (45%), Gaps = 14/248 (5%)

Query: 117 KIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA-----SIKSEILKIFPAARIH 171
           ++A+V+H+YY DL  EI   LSN+ + FD+ +T  + +          E L +     + 
Sbjct: 51  RLAVVMHVYYPDLVTEIVQRLSNIPVEFDMFITNASGADLPLLPQQIHERLPLLKHLVVV 110

Query: 172 IMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSW---WEGDLWRRWLFYDLL 228
            +ENHGRD+ P + L+    L  Y  + K+H KKS  +         G  W+      LL
Sbjct: 111 PVENHGRDIFPLVQLVNFGALDPYQLILKVHTKKSAWRESHPDLEGSGAQWKDEFLDALL 170

Query: 229 GAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQD 288
           G+   V KI+  F +   +G++ +       ++       G ++ +   L  R+ +  + 
Sbjct: 171 GSKDSVEKIMSAFGSDPWLGLVTAPGNIVGPQF------WGGDQALTAELLRRLEMQLKP 224

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
            KL F AG+M+WVR   +  +++L LS          +D    HA+ER   +   +A  +
Sbjct: 225 SKLKFAAGSMYWVRGFVIQGLRSLGLSATDFETEAGQIDATTAHALERAIGILTTEAGLK 284

Query: 349 ISDVDCIL 356
           + + + + 
Sbjct: 285 LRETNQLA 292


>gi|24379285|ref|NP_721240.1| RgpFc protein [Streptococcus mutans UA159]
 gi|24377204|gb|AAN58546.1|AE014924_6 RgpFc protein [Streptococcus mutans UA159]
          Length = 583

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 80/380 (21%), Positives = 136/380 (35%), Gaps = 44/380 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKR---SKKLCYDENY 59
           S  +  F  + K +       +  +  +        F +       +   S  L  D +Y
Sbjct: 149 STAFRDFWENIKEYQDVQKVIDQYETKVTTTLLDAGFQYDVVFDTTKEDASHMLHADFSY 208

Query: 60  VVAYGSRSGKKFFAQ--------------SNLYMMERELHFDGQRIH----HFPQLLHGW 101
                  + +  F +               N          D    H    ++P   +  
Sbjct: 209 YNPTAILNHRVPFIKVKAIDNNQHITPYLLNDIQKNSTYPIDLIVSHMSEINYPDFSYLL 268

Query: 102 ESPAMGKVMQIAIK-AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIK 158
               + K  ++ +K  K A+ +H++Y+DL  E          S+DL +T  ++     I+
Sbjct: 269 GHKYVKKRERVDLKNQKAAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIE 328

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
             +      A++ +  N GRDVLP L L     LS YD+V   H KKSK   +  W G  
Sbjct: 329 EILSANSQEAQVFVTGNIGRDVLPMLKLKN--YLSTYDFVGHFHTKKSKEADF--WAGQS 384

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK-YCDYTCSLGKNREMICT 277
           WR  L   L+        I+     +  IG++ +    +          +       + T
Sbjct: 385 WREELIDMLVKPAD---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNT 441

Query: 278 LAGRMGITFQDQKLDF-----FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L  +MG+T +     F       GT  W + +AL P+ +L L+    P+        I H
Sbjct: 442 LWQKMGMTKKIDFNAFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLP-QNSILH 500

Query: 333 AVERCFSLSV--KKANFRIS 350
           A+ER        +  +FRIS
Sbjct: 501 AIERLLIYIAWNEHYDFRIS 520


>gi|122879048|ref|YP_199439.6| hypothetical protein XOO0800 [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 546

 Score =  236 bits (603), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 68/245 (27%), Positives = 115/245 (46%), Gaps = 11/245 (4%)

Query: 115 KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV-TESASIKSEILKIFPAARIHIM 173
           +    +V+H +Y+D+  E  + L++  +S  L VT   T    ++  + +    A++   
Sbjct: 296 QHDACVVLHAWYLDVLDEALDALAHCGLSLRLVVTTDITMVTQVRQCLQQRGLQAQVEGF 355

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
           EN GRD+LPFL +           V K+H KKS        +GD WRR +   LL  P  
Sbjct: 356 ENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDTWRRDMLSGLLA-PQH 410

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDF 293
           V  I+R F     +G++    +  P      T  +G N + +  L  R G    +    F
Sbjct: 411 VAAIVRGFAEDPLLGLVAPAQHLLP-----VTDFMGGNADALDYLTVRTGTDAINAHSLF 465

Query: 294 FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVD 353
            +G+MFWV+ EAL P+ +  L           +DG + HA+ER  +++V  +  R++ ++
Sbjct: 466 ASGSMFWVKLEALRPLLDAHLHPSEFESEQGQIDGTLAHAIERFLAVAVAHSGQRVATIE 525

Query: 354 CILGY 358
            +LG 
Sbjct: 526 QLLGI 530


>gi|325921211|ref|ZP_08183074.1| lipopolysaccharide biosynthesis protein [Xanthomonas gardneri ATCC
           19865]
 gi|325548310|gb|EGD19301.1| lipopolysaccharide biosynthesis protein [Xanthomonas gardneri ATCC
           19865]
          Length = 706

 Score =  236 bits (602), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 68/271 (25%), Positives = 117/271 (43%), Gaps = 17/271 (6%)

Query: 96  QLLHGWESPA------MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
           +L H W            KV+      ++ +V+H +Y+D+  E+ + +++ +IS  L +T
Sbjct: 413 RLGHAWLEATREALIGPSKVVSELAPHRVCVVLHAWYLDVLDEMLDAVAHCAISPRLVIT 472

Query: 150 LV-TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
              T    ++  + +    A +   EN GRD+LPFL +           V K+H KKS  
Sbjct: 473 TDLTMVVEVRHRVQQRGMQAEVEGFENRGRDILPFLHVANRLLDEGVCLVVKLHTKKST- 531

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
                 +GD WR  +   LL  P     I+  F +   +G+     +  P         +
Sbjct: 532 ---HRSDGDTWRHEMLSALLA-PERADAIVNAFSSDPLLGLAAPDGHLLP-----VADFI 582

Query: 269 GKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDG 328
           G N + +  L  R G     ++  F +G+MFW R EAL P+ +  L           +DG
Sbjct: 583 GGNTDALDYLGARTGTETAIEQGMFASGSMFWARLEALRPLLDAHLHPSEFETEQGQIDG 642

Query: 329 EIEHAVERCFSLSVKKANFRISDVDCILGYR 359
            + HA+ER   +S  ++ +RI+ +   L   
Sbjct: 643 TLAHAIERFMGISAIQSGYRIATIGQALEIS 673


>gi|77748730|ref|NP_643883.2| hypothetical protein XAC3576 [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 546

 Score =  236 bits (602), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 69/241 (28%), Positives = 113/241 (46%), Gaps = 11/241 (4%)

Query: 119 AIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV-TESASIKSEILKIFPAARIHIMENHG 177
            +V+H +Y+D+  E  + +++  +S  L VT   T    ++  + +    A++   EN G
Sbjct: 300 CVVLHAWYLDVLDEALDAIADCGLSLRLVVTTDITMVEQVRQRLQQRGVQAQVDGFENRG 359

Query: 178 RDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKI 237
           RD+LPFL +           V K+H KKS        +GD WRR +F  LL  P     I
Sbjct: 360 RDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDAWRREMFSALL-TPQHADAI 414

Query: 238 IRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGT 297
           +R F     +G+     +  P      T  +G N + +  LA R G    D+   F +G+
Sbjct: 415 MRGFTDDPLLGLAAPAQHLLP-----VTDFIGGNADALDYLAVRTGTDAIDEHSVFASGS 469

Query: 298 MFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILG 357
           MFWV+ EAL P+ +  L           +DG + HA+ER  +++V      ++ +D +LG
Sbjct: 470 MFWVKLEALRPLLDANLHPSEFENEQGQIDGTLAHAIERFLAVAVSHCGHHVATIDQLLG 529

Query: 358 Y 358
            
Sbjct: 530 I 530


>gi|325928558|ref|ZP_08189746.1| Lipopolysaccharide biosynthesis protein/putative glycosyl
           transferase [Xanthomonas perforans 91-118]
 gi|325541097|gb|EGD12651.1| Lipopolysaccharide biosynthesis protein/putative glycosyl
           transferase [Xanthomonas perforans 91-118]
          Length = 695

 Score =  236 bits (602), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 116/247 (46%), Gaps = 11/247 (4%)

Query: 115 KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV-TESASIKSEILKIFPAARIHIM 173
           +  + +V+H +Y+D+  E    +++  +S  L +T   T    ++  + +    A++   
Sbjct: 445 QRDVCVVLHAWYLDVLDEALEAIAHCGLSLRLVITTDITMVEQVRQRLQQRGVQAQVEGF 504

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
           EN GRD+LPFL +           V K+H KKS        +GD WRR +F  LL  P  
Sbjct: 505 ENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDTWRREMFSALLA-PQH 559

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDF 293
           V  I+R F     +G+     +  P      T  +G N + +  LA R G    ++   F
Sbjct: 560 VDAIMRGFADDPLLGLAAPAQHLLP-----VTDFIGGNADALDYLAVRTGTDAINEHSMF 614

Query: 294 FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVD 353
            +G+MFWV+ EAL P+ +  L           +DG + HA+ER  +++V      ++ V+
Sbjct: 615 ASGSMFWVKLEALRPLLDAHLHPSEFEDEQGQIDGTLAHAIERFLAVAVGHCGHHVATVE 674

Query: 354 CILGYRK 360
            +LG  +
Sbjct: 675 QLLGIAQ 681


>gi|302337198|ref|YP_003802404.1| Rhamnan synthesis F [Spirochaeta smaragdinae DSM 11293]
 gi|301634383|gb|ADK79810.1| Rhamnan synthesis F [Spirochaeta smaragdinae DSM 11293]
          Length = 1808

 Score =  235 bits (601), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 75/373 (20%), Positives = 147/373 (39%), Gaps = 48/373 (12%)

Query: 16   HFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVAYGSRSGKKF--FA 73
            + K  N+  ++ +IEK+ +  G F   + +   +   +     + +  G   G       
Sbjct: 884  YLKIENYKKENMSIEKIAIQTGLFNEKYYINNAKGINIKEPFKHYLERGYLLGLNPSSIF 943

Query: 74   QSNLYM-MERELHF-DGQRIHHFPQLLHGWES-------------------------PAM 106
             ++ Y+   R++++ +   + HF +  +                             P +
Sbjct: 944  NTSQYLDANRDVYWANMNPLFHFIKYGYSENRKMVHPGDINSEFHRSFGKSEYGVTGPVL 1003

Query: 107  GKVMQIAIKAK----IAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESAS---IKS 159
                +I +  +    I + +HL+YIDL  E+ + L N+ + F L ++          IK 
Sbjct: 1004 YYDREIQLNPRFNLSIGVHLHLFYIDLAEELLSSLINIPVCFSLFISTSAGVKDQEYIKK 1063

Query: 160  EILKIFP---AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEG 216
             + K  P      +   EN GRD+ PF++      LS +D +   H KKS          
Sbjct: 1064 IVNKKLPLCNECTVIQTENRGRDIAPFIVEFGNS-LSQFDLILHFHSKKSLHSDSLSDA- 1121

Query: 217  DLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMIC 276
               RR+L + +LG   +  + +  F  +  IGM+    +       ++     + +    
Sbjct: 1122 ---RRFLLHYILGNKAITIQNLNMFFENGSIGMVAPPYHPSLRNMPNFGLQEYETK---- 1174

Query: 277  TLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVER 336
                +MGI +  +  DF AG+ FW R +A+  +    +     P+    +DG + H +ER
Sbjct: 1175 QFLKKMGINYSGKCTDFPAGSFFWCRKDAIRQLLTSNIRWNSFPEEKGQIDGTLAHVIER 1234

Query: 337  CFSLSVKKANFRI 349
               +  K+ NF+I
Sbjct: 1235 SLGIICKQNNFKI 1247


>gi|166713445|ref|ZP_02244652.1| hypothetical protein Xoryp_18900 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 695

 Score =  235 bits (601), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 116/247 (46%), Gaps = 11/247 (4%)

Query: 115 KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV-TESASIKSEILKIFPAARIHIM 173
           +    +V+H +Y+D+  E  + L++  +S  L VT   T    ++  + +    A++   
Sbjct: 445 QHDACVVLHAWYLDVLDEALDALAHCGLSLRLVVTTDITMVTQVRQCLQQRGLQAQVEGF 504

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
           EN GRD+LPFL +           V K+H KKS        +GD WRR +   LL  P  
Sbjct: 505 ENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDTWRRDMLSGLLA-PQH 559

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDF 293
           V  I+R F     +G++    +  P      T  +G N + +  L  R G    +    F
Sbjct: 560 VAAIVRGFAEDPLLGLVAPAQHLLP-----VTDFIGGNADALDYLTVRTGTDAINAHSLF 614

Query: 294 FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVD 353
            +G+MFWV+ EAL P+ +  L           +DG + HA+ER  +++V  +  R++ ++
Sbjct: 615 ASGSMFWVKLEALRPLLDAHLHPSEFESEQGQIDGTLAHAIERFLAVAVAHSGQRVATIE 674

Query: 354 CILGYRK 360
            +LG  K
Sbjct: 675 QLLGIPK 681


>gi|315657309|ref|ZP_07910191.1| group 2 glycosyl transferase [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
 gi|315491781|gb|EFU81390.1| group 2 glycosyl transferase [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
          Length = 680

 Score =  235 bits (600), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 63/248 (25%), Positives = 114/248 (45%), Gaps = 14/248 (5%)

Query: 117 KIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA-----SIKSEILKIFPAARIH 171
           ++A+V+H+YY DL  EI   LSN+ + FD+ +T  + +          E L +     + 
Sbjct: 51  RLAVVMHVYYSDLVTEIVQRLSNIPVEFDMFITNASGADLPLLPQQIHERLPLLKHLVVV 110

Query: 172 IMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSW---WEGDLWRRWLFYDLL 228
            +ENHGRD+ P + L+    L  Y  + K+H KKS  +         G  W+      LL
Sbjct: 111 PVENHGRDIFPLVQLVNFGALDPYQLILKVHTKKSAWRESHPDLEGSGAQWKDEFLDALL 170

Query: 229 GAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQD 288
           G+   V KI+  F +   +G++ +       ++       G ++ +   L  R+ +  + 
Sbjct: 171 GSKDSVEKIMSAFGSDPWLGLVTAPGNIVGPQF------WGGDQALTAELLRRLEMQLKP 224

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
            KL F AG+M+WVR   +  +++L LS          +D    HA+ER   +   +A  +
Sbjct: 225 SKLKFAAGSMYWVRGFVIQGLRSLGLSATDFETEAGQIDATTAHALERAIGILTTEAGLK 284

Query: 349 ISDVDCIL 356
           + + + + 
Sbjct: 285 LRETNQLA 292


>gi|84622385|ref|YP_449757.1| hypothetical protein XOO_0728 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188578640|ref|YP_001915569.1| hypothetical protein PXO_03177 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|84366325|dbj|BAE67483.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188523092|gb|ACD61037.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 695

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 68/245 (27%), Positives = 115/245 (46%), Gaps = 11/245 (4%)

Query: 115 KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV-TESASIKSEILKIFPAARIHIM 173
           +    +V+H +Y+D+  E  + L++  +S  L VT   T    ++  + +    A++   
Sbjct: 445 QHDACVVLHAWYLDVLDEALDALAHCGLSLRLVVTTDITMVTQVRQCLQQRGLQAQVEGF 504

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
           EN GRD+LPFL +           V K+H KKS        +GD WRR +   LL  P  
Sbjct: 505 ENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDTWRRDMLSGLLA-PQH 559

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDF 293
           V  I+R F     +G++    +  P      T  +G N + +  L  R G    +    F
Sbjct: 560 VAAIVRGFAEDPLLGLVAPAQHLLP-----VTDFMGGNADALDYLTVRTGTDAINAHSLF 614

Query: 294 FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVD 353
            +G+MFWV+ EAL P+ +  L           +DG + HA+ER  +++V  +  R++ ++
Sbjct: 615 ASGSMFWVKLEALRPLLDAHLHPSEFESEQGQIDGTLAHAIERFLAVAVAHSGQRVATIE 674

Query: 354 CILGY 358
            +LG 
Sbjct: 675 QLLGI 679


>gi|58425017|gb|AAW74054.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 727

 Score =  234 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 68/245 (27%), Positives = 115/245 (46%), Gaps = 11/245 (4%)

Query: 115 KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV-TESASIKSEILKIFPAARIHIM 173
           +    +V+H +Y+D+  E  + L++  +S  L VT   T    ++  + +    A++   
Sbjct: 477 QHDACVVLHAWYLDVLDEALDALAHCGLSLRLVVTTDITMVTQVRQCLQQRGLQAQVEGF 536

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
           EN GRD+LPFL +           V K+H KKS        +GD WRR +   LL  P  
Sbjct: 537 ENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDTWRRDMLSGLLA-PQH 591

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDF 293
           V  I+R F     +G++    +  P      T  +G N + +  L  R G    +    F
Sbjct: 592 VAAIVRGFAEDPLLGLVAPAQHLLP-----VTDFMGGNADALDYLTVRTGTDAINAHSLF 646

Query: 294 FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVD 353
            +G+MFWV+ EAL P+ +  L           +DG + HA+ER  +++V  +  R++ ++
Sbjct: 647 ASGSMFWVKLEALRPLLDAHLHPSEFESEQGQIDGTLAHAIERFLAVAVAHSGQRVATIE 706

Query: 354 CILGY 358
            +LG 
Sbjct: 707 QLLGI 711


>gi|148927812|ref|ZP_01811237.1| Lipopolysaccharide biosynthesis protein-like protein [candidate
           division TM7 genomosp. GTL1]
 gi|147886838|gb|EDK72383.1| Lipopolysaccharide biosynthesis protein-like protein [candidate
           division TM7 genomosp. GTL1]
          Length = 498

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 66/241 (27%), Positives = 112/241 (46%), Gaps = 15/241 (6%)

Query: 117 KIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIME 174
           ++A+VVH++Y +L  EI +++ N+   FDL +T   E   + +      +  +  I + E
Sbjct: 240 RLAVVVHIFYPELANEIYDVIKNIVEPFDLIITTPHEGAVSELIDTFAPLASSVAIALSE 299

Query: 175 NHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVV 234
           N GRDV PFL +  +  L  YD V K+H KKS         G  W++ LF  L G   +V
Sbjct: 300 NRGRDVGPFLAVHRSGLLERYDAVLKLHSKKSTYSD----SGQQWQQSLFRQLCGNSQIV 355

Query: 235 FKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRM---GITFQDQKL 291
            + +         GM+G   Y   + +       G NR  +  L   +    +  +D  L
Sbjct: 356 RRSVALL-RDGKTGMVGPHDYYLTHPHY-----WGANRPAVHKLLQSLTATPLKEEDVPL 409

Query: 292 DFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISD 351
            FFAGTMFW   +A+  + ++  +       +   DG + HA+ER F +  +   + ++ 
Sbjct: 410 RFFAGTMFWFAPKAIVALHDIPEALLNFESENGKQDGTLAHALERLFGIVPQLGGYNVTS 469

Query: 352 V 352
           +
Sbjct: 470 L 470


>gi|171779906|ref|ZP_02920810.1| hypothetical protein STRINF_01693 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171281254|gb|EDT46689.1| hypothetical protein STRINF_01693 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 592

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 71/270 (26%), Positives = 112/270 (41%), Gaps = 21/270 (7%)

Query: 91  IHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTL 150
              F  LL       +  V       KIA+ +H++Y+DL  +  +   N    +DL +T 
Sbjct: 267 FPDFKYLLARKYVKEVPAVS--LADKKIAVHLHVFYVDLLEDFLDAFENFHFVYDLFITT 324

Query: 151 V--TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
              T+   I+S +      A+I +  N GRDVLP L L   + LS+YDY+   H KKSK 
Sbjct: 325 DNATKKQEIESILRSNGKDAQIFVTGNVGRDVLPMLKL--KDYLSDYDYIGHFHTKKSKE 382

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAY-RYPNKYCDYTCS 267
             +  W G+ WR  L   L+        I+  F  +  +G++ +     +         +
Sbjct: 383 ADF--WAGESWRNELIDMLIKPAD---NILANF-DNDKLGIVIADIPTFFRFNKIVDAWN 436

Query: 268 LGKNREMICTLAGRMGITFQDQKLDF-----FAGTMFWVRTEALDPIKNLRLSRYFEPKV 322
                  +  L  +MG+T      +F       GT  W + +AL P+ +L L+    P  
Sbjct: 437 EHLIAPAMNDLWQQMGMTKAIDFNNFHNFVMSYGTYVWFKYDALKPLFDLGLTDEDVPAE 496

Query: 323 HKALDGEIEHAVERCFSLSV--KKANFRIS 350
                  I HA+ER        +  +FRIS
Sbjct: 497 PLP-QNSILHAIERLLIYIAWNEHYDFRIS 525


>gi|289678438|ref|ZP_06499328.1| glycosyl transferase, group 1 [Pseudomonas syringae pv. syringae
           FF5]
          Length = 774

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 102/240 (42%), Gaps = 11/240 (4%)

Query: 113 AIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIK-SEILKIFPAAR-- 169
           A +  +A+ +H++Y D   + ++ L+N     D+ +TL       K   +    P  +  
Sbjct: 262 AARLNVAVCLHIFYEDYIEKFSHALANFPTQVDVFITLADAKHQKKTIAVFSKHPRVKNL 321

Query: 170 -IHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLL 228
            +  + N GR+  P L+    + ++ YD  C +H KKS   G    E   W  +L   LL
Sbjct: 322 KVRCVPNRGRNFGPLLVEFSKDLMA-YDLFCHLHSKKSLYSGR---EQTQWADYLTEYLL 377

Query: 229 GAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQD 288
               ++ +++  F  H+D+G+     +     + ++      N+  +        I   D
Sbjct: 378 RDANIITRLLNAFADHKDLGLYYPTTFWMMPSWVNHVT---MNKSFMAAWHNEWQIDPCD 434

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
             L + AG MFW R EAL  +        F P+     DG + HA+ER   L  +K  ++
Sbjct: 435 GFLSYPAGGMFWARPEALKDMLEKEYDYDFFPQEPLPNDGSMLHALERVIGLLAEKNGYK 494


>gi|254876593|ref|ZP_05249303.1| predicted protein [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254842614|gb|EET21028.1| predicted protein [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
          Length = 765

 Score =  232 bits (593), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 62/252 (24%), Positives = 103/252 (40%), Gaps = 15/252 (5%)

Query: 106 MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT-LVTESASIKSEILKI 164
           +    +  I  K AI +HL+YIDL  E       L   +DL++T + + ++    E    
Sbjct: 519 LPINSEKNISHKFAIHLHLFYIDLADEFNEYFKLLPKGYDLYITIIDSNNSEFIKEKFSS 578

Query: 165 FP--AARIHIMENHGRDVLPFLILLETEQL-SNYDYVCKIHGKKSKRKGYSWWEGDLWRR 221
                  I  ++N GRD+ P +  L+ + L   Y+ V   H KK+         GD WR 
Sbjct: 579 SGAANVEIVAVDNIGRDIAPMIFGLKDQLLNRGYEIVGHFHSKKTV--SAHDNLGDKWRA 636

Query: 222 WLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGR 281
           +L  +L+G    +   I        IG++      Y +        +G+N+  +  L   
Sbjct: 637 YLLNNLIGDNEQISNSILNLFNDEKIGLVFPEDRTYID--------IGENKFYVDELCTA 688

Query: 282 MGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLS 341
           +G+    +   F  G MFW R +A+  I +L        +     DG   HA+ER     
Sbjct: 689 IGLEKICETPLFPLGNMFWARVDAIRDIFSLN-EDMILQEEPLPRDGSYMHALERIIPNI 747

Query: 342 VKKANFRISDVD 353
           V+K  ++   V 
Sbjct: 748 VEKNGYKYVTVY 759


>gi|241668058|ref|ZP_04755636.1| glycosyl transferase, group 1 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 756

 Score =  232 bits (592), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 62/252 (24%), Positives = 103/252 (40%), Gaps = 15/252 (5%)

Query: 106 MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT-LVTESASIKSEILKI 164
           +    +  I  K AI +HL+YIDL  E       L   +DL++T + + ++    E    
Sbjct: 510 LPINSEKNISHKFAIHLHLFYIDLADEFNEYFKLLPKGYDLYITIIDSNNSEFIKEKFSS 569

Query: 165 FP--AARIHIMENHGRDVLPFLILLETEQL-SNYDYVCKIHGKKSKRKGYSWWEGDLWRR 221
                  I  ++N GRD+ P +  L+ + L   Y+ V   H KK+         GD WR 
Sbjct: 570 SGAANVEIVAVDNIGRDIAPMIFGLKDQLLNRGYEIVGHFHSKKTV--SAHDNLGDKWRA 627

Query: 222 WLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGR 281
           +L  +L+G    +   I        IG++      Y +        +G+N+  +  L   
Sbjct: 628 YLLNNLIGDNEQISNSILNLFNDEKIGLVFPEDRTYID--------IGENKFYVDELCTA 679

Query: 282 MGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLS 341
           +G+    +   F  G MFW R +A+  I +L        +     DG   HA+ER     
Sbjct: 680 IGLEKICETPLFPLGNMFWARVDAIRDIFSLN-EDMILQEEPLPRDGSYMHALERIIPNI 738

Query: 342 VKKANFRISDVD 353
           V+K  ++   V 
Sbjct: 739 VEKNGYKYVTVY 750


>gi|194364297|ref|YP_002026907.1| hypothetical protein Smal_0519 [Stenotrophomonas maltophilia
           R551-3]
 gi|194347101|gb|ACF50224.1| conserved hypothetical protein [Stenotrophomonas maltophilia
           R551-3]
          Length = 686

 Score =  232 bits (591), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 63/266 (23%), Positives = 108/266 (40%), Gaps = 16/266 (6%)

Query: 96  QLLHGW---ESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT 152
           +L H W      AM        +    +V+H +++D   E+ + + +  +   L +T  +
Sbjct: 417 RLGHAWLQATRRAMTPSQPAPSRP--CVVIHAWHLDALPELLSAVKDSGLPARLVITTTS 474

Query: 153 ESASIKSEILKIFPA-ARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGY 211
           +  +    I +     A I   +NHGRD+LPFL   +     N   V K+H K+S     
Sbjct: 475 DRQAQVQSITESHGLPAEIWAYDNHGRDILPFLHAADRLLQQNESLVLKLHTKRST---- 530

Query: 212 SWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKN 271
               GD WRR +   LLG        +        +G++    +       +    +G N
Sbjct: 531 HRDNGDQWRREMVDALLGPAQAAAN-LAHLQADPRLGLMAPAGHLL-----NVADYIGGN 584

Query: 272 REMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
            + +  L  ++G+        F +G+MFWVR +AL P+ +  L           +DG + 
Sbjct: 585 AQRMERLWAQLGLDGAPGDGQFASGSMFWVRLQALRPLLDAHLLPSMFEVEAGQIDGTLA 644

Query: 332 HAVERCFSLSVKKANFRISDVDCILG 357
           HA+ER        A F + D   + G
Sbjct: 645 HAIERATGAVATCAGFSVGDTSQVHG 670


>gi|330899783|gb|EGH31202.1| hypothetical protein PSYJA_20361 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 626

 Score =  232 bits (591), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 102/240 (42%), Gaps = 11/240 (4%)

Query: 113 AIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIK-SEILKIFPAAR-- 169
           A +  +A+ +H++Y D   + ++ L+N     D+ +TL       K   +    P  +  
Sbjct: 114 AARLNVAVCLHIFYEDYIEKFSHALANFPTQVDVFITLADAKHQKKTIAVFSKHPRVKNL 173

Query: 170 -IHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLL 228
            +  + N GR+  P L+    + ++ YD  C +H KKS   G    E   W  +L   LL
Sbjct: 174 KVRCVPNRGRNFGPLLVEFSKDLMA-YDLFCHLHSKKSLYSGR---EQTQWADYLTEYLL 229

Query: 229 GAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQD 288
               ++ +++  F  H+D+G+     +     + ++      N+  +        I   D
Sbjct: 230 RDANIITRLLNAFADHKDLGLYYPTTFWMMPSWVNHVT---MNKSFMAAWHNEWQIAPCD 286

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
             L + AG MFW R EAL  +        F P+     DG + HA+ER   L  +K  ++
Sbjct: 287 GFLSYPAGGMFWARPEALKDMLEKEYDYDFFPQEPLPNDGSMLHALERVIGLLAEKNGYK 346


>gi|167627488|ref|YP_001677988.1| group 1 glycosyl transferase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167597489|gb|ABZ87487.1| glycosyl transferase, group 1 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 763

 Score =  231 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 62/252 (24%), Positives = 103/252 (40%), Gaps = 15/252 (5%)

Query: 106 MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT-LVTESASIKSEILKI 164
           +    +  I  K AI +HL+YIDL  E       L   +DL++T + + ++    E    
Sbjct: 517 LPINSEKNISHKFAIHLHLFYIDLADEFNEYFKLLPKGYDLYITIIDSNNSEFIKEKFSS 576

Query: 165 FP--AARIHIMENHGRDVLPFLILLETEQL-SNYDYVCKIHGKKSKRKGYSWWEGDLWRR 221
                  I  ++N GRD+ P +  L+ + L   Y+ V   H KK+         GD WR 
Sbjct: 577 SGAANVEIVAVDNIGRDIAPMIFGLKDQLLNRGYEIVGHFHSKKTV--SAHDNLGDKWRA 634

Query: 222 WLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGR 281
           +L  +L+G    +   I        IG++      Y +        +G+N+  +  L   
Sbjct: 635 YLLNNLIGDNEQISNSILNLFNDEKIGLVFPEDRTYID--------IGENKFYVDELCTA 686

Query: 282 MGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLS 341
           +G+    +   F  G MFW R +A+  I +L        +     DG   HA+ER     
Sbjct: 687 IGLEKICETPLFPLGNMFWARVDAIRDIFSLN-EDMILQEEPLPRDGSYMHALERIIPNI 745

Query: 342 VKKANFRISDVD 353
           V+K  ++   V 
Sbjct: 746 VEKNGYKYVTVY 757


>gi|325915787|ref|ZP_08178089.1| Putative glycosyltransferase [Xanthomonas vesicatoria ATCC 35937]
 gi|325538051|gb|EGD09745.1| Putative glycosyltransferase [Xanthomonas vesicatoria ATCC 35937]
          Length = 695

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 73/272 (26%), Positives = 117/272 (43%), Gaps = 17/272 (6%)

Query: 96  QLLHGWESPAMGKVMQIA------IKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
           +L H W       + + A         +  +VVH +Y+D+  EI + L+       L VT
Sbjct: 420 RLGHAWLDATRQAMTRSAHDVPAPRTYRACVVVHAWYLDVLDEILDALAPSVAMLRLIVT 479

Query: 150 LV-TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
              T    ++  + +    A +   EN GRD+LPFL +           V K+H KKS  
Sbjct: 480 TDLTLVGQVRGRLQQHGIEAEVEGFENRGRDILPFLHIANRLLDEGEQLVVKLHTKKST- 538

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
                 +GD WRR +   LLG  G V  I+  F     +G+     +         T  +
Sbjct: 539 ---HRHDGDAWRREMLAALLGG-GRVDAIVNAFVADPQLGLAAPAQHLL-----AVTDFI 589

Query: 269 GKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDG 328
           G N + +  LA R G     +   F +G+MFW + +AL P+ +  L           +DG
Sbjct: 590 GGNADALDYLAVRTGTGTVTEHDRFASGSMFWAKLDALRPLLDAHLQPGDFEGEQGQIDG 649

Query: 329 EIEHAVERCFSLSVKKANFRISDVDCILGYRK 360
            + HA+ER    +V  +  RI+ +D ++G R+
Sbjct: 650 TLAHAIERFLGHAVLHSGHRIATIDGLMGQRE 681


>gi|296876714|ref|ZP_06900762.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           parasanguinis ATCC 15912]
 gi|296432216|gb|EFH18015.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           parasanguinis ATCC 15912]
          Length = 582

 Score =  230 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 82/381 (21%), Positives = 145/381 (38%), Gaps = 44/381 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFF---FWFWTLF---YKRSKKLCYDE-NY 59
           S  +  F    + +    D  +  +  +   F    F + T+F   ++ +  + Y + +Y
Sbjct: 149 SSAFLEFWQGVQDFTNVQDVIDNYETKVTTNFLDAGFRYKTVFDTIHEDTTGMLYPDFSY 208

Query: 60  VVAYGSRSGKKFFAQSN---------LYMMERELHFDGQRIHHFPQLLHGWESPAMG--- 107
                  + K  F +            Y+ +         +      +   + P      
Sbjct: 209 YNPTAILNHKVPFIKVKTIANNEGIMPYIFDELERVSNYPLDLILNHMSMIDRPDFPYLL 268

Query: 108 -----KVMQIAIK--AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV--TESASIK 158
                K  ++A     K+A+ +H++Y+DL  E  +   +    +DL +T     +  +I+
Sbjct: 269 SRKYLKKQELAGDFDKKVAVHLHVFYVDLLEEFLDAFRDFHFDYDLWITTDVEEKKQAIE 328

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
             +      AR+ +  N GRDVLP L+L   EQLS YDYV   H KKSK   +  W G+ 
Sbjct: 329 QILSNRAQDARVVVTGNIGRDVLPMLLL--KEQLSKYDYVGHFHTKKSKEADF--WAGES 384

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK-YCDYTCSLGKNREMICT 277
           WR+ L   L+       +I+   + +  +G+  +    +          +       +  
Sbjct: 385 WRKELIEMLVKPAD---QILANMEANPKVGITIADIPTFFRYNRIVVAWNEALISPEMNK 441

Query: 278 LAGRMGITF-----QDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L  RMG T      +        GT  W + +AL P+ +L L+    P         I H
Sbjct: 442 LWQRMGATKTIDFEKINTFVMSYGTFVWFKYDALKPLFDLNLTAADVPAEPLP-QNSILH 500

Query: 333 AVERCFSLSV--KKANFRISD 351
           A+ER        +K +FRIS 
Sbjct: 501 AIERLLIYIAWDQKYDFRISQ 521


>gi|55823377|ref|YP_141818.1| polysaccharide biosynthesis protein [Streptococcus thermophilus
           CNRZ1066]
 gi|55739362|gb|AAV63003.1| polysaccharide biosynthesis protein [Streptococcus thermophilus
           CNRZ1066]
          Length = 581

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 84/385 (21%), Positives = 147/385 (38%), Gaps = 46/385 (11%)

Query: 3   VSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFF---FWFWTLFYKRSK---KLCYD 56
           +  CS  +  F    + +    D  +  +  +   F    F + T+F+   +    + + 
Sbjct: 147 IESCS--FHEFWQGVQDFTNVQDVIDNYETKITTNFLDAGFRYKTVFHTIHEDTTGMLHP 204

Query: 57  E-NYVVAYGSRSGKKFFAQSNLYMMERELH---FDG-QRIHHFP-----QLLHGWESPAM 106
           + +Y         K  F +       + +    FD  +R+  +P       +   + P  
Sbjct: 205 DFSYYNPTAILKHKVPFIKVKSIANNQGIMPYIFDELERVSDYPLDLILNHMSMIDRPDY 264

Query: 107 G--------KVMQIAIK--AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV--TES 154
                    K  ++      K+A+ +H++Y+DL  E  +   +   ++DL +T     + 
Sbjct: 265 PYLLSRKYLKNQELTGDFDKKVAVHLHVFYVDLLEEFLDAFQDFHFAYDLWITTDIEEKK 324

Query: 155 ASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWW 214
             I+  + +    A I +  N GRDVLP L+L   E+LS YDYV   H KKSK   +  W
Sbjct: 325 QEIEQILSRRSQDATIVVTGNIGRDVLPMLLL--KEKLSRYDYVGHFHTKKSKEADF--W 380

Query: 215 EGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK-YCDYTCSLGKNRE 273
            G+ WR+ L   L+       +I+   + +  +G+       Y          +      
Sbjct: 381 AGESWRKELIDMLVKPAD---QILANMEANPKVGITIGDIPTYFRYNRIVVAWNEALISP 437

Query: 274 MICTLAGRMGITFQDQK-----LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDG 328
            +  L  RMG T               GT  W + +AL P+ +L L+    P        
Sbjct: 438 EMNKLWQRMGATKNIDFKNLNTFVMSYGTFVWFKYDALKPLFDLNLTVSDVPAEPLP-QN 496

Query: 329 EIEHAVERCFSLSV--KKANFRISD 351
            I HA+ER        +K +FRIS 
Sbjct: 497 SILHAIERLLVYIAWDQKYDFRISQ 521


>gi|134297301|ref|YP_001121036.1| lipopolysaccharide biosynthesis protein-like protein [Burkholderia
            vietnamiensis G4]
 gi|134140458|gb|ABO56201.1| Lipopolysaccharide biosynthesis protein-like protein [Burkholderia
            vietnamiensis G4]
          Length = 1231

 Score =  230 bits (587), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 72/238 (30%), Positives = 112/238 (47%), Gaps = 10/238 (4%)

Query: 119  AIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV-TESASIKSEILKIFPAARIHIMENHG 177
            A+V HLYY DL  E+ +L+    ++ D  +T+    S     EIL       +  ++N G
Sbjct: 998  ALVAHLYYFDLLPELLSLIERN-VNLDAFITIPVHFSREQVGEILASLDNVYVLRVQNRG 1056

Query: 178  RDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKI 237
            RD+LPFL +    +  +Y  + K+H KKS +      +G L R+    +LL  P +V  +
Sbjct: 1057 RDILPFLNIYPIIKSYSYANLVKVHSKKSPQ----RADGALLRKRALLELL-DPSIVPGV 1111

Query: 238  IRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGT 297
            +R  +T   IG+I            DY  +   NR+ +     R+G+       +F AG+
Sbjct: 1112 LRALNTDPKIGLIAPSNSLCSLSNSDYLIN---NRKQLNYCLSRLGLVDSSLNFEFIAGS 1168

Query: 298  MFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCI 355
            MFW R +AL  + +L L      +    LDG + HA+ER F    K   +R   VD I
Sbjct: 1169 MFWARVDALRMLSDLSLREEDFEEELGQLDGTLAHAIERLFCFLGKHVGYRTLPVDQI 1226


>gi|319939379|ref|ZP_08013739.1| RgpFc protein [Streptococcus anginosus 1_2_62CV]
 gi|319811365|gb|EFW07660.1| RgpFc protein [Streptococcus anginosus 1_2_62CV]
          Length = 587

 Score =  229 bits (585), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 80/380 (21%), Positives = 139/380 (36%), Gaps = 45/380 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFF-------FWFWTLFYKRSKKLCYDENY 59
           S  +  F  + K+     +  N  +  +   F          F T+    +  L  D +Y
Sbjct: 155 SSAFRNFWENVKNHTDVQEVINDYETKVTTTFLAAGFRYQTVFDTVNEDTTGMLHPDFSY 214

Query: 60  VVAYGSRSGKKFFAQSN---------LYMMERELHFDGQRI---------HHFPQLLHGW 101
                  + K  F +            Y++E         +          +FP   +  
Sbjct: 215 YNPTAILNHKVPFIKVKAIDNNQHIAPYLLEEIAKKSDYPVDLIVSHMSEINFPDFKYLL 274

Query: 102 ESPAMGKVMQIAIK-AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIK 158
               +      ++   KI + +H++Y+DL  +      N   ++DL +T   ++    I+
Sbjct: 275 ARKYIQTTAPTSLSNKKIGVHLHVFYVDLLEDFLKAFENFHFAYDLFITTDNDTKKLEIE 334

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
           + + +    A I +  N GRDVLP L L +   LS YDY+   H KKSK   +  W G+ 
Sbjct: 335 AILNQNHKNAHIFVTGNIGRDVLPMLKLKK--YLSTYDYIGHFHTKKSKEADF--WAGES 390

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK-YCDYTCSLGKNREMICT 277
           WR  L   L+        I+  F+ +  +G++ S    +          +       +  
Sbjct: 391 WRNELIDMLIKPAD---NILANFE-NDKLGLVISDIPTFFRYNKIVDAWNEHLIAPEMND 446

Query: 278 LAGRMGITFQDQKLDF-----FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L  +M +T       F       GT  W + +AL P+ +L L+    P         I H
Sbjct: 447 LWYKMKMTKPIDFNTFHTFVMSYGTFIWFKYDALKPLFDLDLTDKDVPIEPLP-QNSILH 505

Query: 333 AVERCFSLSV--KKANFRIS 350
           A+ER        +  +FRIS
Sbjct: 506 AIERLIVYVAWNEHYDFRIS 525


>gi|116628171|ref|YP_820790.1| polysaccharide biosynthesis protein [Streptococcus thermophilus
           LMD-9]
 gi|116101448|gb|ABJ66594.1| Lipopolysaccharide biosynthesis protein [Streptococcus thermophilus
           LMD-9]
          Length = 581

 Score =  229 bits (585), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 84/385 (21%), Positives = 147/385 (38%), Gaps = 46/385 (11%)

Query: 3   VSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFF---FWFWTLFYKRSK---KLCYD 56
           +  CS  +  F    + +    D  +  +  +   F    F + T+F+   +    + + 
Sbjct: 147 IESCS--FHEFWQGVQDFTNVQDVIDNYETKITTNFLDAGFRYKTVFHTIHEDTTGMLHP 204

Query: 57  E-NYVVAYGSRSGKKFFAQSNLYMMERELH---FDG-QRIHHFP-----QLLHGWESPAM 106
           + +Y         K  F +       + +    FD  +R+  +P       +   + P  
Sbjct: 205 DFSYYNPTAILKHKVPFIKVKSIANNQGIMPYIFDELERVSDYPLDLILNHMSMIDRPDY 264

Query: 107 G--------KVMQIAIK--AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV--TES 154
                    K  ++      K+A+ +H++Y+DL  E  +   +   ++DL +T     + 
Sbjct: 265 PYLLSRKYLKNQELTGDFDKKVAVHLHVFYVDLLEEFLDAFQDFHFAYDLWITTDVEEKK 324

Query: 155 ASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWW 214
             I+  + +    A I +  N GRDVLP L+L   E+LS YDYV   H KKSK   +  W
Sbjct: 325 QEIEQILSRRSQDATIVVTGNIGRDVLPMLLL--KEKLSRYDYVGHFHTKKSKEADF--W 380

Query: 215 EGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK-YCDYTCSLGKNRE 273
            G+ WR+ L   L+       +I+   + +  +G+       Y          +      
Sbjct: 381 AGESWRKELIDMLVKPAD---QILANMEANPKVGITIGDIPTYFRYNRIVVAWNEALISP 437

Query: 274 MICTLAGRMGITFQDQK-----LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDG 328
            +  L  RMG T               GT  W + +AL P+ +L L+    P        
Sbjct: 438 EMNKLWQRMGATKNIDFKNLNTFVMSYGTFVWFKYDALKPLFDLNLTVSDVPAEPLP-QN 496

Query: 329 EIEHAVERCFSLSV--KKANFRISD 351
            I HA+ER        +K +FRIS 
Sbjct: 497 SILHAIERLLVYIAWDQKYDFRISQ 521


>gi|325928537|ref|ZP_08189725.1| Lipopolysaccharide biosynthesis protein [Xanthomonas perforans
            91-118]
 gi|325541076|gb|EGD12630.1| Lipopolysaccharide biosynthesis protein [Xanthomonas perforans
            91-118]
          Length = 1415

 Score =  229 bits (585), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 68/257 (26%), Positives = 116/257 (45%), Gaps = 18/257 (7%)

Query: 99   HGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIK 158
                 P M +  +     ++A+V+H +Y ++  E+   L +  + + L ++ V + A   
Sbjct: 1155 RALRRPVMPRTPE-----RVAVVIHAFYPEILPEMLKELQSWDVPYFLIISTVADKADEV 1209

Query: 159  SEILKIFPA-ARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGD 217
               L      A + + EN GRD+LPFL +++  +      V K+H K+S        +G+
Sbjct: 1210 RGYLADLSVVADVRVFENRGRDILPFLEIMKDLR-GRESLVLKLHTKRSL----HRQDGE 1264

Query: 218  LWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICT 277
             WRR +   LL    V  +I   F     +G+     +         T   G N + +  
Sbjct: 1265 SWRRDMLEKLLAPK-VASEIFAAFREQERLGLAAPEGH-----ILSMTTYWGANADTVHR 1318

Query: 278  LAGRMGI-TFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVER 336
            L+ +M +         F AG+MF+VR EA+D I +L L R         +DG + HA+ER
Sbjct: 1319 LSKQMHVDPVNPVTAMFAAGSMFYVRPEAIDSIMDLDLRREDFEPEAGQVDGTLAHAIER 1378

Query: 337  CFSLSVKKANFRISDVD 353
            CFSL+V    + I+  +
Sbjct: 1379 CFSLAVCSTGYYIASSN 1395


>gi|312866008|ref|ZP_07726229.1| rhamnan synthesis protein F [Streptococcus downei F0415]
 gi|311098412|gb|EFQ56635.1| rhamnan synthesis protein F [Streptococcus downei F0415]
          Length = 584

 Score =  229 bits (584), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 75/383 (19%), Positives = 141/383 (36%), Gaps = 47/383 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFW---FWTLFYKRSKKLCYDENY 59
           S  +  F    + +    +     +  +        F +   F TL       L  D +Y
Sbjct: 149 SSAFQEFWQGVEDFTDVQEVIGQYETRVTTALTDVGFKYDAVFNTLDASTDGMLHPDFSY 208

Query: 60  VVAYGSRSGKKFFAQSN---------LYMMERELHFDGQRIHHFPQLLHGWESPAMG--- 107
                  + +  F +            Y++ +        +      +     P +    
Sbjct: 209 YNPTAILNARVPFIKVKTIDANQSITPYILNQIEATSDYPVGLIVSHMTNIGQPDLPYLL 268

Query: 108 --------KVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SI 157
                   +  ++  ++K+A+ +H++Y+DL  E  +       ++DL +T   E     I
Sbjct: 269 ARKYLEQAEAEELPAESKVAVHLHVFYVDLLQEFLDAFKTFHFAYDLFITTDKEEKRAEI 328

Query: 158 KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGD 217
           ++ + +    A+I +  N GRDVLP L L   +QL  YDY+   H KKSK   Y  W G 
Sbjct: 329 QAILEQNQVLAQIFVTGNIGRDVLPMLKL--KDQLKGYDYIGHFHTKKSKEADY--WAGQ 384

Query: 218 LWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKN--REMI 275
            WR+ L   L+       +I+     +  +G++ +    +  ++     +  +N     +
Sbjct: 385 SWRQELIAMLVKPAN---QILAQMAKNDRLGIVIADMPSFF-RFNKIVVAWNENLIAPEM 440

Query: 276 CTLAGRMGITFQ-----DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEI 330
             L  +M +                GT  W + +AL P+ +L L+  + P         I
Sbjct: 441 EELWEKMSLKKSIDFKAMDTFVMSYGTYAWFKYDALSPLFDLDLTDEYVPAEPLP-QNSI 499

Query: 331 EHAVERCFSLSV--KKANFRISD 351
            HA+ER        K  ++RIS 
Sbjct: 500 LHAIERLLIYIAWDKHYDYRISP 522


>gi|262282406|ref|ZP_06060174.1| rhamnosyltransferase [Streptococcus sp. 2_1_36FAA]
 gi|262261697|gb|EEY80395.1| rhamnosyltransferase [Streptococcus sp. 2_1_36FAA]
          Length = 582

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 80/380 (21%), Positives = 137/380 (36%), Gaps = 44/380 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWG-------GFFFWFWTLFYKRSKKLCYDENY 59
           S+ + LF  + + +    D  +  +  +          +   F T+    S  L  D +Y
Sbjct: 148 SETFQLFWQNIQDYTEVQDVIDHYETQVTTNLVQAGFHYQTVFNTIQADASGMLYPDFSY 207

Query: 60  VVAYGSRSGKKFFAQSNLYMMEREL-HF---DGQRIHHFP-----QLLHGWESPAMGKVM 110
                    +  F +         L  +   D +    +P     + +   + P    ++
Sbjct: 208 YNPTSILKNRVPFIKVKTIAANEGLTPYILNDIENTTDYPVDLIVKHMSRIDLPDYPYLL 267

Query: 111 QIAI----------KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIK 158
              I            KIA+ +H++Y+DL  E  +   +   S+DL +T  +E     I 
Sbjct: 268 GRKILDLSLPISIPDKKIAVHLHVFYVDLLAEFLHAFESFHFSYDLFITTDSEKKKNEIL 327

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
             +      A + +  N GRDVLP L L     LS YDY+   H KKSK   Y  W G+ 
Sbjct: 328 DILEGKQAKAEVLVTGNVGRDVLPMLKLKR--HLSQYDYIGHFHTKKSKEADY--WAGES 383

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAY-RYPNKYCDYTCSLGKNREMICT 277
           WR+ L   L+       +I+        +G++ +     +         +       +  
Sbjct: 384 WRKELINMLVHPAD---QIVSQLGQDDRLGLVIADIPSFFRFNRIVVAWNEALISPEMNK 440

Query: 278 LAGRMGITFQDQK-----LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L  RM    +             GT  W + +AL P+ +L L+    P         I H
Sbjct: 441 LWERMNCQKEVDFKQMNTFVMSYGTFVWFKYDALSPLFDLNLTEEDVPSEPLP-QNSILH 499

Query: 333 AVERCFSLSV--KKANFRIS 350
           A+ER        K+ +F+IS
Sbjct: 500 AIERLLVYIAWDKQYDFKIS 519


>gi|322516362|ref|ZP_08069287.1| rhamnosyltransferase [Streptococcus vestibularis ATCC 49124]
 gi|322125095|gb|EFX96488.1| rhamnosyltransferase [Streptococcus vestibularis ATCC 49124]
          Length = 581

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 83/381 (21%), Positives = 145/381 (38%), Gaps = 44/381 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFF---FWFWTLF---YKRSKKLCYDE-NY 59
           S  +  F    + +    +  +  +  +   F    F + T+F   ++ +  + Y + +Y
Sbjct: 149 SSAFHEFWQGVQDFTNVQNVIDHYETKVTTNFLNAGFRYKTVFDTIHEDTTGMLYPDFSY 208

Query: 60  VVAYGSRSGKKFFAQSNLYMMERELH---FDG-QRIHHFP-----QLLHGWESPAMG--- 107
                  + K  F +         +    FD  +RI  +P       +   + P      
Sbjct: 209 YNPTAILNHKVPFIKVKTIANNEGIMPYIFDELERISDYPLDLILNHMSMIDRPDYPYLL 268

Query: 108 -----KVMQIAI--KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV--TESASIK 158
                K  ++      K+A+ +H++Y+DL  E  +        +DL +T     +  +I+
Sbjct: 269 SHKYLKGQELVENFDRKVAVHLHVFYVDLLEEFLDAFQAFHFIYDLWITTDVEEKKQAIE 328

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
             +      A + +  N GRDVLP L+L   EQLS YDYV   H KKSK   +  W G+ 
Sbjct: 329 KILSNRVQDATVVVTGNIGRDVLPMLLL--KEQLSRYDYVGHFHTKKSKEADF--WAGES 384

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK-YCDYTCSLGKNREMICT 277
           WR+ L   L+    +   I+   + +  +G+  +    +          +       +  
Sbjct: 385 WRKELIEMLVKPADL---ILANMEANPKVGITIADIPTFFRYNRIVVAWNEALISPEMNK 441

Query: 278 LAGRMGITFQDQK-----LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L  RMG T               GT  W + +AL P+ +L L+    P         I H
Sbjct: 442 LWQRMGATKTIDFKSLNTFVMSYGTFVWFKYDALKPLFDLNLTAADVPAEPLP-QNSILH 500

Query: 333 AVERCFSLSV--KKANFRISD 351
           A+ER        +K +FRIS 
Sbjct: 501 AIERLLIYIAWDQKYDFRISQ 521


>gi|320330331|gb|EFW86314.1| hypothetical protein PsgRace4_09215 [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 774

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 105/240 (43%), Gaps = 11/240 (4%)

Query: 113 AIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEIL----KIFPAA 168
           A +  +AI +H++Y D   + ++ L+N  I+ D+ +TL   +   K+             
Sbjct: 262 AARLNVAICLHIFYEDYIEKFSHALANFPIAVDVFITLAAPNHKKKTIATFGQHPRVKNL 321

Query: 169 RIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLL 228
           ++  + N GR+  P L+    + ++ YD  C +H KKS   G    E   W  +L   LL
Sbjct: 322 KVSCVPNRGRNFGPLLVEFSKDLMA-YDLFCHLHSKKSLYSGR---EQTQWADYLTEYLL 377

Query: 229 GAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQD 288
               ++ +++  F  H+D+G+     +     + ++      N+  +        I   +
Sbjct: 378 RDANIITRLLNAFVDHKDLGLYYPTTFWMMPSWVNHVT---MNKAFMNAWHNEWQIDPCE 434

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
             L + AG MFW R EAL  +     +  F P+     DG + HA+ER   L  +K  ++
Sbjct: 435 GFLSYPAGGMFWARPEALKEMLEKEYTYDFFPQEPLPNDGSMLHALERVIGLLAEKNGYK 494


>gi|304309760|ref|YP_003809358.1| hypothetical protein HDN1F_01080 [gamma proteobacterium HdN1]
 gi|301795493|emb|CBL43691.1| hypothetical protein HDN1F_01080 [gamma proteobacterium HdN1]
          Length = 1315

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 64/262 (24%), Positives = 106/262 (40%), Gaps = 15/262 (5%)

Query: 92  HHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV 151
           H +P+ L       + K       A IAI +HLYY DL       LS +   FDL++++ 
Sbjct: 422 HPYPEQLKQLHELTLPKHTS---NATIAIHIHLYYADLAPTFVQALSRMERPFDLYISIQ 478

Query: 152 TESASIKSEILKI----FPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSK 207
             +  ++ E +           I    N GRD+ PF+ +   E L  YD +  +H KKS 
Sbjct: 479 VRANPVEIEAVVRKIPCLRGLDIRATPNLGRDLYPFVCIFG-EALRKYDIIAHLHSKKSL 537

Query: 208 RKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCS 267
              Y+      W  ++   L  +P  + +I+         G++  + +   +       +
Sbjct: 538 ---YNQGATAGWLEYILDSLFRSPEDIARILERLSDASQTGIVYPQNF---SGLPYMAYT 591

Query: 268 LGKNREMICTLAGRMGITF-QDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKAL 326
              NR     +  R G+T       D+ AG+MFW R +A+ P    +L+           
Sbjct: 592 WLANRSRAQQVQARFGLTSLPSGYFDYPAGSMFWARADAIAPFFEAQLNEDDFENESGQT 651

Query: 327 DGEIEHAVERCFSLSVKKANFR 348
           DG + H +ER   L  +   FR
Sbjct: 652 DGTLAHTLERFLVLVPESLGFR 673


>gi|319946716|ref|ZP_08020950.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           australis ATCC 700641]
 gi|319746764|gb|EFV99023.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           australis ATCC 700641]
          Length = 581

 Score =  227 bits (578), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 83/381 (21%), Positives = 144/381 (37%), Gaps = 44/381 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFF---FWFWTLF---YKRSKKLCYDE-NY 59
           S  +  F    + +    D  +  +  +   F    F + T+F   ++ +  + Y + +Y
Sbjct: 149 SSTFHEFWQGVQDFTNVQDVIDNYETKVTTNFLDAGFRYKTVFDTIHEDTTGMLYPDFSY 208

Query: 60  VVAYGSRSGKKFFAQSNLYMMERELH---FDG-QRIHHFP-----QLLHGWESPAMG--- 107
                    K  F +         +    FD  +R+  +P       +   + P      
Sbjct: 209 YNPTVILKHKVPFIKVKTIANNEGIMPYIFDELERVSDYPLDLILNHMSMIDRPDYPYLL 268

Query: 108 -------KVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV--TESASIK 158
                  + +      K+A+ +H++Y+DL  E  +       ++DL +T     +  +I+
Sbjct: 269 SRKYLKDQDLGDTFDKKVAVHLHVFYVDLLEEFLDAFQAFHFAYDLWITTDVEEKKQAIE 328

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
             +      A + +  N GRDVLP L+L   EQLS+YDYV   H KKSK   +  W G+ 
Sbjct: 329 EILSNRAQVATVVVTGNIGRDVLPMLLL--KEQLSHYDYVGHFHTKKSKEADF--WAGES 384

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK-YCDYTCSLGKNREMICT 277
           WR+ L   L+       KI+   + +  +G+  +    +          +       +  
Sbjct: 385 WRKELIDMLVKPAD---KILANMEANPKVGITIADIPTFFRYNRIVVAWNEVLISPEMNK 441

Query: 278 LAGRMGIT-----FQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L  RMG T               GT  W + +AL P+ +L L     P         I H
Sbjct: 442 LWQRMGATKTIDFKNLNTFVMSYGTFVWFKYDALKPLFDLNLKAADVPAEPLP-QNSILH 500

Query: 333 AVERCFSLSV--KKANFRISD 351
           A+ER        +K +FRIS 
Sbjct: 501 AIERLLVYIAWDQKYDFRISQ 521


>gi|306831662|ref|ZP_07464819.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           gallolyticus subsp. gallolyticus TX20005]
 gi|325978600|ref|YP_004288316.1| rhamnosyltransferase [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|304426087|gb|EFM29202.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           gallolyticus subsp. gallolyticus TX20005]
 gi|325178528|emb|CBZ48572.1| rhamnosyltransferase [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 586

 Score =  227 bits (578), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 76/375 (20%), Positives = 139/375 (37%), Gaps = 43/375 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCYDENYVVA 62
           S+ +  F    +++       +  +      F    F +   L         +  N+ + 
Sbjct: 153 SEVFQEFWKSVEAYTDVQKVIDNYETKYTKRFVDAGFRYASVLNTVPIADNFFHSNFTIH 212

Query: 63  Y--GSRSGKKFFAQSNLY-MMERELHF--------DGQRIHHFPQLLHGWESPAMG---- 107
           Y          F +   + + +    +                   +     P       
Sbjct: 213 YPHVLLDNHIPFIKIKTFDLTQHLAPYLLKEIERVSNYPTKLILDHMSDISLPTPPYLLD 272

Query: 108 -KVMQIAIK-----AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIKS 159
            KV+++  K      K+A+ +H +Y+DL  E  N   N    +DL +T  TE+    I+S
Sbjct: 273 RKVLKVVEKEYSNTKKVAVHLHTFYVDLLEEFLNQFENFHFDYDLFLTTDTEAKKAEIES 332

Query: 160 EILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLW 219
            + K    A++ +  N GRD++P L L   E+LS+YDY+   H KKS    Y  W GD W
Sbjct: 333 ILEKNGKIAQVFLTGNRGRDIIPMLKL--KEELSSYDYIGHFHTKKSPEYPY--WVGDSW 388

Query: 220 RRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNR--EMICT 277
           R  L+  L+ +      I+   + + ++G++ +    +  +Y        +NR  + +  
Sbjct: 389 RNELYQMLIQSAD---NILANLENNDNLGLVIADIPSFF-RYTKIVDPWNENRFADGMNE 444

Query: 278 LAGRMGIT-----FQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L  RM +                GT  W + + L P+ +L L+    P         I H
Sbjct: 445 LWERMNLERQIDFNNLSTFIMSYGTFIWFKRDTLKPLFDLELTDDEIPSEPIP-QHTILH 503

Query: 333 AVERCFSLSVKKANF 347
           ++ER         N+
Sbjct: 504 SIERILVYLAWANNY 518


>gi|157151529|ref|YP_001450315.1| rhamnosyltransferase [Streptococcus gordonii str. Challis substr.
           CH1]
 gi|157076323|gb|ABV11006.1| rhamnosyltransferase [Streptococcus gordonii str. Challis substr.
           CH1]
          Length = 582

 Score =  226 bits (577), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 79/380 (20%), Positives = 137/380 (36%), Gaps = 44/380 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWG-------GFFFWFWTLFYKRSKKLCYDENY 59
           S+ + LF  + + +    D  +  +  +          +   F T+    S  L  D +Y
Sbjct: 148 SEAFQLFWQNIQDFTEVQDVIDHYETQVTTNLVQAGFHYQTVFNTIQADASGMLYPDFSY 207

Query: 60  VVAYGSRSGKKFFAQSNLYMMEREL-HF---DGQRIHHFP-----QLLHGWESPAMGKVM 110
                    +  F +         L  +   D +    +P     + +   + P    ++
Sbjct: 208 YNPTSILKNRVPFIKVKTIAANEGLTPYILNDIENTTDYPVDLIVKHMSRIDLPDYPYLL 267

Query: 111 QIAI----------KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIK 158
              I            KIA+ +H++Y+DL  E  +   +   S+DL +T  +E     I 
Sbjct: 268 GRKILDLSLPISLPDKKIAVHLHVFYVDLLAEFLHAFESFHFSYDLFITTDSEKKKNEIL 327

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
             +      A + +  N GRDVLP L L     LS YDY+   H KKSK   Y  W G+ 
Sbjct: 328 GILEGKQAKAEVFVTGNVGRDVLPMLKLKR--HLSQYDYIGHFHTKKSKEADY--WAGES 383

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAY-RYPNKYCDYTCSLGKNREMICT 277
           WR+ L   L+       +I+        +G++ +     +         +       +  
Sbjct: 384 WRKELINMLVHPAD---QIVSQLGQDDCLGLVIADIPSFFRFNRIVVAWNEALISPEMNK 440

Query: 278 LAGRMGITFQDQK-----LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L  RM    +             GT  W + +AL P+ +L ++    P         I H
Sbjct: 441 LWERMNCQKEVDFKQMNTFVMSYGTFVWFKYDALSPLFDLNMTEEDVPSEPLP-QNSILH 499

Query: 333 AVERCFSLSV--KKANFRIS 350
           A+ER        K+ +F+IS
Sbjct: 500 AIERLLVYIAWDKQYDFKIS 519


>gi|330882679|gb|EGH16828.1| hypothetical protein Pgy4_27710 [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 608

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 105/240 (43%), Gaps = 11/240 (4%)

Query: 113 AIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEIL----KIFPAA 168
           A +  +AI +H++Y D   + ++ L+N  I+ D+ +TL   +   K+             
Sbjct: 96  AARLNVAICLHIFYEDYIEKFSHALANFPIAVDVFITLAAPNHKKKTIATFGQHPRVKNL 155

Query: 169 RIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLL 228
           ++  + N GR+  P L+    + ++ YD  C +H KKS   G    E   W  +L   LL
Sbjct: 156 KVSCVPNRGRNFGPLLVEFSKDLMA-YDLFCHLHSKKSLYSGR---EQTQWADYLTEYLL 211

Query: 229 GAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQD 288
               ++ +++  F  H+D+G+     +     + ++      N+  +        I   +
Sbjct: 212 RDANIITRLLNAFVDHKDLGLYYPTTFWMMPSWVNHVT---MNKAFMNAWHNEWQIDPCE 268

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
             L + AG MFW R EAL  +     +  F P+     DG + HA+ER   L  +K  ++
Sbjct: 269 GFLSYPAGGMFWARPEALKEMLEKEYTYDFFPQEPLPNDGSMLHALERVIGLLAEKNGYK 328


>gi|306833804|ref|ZP_07466929.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus bovis
           ATCC 700338]
 gi|304423998|gb|EFM27139.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus bovis
           ATCC 700338]
          Length = 586

 Score =  225 bits (573), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 75/375 (20%), Positives = 140/375 (37%), Gaps = 43/375 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCYDENYVVA 62
           S+ +  F    +++       +  +      F    F +   L         +  N+ + 
Sbjct: 153 SEVFQEFWKSVEAYTDVQKVIDNYETKYTKRFVDAGFRYASVLNTVPIADNFFHSNFTIH 212

Query: 63  Y--GSRSGKKFFAQSNLY-MMERELHF--------DGQRIHHFPQLLHGWESPAMG---- 107
           Y          F +   + +++    +                   +     P       
Sbjct: 213 YPHVLLDNHVPFIKIKTFDLIQHLAPYLLKEIEKVSNYPTKLILDHMSDISLPTPPYLLD 272

Query: 108 -KVMQIAIK-----AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIKS 159
            KV+++  K      K+A+ +H +Y+DL  E  N   N    +DL +T  TE+    I+S
Sbjct: 273 RKVLKVVEKEYSNTKKVAVHLHTFYVDLLEEFLNQFENFHFDYDLFLTTDTEAKKAEIES 332

Query: 160 EILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLW 219
            + K    A++ +  N GRD++P L L   E+LS+YDY+   H KKS    Y  W GD W
Sbjct: 333 ILEKNGKTAQVFLTGNRGRDIIPMLKL--KEELSSYDYIGHFHTKKSPEYPY--WVGDSW 388

Query: 220 RRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNR--EMICT 277
           R  L+  L+ +      ++   + + ++G++ +    +  +Y        +NR  + +  
Sbjct: 389 RNELYQMLIQSAD---NVLANLENNDNLGLVIADIPSFF-RYTKIVDPWNENRFADGMNE 444

Query: 278 LAGRMGIT-----FQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L  RM +                GT  W + + L P+ +L L+    P         I H
Sbjct: 445 LWERMNLGRQIDFNNLSTFIMSYGTFIWFKHDTLKPLFDLELTDDEIPSEPIP-QHTILH 503

Query: 333 AVERCFSLSVKKANF 347
           ++ER         N+
Sbjct: 504 SIERILVYLAWANNY 518


>gi|288905572|ref|YP_003430794.1| polysaccharide biosynthesis protein (RgpF) [Streptococcus
           gallolyticus UCN34]
 gi|288732298|emb|CBI13867.1| Putative polysaccharide biosynthesis protein (RgpF) [Streptococcus
           gallolyticus UCN34]
          Length = 586

 Score =  224 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 75/375 (20%), Positives = 138/375 (36%), Gaps = 43/375 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCYDENYVVA 62
           S+ +  F    +++       +  +      F    F +   L         +  N+ + 
Sbjct: 153 SEVFQEFWKSVEAYTDVQKVIDNYETKYTKRFVDAGFRYASVLNTVPIADNFFHSNFTIH 212

Query: 63  Y--GSRSGKKFFAQSNLY-MMERELHF--------DGQRIHHFPQLLHGWESPAMG---- 107
           Y          F +   + + +    +                   +     P       
Sbjct: 213 YPHVLLDNHIPFIKIKTFDLTQHLAPYLLKEIERVSNYPTKLILDHMSDISLPTPPYLLD 272

Query: 108 -KVMQIAIK-----AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIKS 159
            KV+++  K      K+A+ +H +Y+DL  E  N   N    +DL +T  TE+    I+S
Sbjct: 273 RKVLKVVEKEYSNTKKVAVHLHTFYVDLLEEFLNQFENFHFDYDLFLTTDTEAKKAEIES 332

Query: 160 EILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLW 219
            + K    A++ +  N GRD++P L L   E+LS+YDY+   H KKS    Y  W GD W
Sbjct: 333 ILEKNGKIAQVFLTGNRGRDIIPMLKL--KEELSSYDYIGHFHTKKSPEYPY--WVGDSW 388

Query: 220 RRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNR--EMICT 277
           R  L+  L+ +      I+   + + ++G++ +    +  +Y        +NR  + +  
Sbjct: 389 RNELYQMLIQSAD---NILANLENNDNLGLVIADIPSFF-RYTKIVDPWNENRFADGMNE 444

Query: 278 LAGRMGIT-----FQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L   M +                GT  W + + L P+ +L L+    P         I H
Sbjct: 445 LWECMNLERQIDFNNLSTFIMSYGTFIWFKRDTLKPLFDLELTDDEIPSEPIP-QHTILH 503

Query: 333 AVERCFSLSVKKANF 347
           ++ER         N+
Sbjct: 504 SIERILVYLAWANNY 518


>gi|329116186|ref|ZP_08244903.1| rhamnan synthesis protein F [Streptococcus parauberis NCFD 2020]
 gi|326906591|gb|EGE53505.1| rhamnan synthesis protein F [Streptococcus parauberis NCFD 2020]
          Length = 589

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 82/381 (21%), Positives = 143/381 (37%), Gaps = 47/381 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFF-------FWFWTLFYKRSKKLCYDENY 59
           S+ ++ F    K      +  +  +  +   F          F T+    S+ L  D +Y
Sbjct: 155 SESFYNFWLGIKDLTNVDEVISNYETKVTTTFIDAGFKYDVIFNTVNEDASQLLHADFSY 214

Query: 60  VVAYGSRSGKKFFAQSN---------LYMMERELHFDGQRIHHFPQLLHGWESPA----- 105
                    +  F +            Y+++         +    + +     P      
Sbjct: 215 YHPTAILQHRVPFIKVKAIDNNQHITPYLLDYIKIESTYPVDLIVEHMSDINYPDFKYLL 274

Query: 106 -----MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV--TESASIK 158
                   +    I  K+AI +H +Y+DL  E  +   N    +DL +T     +   I+
Sbjct: 275 ANKYLKSDLPSEVINKKVAIHLHTFYVDLLQEFLSAFENFHFDYDLFITTDIEEKKTQIE 334

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
           + + +    A + +  N GRDVLP L+L   E+LS YDY+   H KKSK   +  W G+ 
Sbjct: 335 NVLNENNQKAEVFVTGNIGRDVLPMLLL--KEKLSVYDYIGHFHTKKSKEADF--WAGES 390

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKN--REMIC 276
           WR+ L   L+        I+ T + +  +G++ +    Y  +Y     +  +N     + 
Sbjct: 391 WRKELIKMLVLPAD---SILATLEKN-KVGIVIADMPTYF-RYNKIVTAWNENLIAPEMN 445

Query: 277 TLAGRMGITFQDQK-----LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
            L  +MG+T               GT  W + +AL P+ +L L+    P         I 
Sbjct: 446 ELWKKMGLTKSIDFNHLHTFVMSYGTFVWFKYDALKPLFDLNLTVEDVPAEPLP-QNSIL 504

Query: 332 HAVERCFSLSV--KKANFRIS 350
           HA+ER        +  +FRIS
Sbjct: 505 HAIERLLIYIAWNQHYDFRIS 525


>gi|32455988|ref|NP_861990.1| rb115 [Ruegeria sp. PR1b]
 gi|22726340|gb|AAN05136.1| RB115 [Ruegeria sp. PR1b]
          Length = 963

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 70/313 (22%), Positives = 125/313 (39%), Gaps = 30/313 (9%)

Query: 51  KKLCYDENYVVAYGSRSGKKFFAQSNLYMMERE----LHFDGQRIHHFPQLLHGWESPAM 106
           + L  + +       RS +    +      +R        +   + H  +     + P  
Sbjct: 94  QGLEMEGHSAPFSRDRSWRHPDLRRFGCARQRGPLETTPVEYGPVRHVLRFESDRQPPLP 153

Query: 107 GKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEI----- 161
                   K ++ + +HLYY+D+  E+  LL+ L ++F+L ++L   +     E+     
Sbjct: 154 --------KGRLVVQLHLYYVDMAAEMIALLARLPVTFELLLSLPETAVVADEEMISLFR 205

Query: 162 --LKIFPAARIHIMENHGRDVLPFLILLETEQ--LSNYDYVCKIHGKKSKRKGYSWWEGD 217
             L+   A  +  + N GRDV P+++   +E   L++ D V  +H KKS    Y      
Sbjct: 206 AGLERLGAITLRRVPNRGRDVAPWMVSFRSELRALADRDLVLHLHSKKSPHGNYHV---- 261

Query: 218 LWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICT 277
            W R+L + LLG+  V  +++  F    ++G++    +    +      + GK  ++   
Sbjct: 262 GWGRYLGHSLLGSTAVAAQMLGLFAEDPELGLVAPAYWPALRR----APNYGKVGDLCAH 317

Query: 278 LAGRMGI-TFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVER 336
           L  RMG+        DF AG+ F  R   L P   L L     P     + G + HAVER
Sbjct: 318 LFRRMGLGEVDPICADFPAGSFFCARAAVLRPFLTLGLEARDFPAEAGQICGTLAHAVER 377

Query: 337 CFSLSVKKANFRI 349
                  +   R 
Sbjct: 378 LLGQVPARLGLRF 390


>gi|285019449|ref|YP_003377160.1| hypothetical protein XALc_2689 [Xanthomonas albilineans GPE PC73]
 gi|283474667|emb|CBA17166.1| conserved hypothetical protein [Xanthomonas albilineans]
          Length = 686

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 104/240 (43%), Gaps = 14/240 (5%)

Query: 121 VVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKI--FPAARIHIMENHGR 178
           +VH +Y ++  E+ N L+  ++ + L VT   + AS     L+   FP   + ++EN GR
Sbjct: 442 IVHAWYPNVLPELLNPLAASALPWRLLVTTSPDQASAVQAQLRDCSFP-YEVMVLENRGR 500

Query: 179 DVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKII 238
           D+LPFL   E       D V K+H K+S         GD WR  L   L G      +I+
Sbjct: 501 DILPFLHAGERLLQDGVDVVLKLHTKRST----HLHNGDAWRSELLQRLAG-ADRAARIL 555

Query: 239 RTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGI-TFQDQKLDFFAGT 297
             F     +G++    +  P          G NR     L  R G       +  F +G+
Sbjct: 556 EAFAQDPMLGLVAPEGHLLP-----LADFWGGNRMAADYLLRRTGYTDVCLDEAHFISGS 610

Query: 298 MFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILG 357
           MFWVR  AL P+ +  L           +DG + HA ER  +L  +   +R++    ++G
Sbjct: 611 MFWVRLHALRPLLDSHLCPSEFEPEQGQIDGTLAHAAERVTALLAQHRGYRVATAAELIG 670


>gi|312867647|ref|ZP_07727853.1| rhamnan synthesis protein F [Streptococcus parasanguinis F0405]
 gi|311096710|gb|EFQ54948.1| rhamnan synthesis protein F [Streptococcus parasanguinis F0405]
          Length = 582

 Score =  224 bits (570), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 84/382 (21%), Positives = 141/382 (36%), Gaps = 46/382 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFF---FWFWTLF---YKRSKKLCYD--EN 58
           S  +  F    + +    D  +  +  +   F    F + T+F   ++ +  + Y     
Sbjct: 149 SNAFPEFWQGVQDFTNVQDVIDHYETKVTTNFLDAGFRYKTVFDTIHEDTTGMLYPDFSY 208

Query: 59  YVVAYGSRSGKKFFAQSNLYMMEREL----HFDGQRIHHFP-----QLLHGWESPAMG-- 107
           Y      R  K  F +         +      + +RI  +P       +   + P     
Sbjct: 209 YNPTAILR-HKVPFIKVKTIANNEGIIPYIFDELERISDYPLDLILNHMSMIDRPDYPYL 267

Query: 108 ------KVMQIAI--KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESAS--I 157
                 K  ++A     K+A+ +H++Y+DL  E  +        +DL +T   E     I
Sbjct: 268 LSRKYVKNQELAENFDRKVAVHLHVFYVDLLEEFLDAFQAFHFVYDLWITTDVEEKKQTI 327

Query: 158 KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGD 217
           +  +      A + +  N GRDVLP L+L   EQLS YDYV   H KKSK   +  W G+
Sbjct: 328 EKILSNRAQDATVVVTGNIGRDVLPMLLL--KEQLSQYDYVGHFHTKKSKEADF--WAGE 383

Query: 218 LWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK-YCDYTCSLGKNREMIC 276
            WR+ L   L+       +I+   + +  +G+  +    +          +       + 
Sbjct: 384 SWRKELIEMLVKPAD---QILANMEANPKVGITIADIPTFFRYNRIVVAWNEALISPEMN 440

Query: 277 TLAGRMGIT-----FQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
            L  RMG                 GT  W + +AL P+ +L L+    P         I 
Sbjct: 441 KLWERMGAAKTIDFKNLNTFVMSYGTFVWFKYDALKPLFDLNLTAANVPAEPLP-QNSIL 499

Query: 332 HAVERCFSLSV--KKANFRISD 351
           HA+ER        +K +FRIS 
Sbjct: 500 HAIERLLIYIAWDQKYDFRISQ 521


>gi|55821450|ref|YP_139892.1| polysaccharide biosynthesis protein [Streptococcus thermophilus LMG
           18311]
 gi|55737435|gb|AAV61077.1| polysaccharide biosynthesis protein [Streptococcus thermophilus LMG
           18311]
          Length = 594

 Score =  223 bits (569), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 73/264 (27%), Positives = 111/264 (42%), Gaps = 21/264 (7%)

Query: 102 ESPAMGKVMQIAIK-AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIK 158
           +   + K  Q      KIA+ +H YY+DL  +      N   ++DL +T  +E     I+
Sbjct: 272 DRKVIEKSSQTYSDTKKIAVHLHTYYVDLLEDFLKQFENFHFTYDLFLTTDSEDKKAEIQ 331

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
           S + K    ARI I  N GRDV+P L L   ++LS YDY+   H KKS    Y  W GD 
Sbjct: 332 SILDKNGKVARIFITGNRGRDVIPMLKL--KDELSAYDYIGHFHTKKSPEYPY--WVGDS 387

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNR--EMIC 276
           WR  LF  L+        II   +    +G++ +    +  +Y        +NR  E + 
Sbjct: 388 WRNELFSMLIQPAD---NIIANLERDDRLGLVIADIPSFF-RYTKIVDPWNENRFAEGMN 443

Query: 277 TLAGRMGITFQDQK-----LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
            L  RM +                GT  W + +AL P+ +L L     P         I 
Sbjct: 444 DLWERMDLGRDIDFDKMNTFIMSYGTFIWFKYDALKPLFDLDLQDEEIPAEPIP-QHTIL 502

Query: 332 HAVERCFSL--SVKKANFRISDVD 353
           H++ER        ++ ++ I+  D
Sbjct: 503 HSIERILVYLAWARRYDYAIAKND 526


>gi|225868697|ref|YP_002744645.1| rhamnan synthesis protein F family protein [Streptococcus equi
           subsp. zooepidemicus]
 gi|225701973|emb|CAW99527.1| rhamnan synthesis protein F family protein [Streptococcus equi
           subsp. zooepidemicus]
          Length = 581

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 79/380 (20%), Positives = 139/380 (36%), Gaps = 45/380 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFF---FWFWTL--------------FYKR 49
           SK +  F  +        D  +  +  +   F    F + T+               +  
Sbjct: 149 SKEFRQFWENIVELTDVQDVIHNYETRITTVFVEAGFRYKTVFDTTKEDSSSMLHADFSY 208

Query: 50  SKKLCYDENYVVAYGSR--SGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPA-- 105
                  +++V     +     +  A   L  ++++  +    I      +H  ++    
Sbjct: 209 YNPTAILKHHVPFIKVKAIDANQHIAPYLLDFIDQKTTYPASLIVDHMSQVHLPDAKYLL 268

Query: 106 -----MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIK 158
                  + + I    KIA+ +H++Y+DL  E     S+    +DL +T  +++    IK
Sbjct: 269 AHKYLPEQPISIDQSKKIAVHLHVFYVDLLSEFLEAFSHFHFDYDLLITTDSKAKKAEIK 328

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
             + +   +A I +  N GRDVLP L L   E+LS YDY+   H KKSK   +  W G  
Sbjct: 329 EILRESGASADILVTGNIGRDVLPMLTL--KERLSQYDYIGHFHTKKSKEADF--WAGQS 384

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAY-RYPNKYCDYTCSLGKNREMICT 277
           WR  L   ++     +   +        IG++ +     +         +       +  
Sbjct: 385 WRTELIDMMVKPADQILTALAA----DAIGIVIADIPSFFRFNKIVDAWNEHLIAPEMNQ 440

Query: 278 LAGRMGITFQ-----DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L   MG+T +             GT  W + +AL P+ +L LS    P         I H
Sbjct: 441 LWQAMGLTKRIDFQTMDTFVMSYGTFVWFKYDALKPLFDLDLSEADIPAEPLP-QNSILH 499

Query: 333 AVERCFSLSV--KKANFRIS 350
           A+ER        +  +FRIS
Sbjct: 500 AIERLLIYIAWDRHYDFRIS 519


>gi|225870347|ref|YP_002746294.1| rhamnan synthesis protein F family protein [Streptococcus equi
           subsp. equi 4047]
 gi|225699751|emb|CAW93520.1| rhamnan synthesis protein F family protein [Streptococcus equi
           subsp. equi 4047]
          Length = 581

 Score =  222 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 79/380 (20%), Positives = 139/380 (36%), Gaps = 45/380 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFF---FWFWTL--------------FYKR 49
           SK +  F  +        D  +  +  +   F    F + T+               +  
Sbjct: 149 SKEFRQFWENIVELTDVQDVIHNYETRITTVFVEAGFRYKTVFDTTKEDSSSMLHADFSY 208

Query: 50  SKKLCYDENYVVAYGSR--SGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPA-- 105
                  +++V     +     +  A   L  ++++  +    I      +H  ++    
Sbjct: 209 YNPTAILKHHVPFIKVKAIDANQHIAPYLLDFIDQKTTYPASLIVDHMSQVHPPDAKYLL 268

Query: 106 -----MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIK 158
                  + + I    KIA+ +H++Y+DL  E     S+    +DL +T  +++    IK
Sbjct: 269 AHKYLPEQPISIDQSKKIAVHLHVFYVDLLSEFLEAFSHFHFDYDLLITTDSKAKKAEIK 328

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
             + +   +A I +  N GRDVLP L L   E+LS YDY+   H KKSK   +  W G  
Sbjct: 329 EILRESGASADILVTGNIGRDVLPMLTL--KERLSQYDYIGHFHTKKSKEADF--WAGQS 384

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAY-RYPNKYCDYTCSLGKNREMICT 277
           WR  L   ++     +   +        IG++ +     +         +       +  
Sbjct: 385 WRTELIDMMVKPADQILTALAA----DAIGIVIADIPSFFRFNKIVDAWNEHLIAPEMNQ 440

Query: 278 LAGRMGITFQ-----DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L   MG+T +             GT  W + +AL P+ +L LS    P         I H
Sbjct: 441 LWQAMGLTKRIDFQTMDTFVMSYGTFVWFKYDALKPLFDLDLSEADIPAEPL-SQNSILH 499

Query: 333 AVERCFSLSV--KKANFRIS 350
           A+ER        +  +FRIS
Sbjct: 500 AIERLLIYIAWDRHYDFRIS 519


>gi|296135664|ref|YP_003642906.1| glycosyl transferase family 2 [Thiomonas intermedia K12]
 gi|295795786|gb|ADG30576.1| glycosyl transferase family 2 [Thiomonas intermedia K12]
          Length = 1414

 Score =  222 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 80/243 (32%), Positives = 111/243 (45%), Gaps = 19/243 (7%)

Query: 119 AIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGR 178
           A+++HLYY DLW E    L  L    D++V+L      + ++I++  P A +    N GR
Sbjct: 281 AVLLHLYYPDLWPEFLAHLKTLPAPCDVYVSLSEGREELLTDIVRDLPDAVVMRHPNKGR 340

Query: 179 DVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWW---------EGDLWRRWLFYDLLG 229
           D+ P L LL   +  NY  +  +HGKKS                 +GD WRR L   LL 
Sbjct: 341 DIAPRLALLRLARAHNYKQLLFLHGKKSPHLKEVENIHIPFLQHKDGDRWRRELLAALL- 399

Query: 230 APGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQ 289
                 K I  F     +G+IG   +               N   +   A RMGIT    
Sbjct: 400 --DASEKTIAAFAQQPKLGLIGPHGFWL-------GLRGDANFPRLSAQAQRMGITPDPA 450

Query: 290 KLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRI 349
           +  +FAG+MFW R +ALDP+  L L            DG + H VER F+LS +KA F+I
Sbjct: 451 RHGYFAGSMFWCRPQALDPLLALDLKDADFEDETGQTDGTLAHVVERLFALSAEKAGFQI 510

Query: 350 SDV 352
           +D 
Sbjct: 511 ADT 513


>gi|195977971|ref|YP_002123215.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus equi
           subsp. zooepidemicus MGCS10565]
 gi|195974676|gb|ACG62202.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus equi
           subsp. zooepidemicus MGCS10565]
          Length = 581

 Score =  222 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 79/380 (20%), Positives = 139/380 (36%), Gaps = 45/380 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFF---FWFWTL--------------FYKR 49
           SK +  F  +        D  +  +  +   F    F + T+               +  
Sbjct: 149 SKEFRQFWENIVELTDVQDVIHNYETRITTVFVEAGFRYKTVFDTTKEDSSSMLHADFSY 208

Query: 50  SKKLCYDENYVVAYGSR--SGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPA-- 105
                  +++V     +     +  A   L  ++++  +    I      +H  ++    
Sbjct: 209 YNPTAILKHHVPFIKVKAIDANQHIAPYLLDFIDQKTSYPASLIVDHMSQVHLPDAKYLL 268

Query: 106 -----MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESA--SIK 158
                  + + IA   KIA+ +H++Y DL  E     S+    +DL +T  +++    IK
Sbjct: 269 AHKYLSNQPISIAPSKKIAVHLHVFYADLLSEFLEAFSHFHFDYDLLITTDSKAKKAEIK 328

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
             + +   +A I +  N GRDVLP L L   E+LS YDY+   H KKSK   +  W G  
Sbjct: 329 EILRESGASADILVTGNIGRDVLPMLTL--KERLSQYDYIGHFHTKKSKEADF--WAGQS 384

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAY-RYPNKYCDYTCSLGKNREMICT 277
           WR  L   ++     +   +        IG++ +     +         +       +  
Sbjct: 385 WRTELIDMMVKPADQILTALAA----DAIGIVIADIPSFFRFNKIVDAWNEHLIAPEMNQ 440

Query: 278 LAGRMGITFQ-----DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           L   MG+T +             GT  W + +AL P+ +L L+    P         I H
Sbjct: 441 LWQAMGLTKRIDFQTMDTFVMSYGTFVWFKYDALKPLFDLGLNEADIPAEPLP-QNSILH 499

Query: 333 AVERCFSLSV--KKANFRIS 350
           A+ER        +  +FRIS
Sbjct: 500 AIERLLIYIAWDRHYDFRIS 519


>gi|320325880|gb|EFW81940.1| hypothetical protein PsgB076_04646 [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 774

 Score =  222 bits (565), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 104/240 (43%), Gaps = 11/240 (4%)

Query: 113 AIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEIL----KIFPAA 168
           A +  +AI +H++Y D   + ++ L+N  I+ D+ +TL   +   K+             
Sbjct: 262 AARLNVAICLHIFYEDYIEKFSHALANFPIAVDVFITLAAPNHKKKTIATFGQHPRVKNL 321

Query: 169 RIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLL 228
           ++  + N  R+  P L+    + ++ YD  C +H KKS   G    E   W  +L   LL
Sbjct: 322 KVSCVPNRERNFGPLLVEFSKDLMA-YDLFCHLHSKKSLYSGR---EQTQWADYLTEYLL 377

Query: 229 GAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQD 288
               ++ +++  F  H+D+G+     +     + ++      N+  +        I   +
Sbjct: 378 RDANIITRLLNAFVDHKDLGLYYPTTFWMMPSWVNHVT---MNKAFMNAWHNEWQIDPCE 434

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
             L + AG MFW R EAL  +     +  F P+     DG + HA+ER   L  +K  ++
Sbjct: 435 GFLSYPAGGMFWARPEALKEMLEKEYTYDFFPQEPLPNDGSMLHALERVIGLLAEKNGYK 494


>gi|323135560|ref|ZP_08070643.1| Rhamnan synthesis F [Methylocystis sp. ATCC 49242]
 gi|322398651|gb|EFY01170.1| Rhamnan synthesis F [Methylocystis sp. ATCC 49242]
          Length = 812

 Score =  221 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 62/247 (25%), Positives = 104/247 (42%), Gaps = 13/247 (5%)

Query: 110 MQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT-ESASIKSEILKIFPA- 167
            + A +  IA +VH +Y ++   +   L N++   DL  +  T E      ++ + +P  
Sbjct: 139 PKPARERPIAAIVHGFYPEIAPLVLEKLKNVTGPVDLFFSTDTQEKKHALEDVCRDWPKG 198

Query: 168 -ARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYD 226
              I I  N GRD+              YD    +H K+S   G        WR +LF +
Sbjct: 199 RVEIRICPNRGRDIAAKFFGFRDVYAD-YDLFIHLHTKRSPHGG---AALARWRDYLFDN 254

Query: 227 LLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITF 286
           LLG+P +V  I+  F     IG++  +             + G + +    L  RMG+  
Sbjct: 255 LLGSPEIVNSILSLF-DDPKIGVVFPQHLFELRGI----LNWGYDYDHARALMKRMGVEI 309

Query: 287 QDQ-KLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKA 345
                L+F +G+MFW R+ A  P+ +L +     P+    +DG + HA+ER   +  +  
Sbjct: 310 DKNLVLEFPSGSMFWGRSAAFRPLLDLDIDFDDFPQEGGQVDGTLAHAIERSLLMIAESR 369

Query: 346 NFRISDV 352
            F    V
Sbjct: 370 GFEWLKV 376


>gi|222152862|ref|YP_002562039.1| rhamnan synthesis protein F family protein [Streptococcus uberis
           0140J]
 gi|222113675|emb|CAR41606.1| rhamnan synthesis protein F family protein [Streptococcus uberis
           0140J]
          Length = 585

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 74/279 (26%), Positives = 118/279 (42%), Gaps = 24/279 (8%)

Query: 82  RELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLS 141
            ++H+         + L   E  +  KV +      IA+ +H++Y+DL  E  +  ++  
Sbjct: 257 SDIHYPDAPYLLSQKYLEKQEE-SDLKVSE----HSIAVHLHVFYVDLLEEFLHAFTSFK 311

Query: 142 ISFDLHVTLV--TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVC 199
             FDL++T     + + IK+ +     +A+I +  N GRDVLP L L   ++LS YDY+ 
Sbjct: 312 FPFDLYITTDKSEKESEIKAILDSFRVSAKIVVTGNIGRDVLPMLKL--KDELSQYDYIG 369

Query: 200 KIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPN 259
             H KKSK   +  W G+ WR  L   L+        II  F+    IG+I +    +  
Sbjct: 370 HFHTKKSKEADF--WAGESWRNELIDMLIKPAN---TIINQFE-DPAIGIIIADIPSFFR 423

Query: 260 KYCDYTC-SLGKNREMICTLAGRMGITFQDQKLDF-----FAGTMFWVRTEALDPIKNLR 313
                T  +       +  L  +M ++       F       GT  W + +AL P+ +L 
Sbjct: 424 FNKIVTPLNEHLIAPEMNKLWEKMNLSKTIDFEQFDTFVMSYGTFVWFKYDALKPLFDLN 483

Query: 314 LSRYFEPKVHKALDGEIEHAVERCFSLSV--KKANFRIS 350
           L     PK        I HAVER           +FRI+
Sbjct: 484 LKDGDVPKEPLP-QNSILHAVERLLIYIAWDSHFDFRIA 521


>gi|94990172|ref|YP_598272.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS10270]
 gi|94543680|gb|ABF33728.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS10270]
          Length = 581

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 62/244 (25%), Positives = 106/244 (43%), Gaps = 19/244 (7%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIM 173
            K+A+ +H++Y+DL  E      + +  +DL +T  ++     IK  + +    A I + 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            N GRD+ P L+L   ++LS YDY+   H KKSK   +  W G+ WR+ L   L+     
Sbjct: 344 GNRGRDIYPMLLL--KDKLSQYDYIGHFHTKKSKEADF--WAGESWRKELIDMLVKPAD- 398

Query: 234 VFKIIRTFDTHRDIGMIGSRAY-RYPNKYCDYTCSLGKNREMICTLAGRMGITF-----Q 287
              I+  F+T+ DIG+I +     +         +     + + +L  +M +        
Sbjct: 399 --SILSAFETN-DIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA 455

Query: 288 DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSV--KKA 345
                   GT  W + +AL  + +L L++   P         I HA+ER           
Sbjct: 456 MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLP-QNSILHAIERLLVYIAWGNSY 514

Query: 346 NFRI 349
           +FRI
Sbjct: 515 DFRI 518


>gi|94988294|ref|YP_596395.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS9429]
 gi|94992170|ref|YP_600269.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS2096]
 gi|94541802|gb|ABF31851.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS9429]
 gi|94545678|gb|ABF35725.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS2096]
          Length = 581

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 62/244 (25%), Positives = 106/244 (43%), Gaps = 19/244 (7%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIM 173
            K+A+ +H++Y+DL  E      + +  +DL +T  ++     IK  + +    A I + 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            N GRD+ P L+L   ++LS YDY+   H KKSK   +  W G+ WR+ L   L+     
Sbjct: 344 GNRGRDIYPMLLL--KDKLSQYDYIGHFHTKKSKEADF--WAGESWRKELIDMLVKPAD- 398

Query: 234 VFKIIRTFDTHRDIGMIGSRAY-RYPNKYCDYTCSLGKNREMICTLAGRMGITF-----Q 287
              I+  F+T+ DIG+I +     +         +     + + +L  +M +        
Sbjct: 399 --SILSAFETN-DIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA 455

Query: 288 DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSV--KKA 345
                   GT  W + +AL  + +L L++   P         I HA+ER           
Sbjct: 456 MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLP-QNSILHAIERLLVYIAWGNSY 514

Query: 346 NFRI 349
           +FRI
Sbjct: 515 DFRI 518


>gi|21910063|ref|NP_664331.1| hypothetical protein SpyM3_0527 [Streptococcus pyogenes MGAS315]
 gi|28896239|ref|NP_802589.1| hypothetical protein SPs1327 [Streptococcus pyogenes SSI-1]
 gi|21904254|gb|AAM79134.1| putative protein [Streptococcus pyogenes MGAS315]
 gi|28811490|dbj|BAC64422.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1]
          Length = 581

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 62/244 (25%), Positives = 106/244 (43%), Gaps = 19/244 (7%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIM 173
            K+A+ +H++Y+DL  E      + +  +DL +T  ++     IK  + +    A I + 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            N GRD+ P L+L   ++LS YDY+   H KKSK   +  W G+ WR+ L   L+     
Sbjct: 344 GNRGRDIYPMLLL--KDKLSQYDYIGHFHTKKSKEADF--WAGESWRKELIDMLVKPAD- 398

Query: 234 VFKIIRTFDTHRDIGMIGSRAY-RYPNKYCDYTCSLGKNREMICTLAGRMGITF-----Q 287
              I+  F+T+ DIG+I +     +         +     + + +L  +M +        
Sbjct: 399 --SILSAFETN-DIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA 455

Query: 288 DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSV--KKA 345
                   GT  W + +AL  + +L L++   P         I HA+ER           
Sbjct: 456 MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLP-QNSILHAIERLLVYIAWGNSY 514

Query: 346 NFRI 349
           +FRI
Sbjct: 515 DFRI 518


>gi|71735705|ref|YP_273244.1| hypothetical protein PSPPH_0972 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71556258|gb|AAZ35469.1| conserved hypothetical protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 1262

 Score =  220 bits (560), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 65/239 (27%), Positives = 99/239 (41%), Gaps = 15/239 (6%)

Query: 117 KIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTES-----ASIKSEILKIFPAARIH 171
           +I + +HLYY DL   I+  L+N+ ++FDL ++   E        I S+ +       I 
Sbjct: 211 RIGVYLHLYYTDLLGAISKHLNNIPLAFDLFISTPHELDHKKLRKIVSDSVTNVKEISIK 270

Query: 172 IMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAP 231
            + N GRD+ PF+I    E L  YD +C IH KKS+           W   +   LLG+ 
Sbjct: 271 HVPNRGRDIAPFIIEFGNE-LQAYDAICHIHTKKSEHTKG----LSDWGDDILSSLLGSR 325

Query: 232 GVVFKIIRTFDTHRDIGMIGSRA-YRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQK 290
             V KI+        I  I       Y      ++ +    + ++              K
Sbjct: 326 EDVKKILTLLKGDAKI--IYPEGQNYYMKDPTGWSENHEIAKHILSDHLETD--ISNFPK 381

Query: 291 LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRI 349
            +F  G+MFW R E +    N+ L     P+     DG + HA+ER   +S   A  RI
Sbjct: 382 AEFPEGSMFWARQEGIQSFLNIPLDWEDFPEEPIPTDGTLAHALERIILISAYAAPGRI 440


>gi|50913971|ref|YP_059943.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS10394]
 gi|50903045|gb|AAT86760.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS10394]
          Length = 581

 Score =  220 bits (560), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 62/244 (25%), Positives = 106/244 (43%), Gaps = 19/244 (7%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIM 173
            K+A+ +H++Y+DL  E      + +  +DL +T  ++     IK  + +    A I + 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            N GRD+ P L+L   ++LS YDY+   H KKSK   +  W G+ WR+ L   L+     
Sbjct: 344 GNRGRDIYPMLLL--KDKLSQYDYIGHFHTKKSKEADF--WAGESWRKELIDMLVKPAD- 398

Query: 234 VFKIIRTFDTHRDIGMIGSRAY-RYPNKYCDYTCSLGKNREMICTLAGRMGITF-----Q 287
              I+  F+T+ DIG+I +     +         +     + + +L  +M +        
Sbjct: 399 --SILSAFETN-DIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA 455

Query: 288 DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSV--KKA 345
                   GT  W + +AL  + +L L++   P         I HA+ER           
Sbjct: 456 MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLP-QNSILHAIERLLVYIAWGNSY 514

Query: 346 NFRI 349
           +FRI
Sbjct: 515 DFRI 518


>gi|281490695|ref|YP_003352675.1| bifunctional alpha-L-Rha
           alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Lactococcus lactis
           subsp. lactis KF147]
 gi|281374464|gb|ADA63985.1| Alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Lactococcus lactis
           subsp. lactis KF147]
          Length = 589

 Score =  219 bits (559), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 83/383 (21%), Positives = 150/383 (39%), Gaps = 46/383 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKR--SKKLCYDE-NY 59
           S+ +  F  +   +    D  +  ++     F    F +   L  +   +K L + + +Y
Sbjct: 151 SQIFEDFWKNIVDYTNVQDVIDHYEIQSTKIFMDAGFKYESVLDTRALDAKNLLHPDFSY 210

Query: 60  VVAYGSRSGKKFFAQSNLY-----------MMER---------ELHFDGQRIHHFPQLLH 99
                    K  F +   +           M++           L  D      +P L  
Sbjct: 211 YAPDVILKEKVPFIKVKAFQSIQSNGIAYYMLDYIDRNTDYPKSLVVDHLSTIGYPDLNF 270

Query: 100 GWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESAS--I 157
              S  +  + +  +   +A+ +H+YY +L  E  +   N S  +DL++T  T+     I
Sbjct: 271 LLPSKMITSLSKTVLHQTVAVHLHVYYPELLEEFLDAFKNFSFDYDLYLTTNTDEKEEII 330

Query: 158 KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGD 217
           K  +      A++    NHGRD++PFL L   E+L  YD V   H K+S    +  + G+
Sbjct: 331 KEMLKCKDARAKLVRTPNHGRDIVPFLAL--KEELKKYDIVGHFHTKRSLEAAF--FAGE 386

Query: 218 LWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGS--RAYRYPNKYCDYTCSLGKNREMI 275
            WR  L   L+        I+  F+  + +G++ +   ++   NK  +      +   ++
Sbjct: 387 SWRTELISMLI---EPADNIMAHFEQKQKLGIVIADIPSFFRFNKIVNADNENKQIAPIM 443

Query: 276 CTLAGRMGITFQDQKLDF-----FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEI 330
             +  RM +  +    DF       GT FW +TE L+P+ NL +     P         I
Sbjct: 444 NDIWKRMKMNKKVNFHDFNTFTMSYGTFFWAKTEVLEPLFNLEIMDREIPNEPLP-QNTI 502

Query: 331 EHAVERCFSLSV--KKANFRISD 351
            HA+ER        K+ +F+IS 
Sbjct: 503 LHAIERVLIYLAWDKEMDFKISP 525


>gi|190572709|ref|YP_001970554.1| putative glycosyltransferase protein [Stenotrophomonas maltophilia
           K279a]
 gi|190010631|emb|CAQ44240.1| putative glycosyltransferase protein [Stenotrophomonas maltophilia
           K279a]
          Length = 707

 Score =  219 bits (559), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 69/264 (26%), Positives = 110/264 (41%), Gaps = 12/264 (4%)

Query: 96  QLLHGW-ESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV-TE 153
           +L H W ++         A  ++  IV+H +Y+D   E+   + +  +   L +T     
Sbjct: 438 RLGHAWLQATRRALFPSQAAPSRPCIVIHAWYLDALPELLQAVKDSGLQARLVITTTGER 497

Query: 154 SASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSW 213
            A ++S I      A I + +NHGRDVLPFL   +     N   V K+H K+S       
Sbjct: 498 QAQVQSIIDAEGLTAEIWVYDNHGRDVLPFLHAADRLLQQNESLVLKLHTKRST----HR 553

Query: 214 WEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNRE 273
             GD WRR +   LLG       +      +  IG++    +            +G N +
Sbjct: 554 DNGDQWRREMVDALLGTAQAAANLAHL-LANPSIGLMAPAGHLL-----KVADYIGGNAQ 607

Query: 274 MICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHA 333
            +  L   +G+        F +G+MFWVR  AL P+ +  L           +DG + HA
Sbjct: 608 RMERLWALLGLDSAPGDGQFASGSMFWVRLPALRPLLDAHLLPSMFDTEAGQIDGTLAHA 667

Query: 334 VERCFSLSVKKANFRISDVDCILG 357
           +ER     V  A F ++D   + G
Sbjct: 668 IERATGAVVSAAGFTVADTSEVEG 691


>gi|15672189|ref|NP_266363.1| polysaccharide biosynthesis protein [Lactococcus lactis subsp.
           lactis Il1403]
 gi|12723062|gb|AAK04305.1|AE006258_8 polysaccharide biosynthesis protein [Lactococcus lactis subsp.
           lactis Il1403]
          Length = 589

 Score =  218 bits (556), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 82/383 (21%), Positives = 148/383 (38%), Gaps = 46/383 (12%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKR--SKKLCYDE-NY 59
           S+ +  F  +   +    D  +  ++     F    F +   L  +   +K L + + +Y
Sbjct: 151 SQIFEDFWKNIVDYTNVQDVIDHYEIQSTKIFMDAGFKYESVLDTRALDAKNLLHPDFSY 210

Query: 60  VVAYGSRSGKKFFAQSNLY-----------MMER---------ELHFDGQRIHHFPQLLH 99
                    K  F +   +           M++           L  D      +P L  
Sbjct: 211 YAPDVILKEKVPFIKVKAFQSIQSNGIAYYMLDYIDRNTDYPKSLVVDHLSTVGYPDLNF 270

Query: 100 GWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESAS--I 157
              S  +  + +  +   +A+ +H+YY +L  E  +   N S  +DL++T  T+     I
Sbjct: 271 LLPSKMITPLSKTVLHQTVAVHLHVYYPELLEEFLDAFKNFSFDYDLYLTTNTDEKEEII 330

Query: 158 KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGD 217
           K  +      A++    NHGRD++PFL L   E+L  YD V   H K+S    +  + G+
Sbjct: 331 KEMLKCKDAKAKLVRTPNHGRDIVPFLAL--KEELKKYDIVGHFHTKRSLEAAF--FAGE 386

Query: 218 LWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGS--RAYRYPNKYCDYTCSLGKNREMI 275
            WR  L   L+        I+  F+  + +G++ +   ++   NK  +      +   ++
Sbjct: 387 SWRTELISMLI---EPADNIMAHFEQKQKLGIVIADIPSFFRFNKIVNADNENKQIAPIM 443

Query: 276 CTLAGRMGITFQDQKLDF-----FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEI 330
             +  RM +  +    DF       GT FW + E L+P+ NL +     P         I
Sbjct: 444 NDIWKRMKMNKKVNFHDFNTFTMSYGTFFWAKIEVLEPLFNLEIMDREIPNEPLP-QNTI 502

Query: 331 EHAVERCFSLSV--KKANFRISD 351
            HA+ER        K+ +F IS 
Sbjct: 503 LHAIERVLIYLAWDKEMDFNISP 525


>gi|322373386|ref|ZP_08047922.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus sp.
           C150]
 gi|321278428|gb|EFX55497.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus sp.
           C150]
          Length = 594

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 70/249 (28%), Positives = 106/249 (42%), Gaps = 20/249 (8%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIM 173
            KIA+ +H YY+DL  +      N   ++DL +T  +E     I+S + K    ARI I 
Sbjct: 287 KKIAVHLHTYYVDLLDDFLRQFENFHFTYDLFLTTDSEEKKKEIQSILDKHGKEARIFIT 346

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            N GRDV+P L L   ++LS YDY+   H KKS    Y  W GD WR  LF  L+     
Sbjct: 347 GNRGRDVIPMLKL--KDELSAYDYIGHFHTKKSPEYPY--WVGDSWRNELFSMLIQPAD- 401

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNR--EMICTLAGRMGITFQDQK- 290
              II   +    +G++ +    +  +Y        +NR  E +  L  RM +       
Sbjct: 402 --NIIANLEHDDRLGLVIADIPTFF-RYTKIVDPWNENRFAEGMNDLWERMDLGRDIDFD 458

Query: 291 ----LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSL--SVKK 344
                    GT  W + + L P+ +L L     P         I H++ER        ++
Sbjct: 459 KMNTFIMSYGTFIWFKYDTLKPLFDLDLQDEEIPAEPIP-QHTILHSIERILVYLAWARR 517

Query: 345 ANFRISDVD 353
            ++ I+  D
Sbjct: 518 YDYAIAKND 526


>gi|192359986|ref|YP_001983898.1| Capsule polysaccharide biosynthesis protein family [Cellvibrio
           japonicus Ueda107]
 gi|190686151|gb|ACE83829.1| Capsule polysaccharide biosynthesis protein family [Cellvibrio
           japonicus Ueda107]
          Length = 872

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 84/314 (26%), Positives = 119/314 (37%), Gaps = 27/314 (8%)

Query: 56  DENYVVAYGSRSGKKFFAQSNLYMMERELHFDG--------QRIHHFPQLLHGWESPAMG 107
              + V YG + G+   A  +    E  L            Q +     L          
Sbjct: 528 PIFHFVHYGLQEGRSPRASISGAKAEETLTLLKEAITAAIVQPVIPLYPLSPEEAVRRDS 587

Query: 108 KVMQIAI-----KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT-ESASIKSEI 161
           +  +I       + +IA+V HLYY DL  EI + L  +  +FDL VTL    +  I+  +
Sbjct: 588 QFAEIRAALEHSQKRIAVVAHLYYRDLVPEILSALETIPEAFDLIVTLPDWGTRHIEQMV 647

Query: 162 LKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYS--WWEGDLW 219
            + +P A  +   N GRD+ PF+ LL      NYD + KI  K+   +        G LW
Sbjct: 648 REAYPEAVFYRAVNRGRDIGPFVDLLPLITEKNYDALLKIQTKRGYYRSGRLLPQFGQLW 707

Query: 220 RRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLA 279
           R   F  LLG    V  I+    T   + M+G   Y        Y       + ++    
Sbjct: 708 RSETFRALLGNKSRVTDILEALRTDPSLNMVGPSPYFLSLTKYPYHDQGDLAQTILN--- 764

Query: 280 GRMGITFQDQKLDFFAGTMFWVRTEALDPIKN-LRLSRYFEPKVHKALDGEIEHAVERCF 338
                        FFAGTMFWVR   L P+     LS         A DG   H +ER F
Sbjct: 765 -------NPTGNGFFAGTMFWVRPSCLRPLTEPEHLSITAFEPESGANDGATAHLIERLF 817

Query: 339 SLSVKKANFRISDV 352
           S      + +I+ V
Sbjct: 818 SQVAFANDGKIAGV 831


>gi|116511036|ref|YP_808252.1| lipopolysaccharide biosynthesis protein [Lactococcus lactis subsp.
           cremoris SK11]
 gi|116106690|gb|ABJ71830.1| Lipopolysaccharide biosynthesis protein [Lactococcus lactis subsp.
           cremoris SK11]
          Length = 588

 Score =  217 bits (552), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 78/401 (19%), Positives = 150/401 (37%), Gaps = 55/401 (13%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKR----------SKK 52
           S+ +  F ++ +  +   +     +  +   F    F        ++             
Sbjct: 160 SEAFENFWANIEVLDDVVEVIVKYETAMTKYFEDAGFKSGVVFDTRKEEWSGMLVHDFSV 219

Query: 53  LCYDEN---YVVA-------YGSRSGKKFFA-----QSNLYMMERELHFDGQRIHHFPQL 97
               E    ++         YG+ +           Q   + ++  ++   +  +   + 
Sbjct: 220 FNLPELLKRHIPFLKIKAFSYGAENIYTPLVIERLKQETSFPVKLIVNHMTEVDYPDREY 279

Query: 98  LHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASI 157
           +   ++    K +      KI I +H +Y+DL  E  N       ++DL++T  TE    
Sbjct: 280 MLEEKTLKFTKEVSAKTNLKIGIHLHAFYLDLIPEYLNYFDKYVQNYDLYITTDTEEK-- 337

Query: 158 KSEILKIFPAARIH---IMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWW 214
             EILK +P  +I    +  N GRDVLP++ +  +E +++YD     H KKSK     W 
Sbjct: 338 YEEILKNYPLPQIKKVIVTGNKGRDVLPWMQV--SELMTDYDLCGHFHTKKSKDND--WI 393

Query: 215 EGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREM 274
            G+ WRR + Y LL        I + F+ +  +G+I +    +   +  Y  +    R++
Sbjct: 394 VGESWRRDIEYSLL---EPAQAIFQEFEKNPKLGLIIADVPSFFEHF--YGPTYITERDI 448

Query: 275 ---ICTLAGRMGITFQDQ-----KLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKAL 326
              +  +  ++      +           GTM W R +AL+ + N+ +     P+     
Sbjct: 449 WPDMQEIWQKIDFENSKELKQKDSYVMSYGTMIWYRPQALNNLLNVNIQA-DVPEEPLPY 507

Query: 327 DGEIEHAVERCFSLSVKKANF--RISDVDCILGYRKSLSQN 365
              I HA ER          +  RIS +    G+  + S N
Sbjct: 508 -NSILHAFERLLVYVSWANGYDFRISQIQTNNGFVANFSAN 547


>gi|145588508|ref|YP_001155105.1| methyltransferase type 11 [Polynucleobacter necessarius subsp.
            asymbioticus QLW-P1DMWA-1]
 gi|145046914|gb|ABP33541.1| Methyltransferase type 11 [Polynucleobacter necessarius subsp.
            asymbioticus QLW-P1DMWA-1]
          Length = 1082

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 75/256 (29%), Positives = 131/256 (51%), Gaps = 15/256 (5%)

Query: 95   PQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNL--SISFDLHVTLVT 152
              +L  + +P   ++++ + +  IAIVVH++Y+D W +I  ++  +      D+++T+  
Sbjct: 836  YDILKNYINPEHAEIIRESQENSIAIVVHIHYMDTWEDIKKIIKKILSVHDSDIYITIT- 894

Query: 153  ESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYS 212
             +      I   FP+A I ++EN GRD+LPF+ +L+     NY  +CKIH KKS+     
Sbjct: 895  -NLEQYQSIKNDFPSANIELVENRGRDILPFINVLKKIIHKNYVAICKIHSKKSEY---- 949

Query: 213  WWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNR 272
              +G++ R+ L++ L+     + KI + F+ ++ +GM+    Y           ++  NR
Sbjct: 950  RSDGEVIRKELYFSLINNEITLEKIPKFFEVNKKLGMLVPGKYFL----QHNDINMYFNR 1005

Query: 273  EMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
            E I  +   +G+ F++ K  F AG+MFW R  AL  +  L  S           DG + H
Sbjct: 1006 ENISKVCSVIGVNFKESK--FPAGSMFWARPAALQKLLKLE-SGELFDVEEGLADGTVAH 1062

Query: 333  AVERCFSLSVKKANFR 348
            AVER F L  + + F 
Sbjct: 1063 AVERLFGLVSESSGFY 1078


>gi|325276923|ref|ZP_08142610.1| hypothetical protein G1E_25356 [Pseudomonas sp. TJI-51]
 gi|324097938|gb|EGB96097.1| hypothetical protein G1E_25356 [Pseudomonas sp. TJI-51]
          Length = 758

 Score =  216 bits (551), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 64/245 (26%), Positives = 101/245 (41%), Gaps = 11/245 (4%)

Query: 108 KVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKS----EILK 163
           ++   A   KIAI +H+YY D     A  L       DL +T+  ES   ++      ++
Sbjct: 241 ELTPKASNQKIAICLHIYYDDYIERFAEALYTFPTEVDLLITIANESFRDRAYQTFSKIQ 300

Query: 164 IFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWL 223
                 I  + N GR+  P L+    E L+ YD +C +H KKS   G    E   W  +L
Sbjct: 301 AVKKVTIKSVPNRGRNFGPLLVEFAQELLT-YDLLCHLHSKKSLYSGR---EQTQWADYL 356

Query: 224 FYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMG 283
              LL    VV +++  F  +   G+     +     + ++      N+  +  L   +G
Sbjct: 357 SEYLLNDCSVVKRVLNAFSDNPQFGVYYPTTFWMMPSWVNHVT---MNKPHMRNLQTALG 413

Query: 284 ITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVK 343
               D  L + AG MFW R +AL  I N   +    P      DG + HA+ER      +
Sbjct: 414 FGHFDDFLSYPAGGMFWARPKALVDILNKTYTYDDFPNEPLPNDGSMLHALERVIGPVCE 473

Query: 344 KANFR 348
           K  ++
Sbjct: 474 KNGYQ 478


>gi|322385732|ref|ZP_08059376.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           cristatus ATCC 51100]
 gi|321270470|gb|EFX53386.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           cristatus ATCC 51100]
          Length = 598

 Score =  216 bits (551), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 69/264 (26%), Positives = 114/264 (43%), Gaps = 21/264 (7%)

Query: 102 ESPAMGKVMQIAIK-AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSE 160
           +   + +  Q      KIA+ +H YY+DL  +      N   ++DL +T  +E   ++ E
Sbjct: 272 DRKVIEESSQTYSDTKKIAVHLHTYYVDLLEDFLKQFENFHFTYDLFLTTDSEKKKLEIE 331

Query: 161 --ILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218
             +LK     +I+I  N GRD++P L L   E+L  YDY+   H KKS    Y  W GD 
Sbjct: 332 AVLLKRNQLGKIYITGNKGRDIIPMLKL--REELCTYDYIGHFHTKKSPEYPY--WVGDS 387

Query: 219 WRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNR--EMIC 276
           WR  LF  LL    +   I+ + +  + +G++ +    +  +Y        +N+  + + 
Sbjct: 388 WRNELFDMLLKPADL---IMASLENDKRLGLVIADIPTFF-RYTKIVDPWNENKFADDMN 443

Query: 277 TLAGRMGITFQDQK-----LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
            L  RM I                GT  W + +AL P+ +L L     P         I 
Sbjct: 444 ILWERMDINRSIDFNKLNTFIMSYGTFIWFKYDALKPLFDLNLQDEDIPSEPLP-QHTIL 502

Query: 332 HAVERCFSLSV--KKANFRISDVD 353
           H++ER        ++ ++ IS  D
Sbjct: 503 HSIERILVYLAWSQRFDYAISKND 526


>gi|16124886|ref|NP_419450.1| hypothetical protein CC_0633 [Caulobacter crescentus CB15]
 gi|221233606|ref|YP_002516042.1| hypothetical protein CCNA_00669 [Caulobacter crescentus NA1000]
 gi|13421844|gb|AAK22618.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|51039815|tpg|DAA00361.1| TPA_exp: conserved hypothetical protein [Caulobacter vibrioides]
 gi|220962778|gb|ACL94134.1| hypothetical protein CCNA_00669 [Caulobacter crescentus NA1000]
          Length = 818

 Score =  216 bits (550), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 68/242 (28%), Positives = 105/242 (43%), Gaps = 10/242 (4%)

Query: 110 MQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASI-KSEILKIFPAA 168
            Q A +A    ++HL+Y +L    A  L+  +   DL +T+    +    +     FP A
Sbjct: 583 SQFAKRADAVTLLHLFYPELIDWFAERLAATADVLDLMITVPETWSEADLARARAAFPTA 642

Query: 169 RIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLL 228
            + I EN GRD+ PF+  L   +   Y   CK+H K+S        +GD WR  L   LL
Sbjct: 643 HLAIAENRGRDIRPFVETLRRARALGYSVFCKLHSKRSP----HQAKGDQWRTTLVEGLL 698

Query: 229 GAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQD 288
           G       +         +G++ +   R      D   +   NR     L+  MG+  + 
Sbjct: 699 GGEAAALALRAF-AQDPKLGLLAAAGARMRIGDPDVMDN---NRAEADRLSAHMGLKPRP 754

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
           +   F AG+MFW RTEA  P+ +L             +DG   HA+ER  +  V++A +R
Sbjct: 755 ETP-FAAGSMFWGRTEAFAPLTDLSDDEIAFGPELGRVDGTTAHAIERLTAAIVERAGYR 813

Query: 349 IS 350
            S
Sbjct: 814 AS 815


>gi|312962408|ref|ZP_07776899.1| lipopolysaccharide biosynthesis protein-like protein [Pseudomonas
            fluorescens WH6]
 gi|311283335|gb|EFQ61925.1| lipopolysaccharide biosynthesis protein-like protein [Pseudomonas
            fluorescens WH6]
          Length = 1308

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 78/244 (31%), Positives = 128/244 (52%), Gaps = 15/244 (6%)

Query: 110  MQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSI-SFDLHVTLVTESASIKSEILKIFPAA 168
             +   +A  A+V+HL+Y DLW +I + L +     +DL+VT+ + SA ++  + + +P A
Sbjct: 1079 KRSVRQADYAVVLHLHYDDLWDDIKSYLDSFGQLEYDLYVTVTSSSAGVR--VAQEYPKA 1136

Query: 169  RIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLL 228
             I ++EN GRDVLPFL +L+  +   Y  VCKIH K+S  +     +GD  R  L   LL
Sbjct: 1137 HIQLVENRGRDVLPFLKILQVIKDMGYVAVCKIHSKRSLYRD----DGDKIRGELIGSLL 1192

Query: 229  GAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQD 288
            G+   +  ++  F+  +DIG+I    Y  P+   + T        ++  L+ ++G  F  
Sbjct: 1193 GSKETILSVVDRFERQKDIGVIVPVKYLIPHTDHNMTYCG----AIVTELSSKLGFNFS- 1247

Query: 289  QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
               +F AG+MFW R +AL+ + ++  S           DG I H +ER     VKKAN+ 
Sbjct: 1248 -YCEFIAGSMFWFRPKALEALLSIDESS--FEVEDGLADGTIAHGIERVLCNVVKKANYT 1304

Query: 349  ISDV 352
            +  +
Sbjct: 1305 VETI 1308


>gi|332995244|gb|AEF05299.1| hypothetical protein ambt_19030 [Alteromonas sp. SN2]
          Length = 638

 Score =  214 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 63/247 (25%), Positives = 108/247 (43%), Gaps = 11/247 (4%)

Query: 106 MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKS----EI 161
           + K      + K+AIV+H++Y D   + A  +     + D+ +T  T++   K+      
Sbjct: 122 VAKETSSWKQQKVAIVLHIFYPDFVDKFAASVQRFPTNVDVFITAGTDAIKNKALKTFNG 181

Query: 162 LKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRR 221
           LK     +  + EN GR+  PFL+    E L  YD +C +H KKS   G    E   W  
Sbjct: 182 LKNVQKVQAVLCENRGRNFGPFLVNFSDELLD-YDLMCHLHSKKSLYSGR---EQTQWFD 237

Query: 222 WLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGR 281
           +    LL    VV  I+R FD   ++G+    ++     + ++      N+ +      +
Sbjct: 238 YQNNFLLKDKHVVKSILRLFDEREELGIYYPTSFWMMPAWVNH---WTCNKGISQDFVDK 294

Query: 282 MGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLS 341
            G+   D  +++  G MFW R +A+ P+   +      P+     DG   HA+ER   L 
Sbjct: 295 WGLDISDDFVNYPVGGMFWARPKAIAPLLKEKFEYSDFPEEPLPNDGSWLHALERSIGLL 354

Query: 342 VKKANFR 348
            +K  F+
Sbjct: 355 AEKQGFK 361


>gi|160936497|ref|ZP_02083865.1| hypothetical protein CLOBOL_01388 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440582|gb|EDP18320.1| hypothetical protein CLOBOL_01388 [Clostridium bolteae ATCC
           BAA-613]
          Length = 373

 Score =  214 bits (546), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 100/233 (42%), Gaps = 7/233 (3%)

Query: 125 YYIDLWIEIANLLSNLSISFDL-HVTLVTESASIKSEILKIFP--AARIHIMENHGRDVL 181
           +Y DL  +    +  +    D+  VT   + A    + +        ++ + EN GRD+ 
Sbjct: 2   FYEDLLNQCYLYIEQIPKYIDVCFVTSNPKIAFKVKKYINNTKKINYKVLVKENRGRDMA 61

Query: 182 PFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTF 241
             L+      +  Y+Y+C +H KKS + G +  +G  +   ++ +L+G+ G++  I+R  
Sbjct: 62  ALLVTCHDFIME-YEYLCFVHDKKSLQMG-NDNDGCKFMELIWKNLIGSTGLIENILRYL 119

Query: 242 DTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQ--DQKLDFFAGTMF 299
             +RD+G++      + N    +      N + +  L  ++ +      +K     G  F
Sbjct: 120 GNNRDVGLMVPPIPYWGNYIGVFINPWTCNYDNVINLGNQLKLKKNVCYEKEYVTIGGAF 179

Query: 300 WVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDV 352
           W RT AL P+   +       +   A+DG I HA+ER          + + ++
Sbjct: 180 WCRTNALKPLFEYKWKLEDFCQEPMAVDGTISHAIERILGFVALNNGYDVLEI 232


>gi|15674835|ref|NP_269009.1| hypothetical protein SPy_0792 [Streptococcus pyogenes M1 GAS]
 gi|71910421|ref|YP_281971.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS5005]
 gi|13621968|gb|AAK33730.1| conserved hypothetical protein - possibly involved in cell wall
           localization and side chain formation of
           rhamnose-glucose polysaccharide [Streptococcus pyogenes
           M1 GAS]
 gi|71853203|gb|AAZ51226.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS5005]
          Length = 581

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 60/243 (24%), Positives = 101/243 (41%), Gaps = 17/243 (6%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIM 173
            K+A+ +H++Y+DL  E      N +  +DL +T  ++     IK  + +    A I + 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFENWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            N GRD+ P L+L   ++LS YDY+   H KKSK   +  W G+ WR+ L   L+     
Sbjct: 344 GNRGRDIYPMLLL--KDKLSQYDYIGHFHTKKSKEADF--WAGESWRKELIDMLVKPAD- 398

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITF-----QD 288
              I+  F+T     +I      +         +     + + +L  +M +         
Sbjct: 399 --SILSAFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAM 456

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSV--KKAN 346
                  GT  W + +AL  + +L L++   P         I HA+ER           +
Sbjct: 457 DTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLP-QNSILHAIERLLVYIAWGDSYD 515

Query: 347 FRI 349
           FRI
Sbjct: 516 FRI 518


>gi|332535404|ref|ZP_08411194.1| glycosyl transferase, group 1 [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332035169|gb|EGI71680.1| glycosyl transferase, group 1 [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 672

 Score =  213 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 58/236 (24%), Positives = 102/236 (43%), Gaps = 11/236 (4%)

Query: 117 KIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKS----EILKIFPAARIHI 172
           K+A+  H++Y +        L+  +   D+ V++ +E  + K+    +         + +
Sbjct: 164 KLAMCFHVFYGEFIDYYCGALAKFTQQVDVFVSVASEELAKKAIHDFKACSKVNKVVVKV 223

Query: 173 MENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPG 232
           + NHGR+  P L+   ++ L NYD  C +H KKS   G        W  +L   LL  P 
Sbjct: 224 VPNHGRNFGPMLVEFASD-LQNYDLFCHMHSKKSLYSGR---AQTQWADYLGEYLLNDPH 279

Query: 233 VVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLD 292
           V+ +++  F+ +   G+    ++     + ++     KN+        +  I  +D  L 
Sbjct: 280 VIKQVLNHFNDNPKSGLYYPTSFWMMPDWVNH---WLKNKPAAQKFTKKWNIELKDDFLA 336

Query: 293 FFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
           + AG MFW R EAL  + N        P      DG   HA+ER   L V+K  ++
Sbjct: 337 YPAGGMFWARPEALKQLLNKEYKYDDFPGEPLPNDGSQLHALERMLGLLVEKNGYK 392


>gi|295687882|ref|YP_003591575.1| rhamnan synthesis protein F [Caulobacter segnis ATCC 21756]
 gi|295429785|gb|ADG08957.1| Rhamnan synthesis F [Caulobacter segnis ATCC 21756]
          Length = 818

 Score =  212 bits (541), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 73/272 (26%), Positives = 112/272 (41%), Gaps = 18/272 (6%)

Query: 88  GQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIV--------VHLYYIDLWIEIANLLSN 139
           G    H  +       P +     +  +A+ A V        +HL+Y +L    A  L+ 
Sbjct: 553 GHGYLHATRAALSAYQPRLTDAHPLVAQAQAAFVKRADAVTLLHLFYPELIDWFAERLAA 612

Query: 140 LSISFDLHVTLVTESASI-KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYV 198
            +   DL +T+    +    +     FP A + I EN GRD+ PF+  L   +   Y   
Sbjct: 613 TADVLDLMITVPETWSEADLARARATFPMAHLAIAENRGRDIRPFVETLRRARTLGYSVF 672

Query: 199 CKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYP 258
           CK+H K+S        +GD WR  L   LLG       +         +G++ +   R  
Sbjct: 673 CKLHSKRSP----HRAKGDEWRAELVDGLLGGEAAALALRAF-AQDAKLGLLAAAGSRLR 727

Query: 259 NKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYF 318
               D   +   NR+    LA RMG+    +   F AG+MFW RTEA  P+ +L  +   
Sbjct: 728 IGDPDVMNN---NRQDADRLARRMGLKLAPETP-FSAGSMFWGRTEAFAPLSDLTDAEID 783

Query: 319 EPKVHKALDGEIEHAVERCFSLSVKKANFRIS 350
                  +DG   HA+ER  +  V +A +R S
Sbjct: 784 FGPELGRVDGTTAHAIERLTAAIVARAGYRAS 815


>gi|209559162|ref|YP_002285634.1| RgpFc protein [Streptococcus pyogenes NZ131]
 gi|209540363|gb|ACI60939.1| RgpFc protein [Streptococcus pyogenes NZ131]
          Length = 581

 Score =  212 bits (540), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 101/243 (41%), Gaps = 17/243 (6%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIM 173
            K+A+ +H++Y+DL  E      + +  +DL +T  ++     IK  + +    A I + 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            N GRD+ P L+L   ++LS YDY+   H KKSK   +  W G+ WR+ L   L+     
Sbjct: 344 GNRGRDIYPMLLL--KDKLSQYDYIGHFHTKKSKEADF--WAGESWRKELIDMLVKPAD- 398

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITF-----QD 288
              I+  F+T     +I      +         +     + + +L  +M +         
Sbjct: 399 --SILSAFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAM 456

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSV--KKAN 346
                  GT  W + +AL  + +L L++   P         I HA+ER           +
Sbjct: 457 DTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLP-QNSILHAIERLLVYIAWGNSYD 515

Query: 347 FRI 349
           FRI
Sbjct: 516 FRI 518


>gi|306827605|ref|ZP_07460885.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes ATCC 10782]
 gi|304430168|gb|EFM33197.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes ATCC 10782]
          Length = 581

 Score =  212 bits (540), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 101/243 (41%), Gaps = 17/243 (6%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIM 173
            K+A+ +H++Y+DL  E      + +  +DL +T  ++     IK  + +    A I + 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            N GRD+ P L+L   ++LS YDY+   H KKSK   +  W G+ WR+ L   L+     
Sbjct: 344 GNRGRDIYPMLLL--KDKLSQYDYIGHFHTKKSKEADF--WAGESWRKELIDMLVKPAD- 398

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITF-----QD 288
              I+  F+T     +I      +         +     + + +L  +M +         
Sbjct: 399 --SILSAFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAM 456

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSV--KKAN 346
                  GT  W + +AL  + +L L++   P         I HA+ER           +
Sbjct: 457 DTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLP-QNSILHAIERLLVYIAWGNSYD 515

Query: 347 FRI 349
           FRI
Sbjct: 516 FRI 518


>gi|19745874|ref|NP_607010.1| hypothetical protein spyM18_0853 [Streptococcus pyogenes MGAS8232]
 gi|19748025|gb|AAL97509.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232]
          Length = 581

 Score =  212 bits (540), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 101/243 (41%), Gaps = 17/243 (6%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIM 173
            K+A+ +H++Y+DL  E      + +  +DL +T  ++     IK  + +    A I + 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            N GRD+ P L+L   ++LS YDY+   H KKSK   +  W G+ WR+ L   L+     
Sbjct: 344 GNRGRDIYPMLLL--KDKLSQYDYIGHFHTKKSKEADF--WAGESWRKELIDMLVKPAD- 398

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITF-----QD 288
              I+  F+T     +I      +         +     + + +L  +M +         
Sbjct: 399 --SILSAFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAM 456

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSV--KKAN 346
                  GT  W + +AL  + +L L++   P         I HA+ER           +
Sbjct: 457 DTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLP-QNSILHAIERLLVYIAWGNSYD 515

Query: 347 FRI 349
           FRI
Sbjct: 516 FRI 518


>gi|56808559|ref|ZP_00366292.1| COG3754: Lipopolysaccharide biosynthesis protein [Streptococcus
           pyogenes M49 591]
          Length = 581

 Score =  212 bits (540), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 101/243 (41%), Gaps = 17/243 (6%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIM 173
            K+A+ +H++Y+DL  E      + +  +DL +T  ++     IK  + +    A I + 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            N GRD+ P L+L   ++LS YDY+   H KKSK   +  W G+ WR+ L   L+     
Sbjct: 344 GNRGRDIYPMLLL--KDKLSQYDYIGHFHTKKSKEADF--WAGESWRKELIDMLVKPAD- 398

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITF-----QD 288
              I+  F+T     +I      +         +     + + +L  +M +         
Sbjct: 399 --SILSAFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAM 456

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSV--KKAN 346
                  GT  W + +AL  + +L L++   P         I HA+ER           +
Sbjct: 457 DTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLP-QNSILHAIERLLVYIAWGNSYD 515

Query: 347 FRI 349
           FRI
Sbjct: 516 FRI 518


>gi|139474025|ref|YP_001128741.1| rhamnan synthesis protein F family protein [Streptococcus pyogenes
           str. Manfredo]
 gi|134272272|emb|CAM30524.1| rhamnan synthesis protein F family protein [Streptococcus pyogenes
           str. Manfredo]
          Length = 581

 Score =  212 bits (540), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 59/243 (24%), Positives = 101/243 (41%), Gaps = 17/243 (6%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIM 173
            K+A+ +H++Y+DL  E      + +  +DL +T  ++     IK  + +    A I + 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            N GRD+ P L+L   ++LS YDY+   H KKSK   +  W G+ WR+ L   L+     
Sbjct: 344 GNRGRDIYPMLLL--KDKLSQYDYIGHFHTKKSKEADF--WAGESWRKELIDMLVKPAD- 398

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITF-----QD 288
              I+  F+T     +I      +         +     + + +L  +M +         
Sbjct: 399 --SILSAFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAM 456

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSV--KKAN 346
                  GT  W + +AL  + +L L++   P         I HA+ER           +
Sbjct: 457 DTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLP-QNSILHAIERLLVYIAWGNSYD 515

Query: 347 FRI 349
           FRI
Sbjct: 516 FRI 518


>gi|71903253|ref|YP_280056.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS6180]
 gi|71802348|gb|AAX71701.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS6180]
          Length = 581

 Score =  212 bits (539), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 60/243 (24%), Positives = 102/243 (41%), Gaps = 17/243 (6%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIM 173
            K+A+ +H++Y+DL  E      + +  +DL +T  ++     IK  + +    A I + 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            N GRD+ P L+L   ++LS YDY+   H KKSK   +  W G+ WR+ L   L+     
Sbjct: 344 GNRGRDIYPMLLL--KDKLSQYDYIGHFHTKKSKEADF--WAGESWRKELIDMLVKPAD- 398

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITF-----QD 288
              I+  F+T     +I      +         +     + + +L  +M +         
Sbjct: 399 --SILSVFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAM 456

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSV--KKAN 346
                  GT  W + +AL  + +L L++   P         I HA+ER F         +
Sbjct: 457 DTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLP-QNSILHAIERLFVYIAWGNSYD 515

Query: 347 FRI 349
           FRI
Sbjct: 516 FRI 518


>gi|125623094|ref|YP_001031577.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase RgpF [Lactococcus
           lactis subsp. cremoris MG1363]
 gi|124491902|emb|CAL96823.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase RgpF [Lactococcus
           lactis subsp. cremoris MG1363]
 gi|300069842|gb|ADJ59242.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase RgpF [Lactococcus
           lactis subsp. cremoris NZ9000]
          Length = 588

 Score =  212 bits (539), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 81/408 (19%), Positives = 149/408 (36%), Gaps = 69/408 (16%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FF-----------WF--------- 42
           SK +  F ++ +  +   +     +  +   F    F            W          
Sbjct: 160 SKAFEDFWTNIEVLDDVVEVIVKYETAMTKYFEDAGFKSGVIFDTRKEEWAGMLVHDFSV 219

Query: 43  --------WTLFYKRSKKLCY--DENYVVAYGSRSGKKFFAQSNLYMMERELHFDGQRIH 92
                     + + + K   Y  D  Y      R  ++      L +       +     
Sbjct: 220 FNLPELLKRHIPFLKIKAFSYGADNIYTPLVIERLKQETTYPIELIV-------NHMTEV 272

Query: 93  HFPQLLHGWESPAMGKVMQIAIKA--KIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTL 150
            +P   +  E   +    +I  K+  KIAI +H +Y+DL  E  +       ++DL +T 
Sbjct: 273 DYPDREYMLEEKTLKLSTEINKKSNLKIAIHLHAFYLDLIPEYLDYFDKYVQNYDLFITT 332

Query: 151 VTESASIKSEILKIFPAARIH---IMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSK 207
            T+      +I+K +P  +I    +  N GRDVLP++ +  +E +++YD     H KKSK
Sbjct: 333 DTKDK--YEQIIKSYPLNQIKKVLVTGNKGRDVLPWMEI--SELMADYDLCGHFHTKKSK 388

Query: 208 RKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCS 267
                W  G+ WRR + Y LL        I + F+ +  +G++ +    +   +  Y  +
Sbjct: 389 DND--WIVGESWRRDIEYSLLKPAQ---AIFQEFEKNPKLGLMIADVPSFFEHF--YGPT 441

Query: 268 LGKNREM---ICTLAGRMGITFQ-----DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFE 319
               R++   +  +  ++                  GTM W R +AL+ +  + +     
Sbjct: 442 YITERDIWPDMEEIWKKINFENPRGLKQKDSYVMSYGTMIWYRPQALNNLLKVDIEAA-V 500

Query: 320 PKVHKALDGEIEHAVERCFSL--SVKKANFRISDVDCILGYRKSLSQN 365
           P+        I HA ER           +FRIS +    G+  + S N
Sbjct: 501 PEEPLPY-NSILHAFERLLVYTSWANGYDFRISQIQTNNGFVANFSAN 547


>gi|94994091|ref|YP_602189.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS10750]
 gi|94547599|gb|ABF37645.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS10750]
          Length = 581

 Score =  212 bits (539), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 60/243 (24%), Positives = 102/243 (41%), Gaps = 17/243 (6%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIM 173
            K+A+ +H++Y+DL  E      + +  +DL +T  ++     IK  + +    A I + 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            N GRD+ P L+L   ++LS YDY+   H KKSK   +  W G+ WR+ L   L+     
Sbjct: 344 GNRGRDIYPMLLL--KDKLSQYDYIGHFHTKKSKEADF--WAGESWRKELIDMLVKPAD- 398

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITF-----QD 288
              I+  F+T     +I      +         +     + + +L  +M +         
Sbjct: 399 --SILSVFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAM 456

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSV--KKAN 346
                  GT  W + +AL  + +L L++   P         I HA+ER F         +
Sbjct: 457 DTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLP-QNSILHAIERLFVYIAWGNSYD 515

Query: 347 FRI 349
           FRI
Sbjct: 516 FRI 518


>gi|23009067|ref|ZP_00050256.1| COG3754: Lipopolysaccharide biosynthesis protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 486

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 68/331 (20%), Positives = 118/331 (35%), Gaps = 45/331 (13%)

Query: 40  FWFWTLFYKRSKKLCYDENYVVAYGSRSGKK------FFAQSNLYMMERELHFDGQRIHH 93
           F+    +Y++ K +   +     +  RS  K         +   Y+ +         + H
Sbjct: 165 FFSKAHYYRKYKDISPSKVDAFVHYMRSSHKEGRQPHPLFEPGHYVEQCPEAKQANPLVH 224

Query: 94  FPQLLHGWE-SPAMGKVMQIAIKA-------------------------KIAIVVHLYYI 127
           + +       SP   KV  +A K                          +I +  H+++ 
Sbjct: 225 YLRKGVDLNLSPRGPKVANVAEKKLPASRKVVNLVAAGSSAPAGALANARIGVFAHIFHT 284

Query: 128 DLWIEIANLLSNLSISFDLHVTLVTESA-SIKSEILKIF--PAARIHIMENHGRDVLPFL 184
           DL   +    +N+     ++VT  + S      +           I I  N GRD+ P L
Sbjct: 285 DLCEYVLKYTNNIPFDTTVYVTTSSASKADFIRKTFGRLSKHRYEIVIAPNRGRDIAPML 344

Query: 185 ILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTH 244
           +        N DY   +H KKS      +   D WR +LF   LG+  ++  I+      
Sbjct: 345 VGYRN-AFQNCDYAVHVHTKKSLHYSSGF---DAWRDYLFEMNLGSAELITGIVNVLSR- 399

Query: 245 RDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQK-LDFFAGTMFWVRT 303
            +IG +    Y             G N + I  L    G++   +  LDF +G+MFW + 
Sbjct: 400 SNIGAVAPDHY----APIAKLIQWGGNIDAINGLLSFTGLSVASENVLDFPSGSMFWFKP 455

Query: 304 EALDPIKNLRLSRYFEPKVHKALDGEIEHAV 334
           +AL  +  + L  Y        +DG + HA+
Sbjct: 456 DALSKLMEIHLQSYHFDPELGQVDGTLAHAI 486


>gi|222148479|ref|YP_002549436.1| hypothetical protein Avi_2007 [Agrobacterium vitis S4]
 gi|221735467|gb|ACM36430.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 513

 Score =  209 bits (533), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 68/245 (27%), Positives = 109/245 (44%), Gaps = 14/245 (5%)

Query: 112 IAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE-SASIKSEILKIFP---A 167
           +A++  + I VH +Y++L+ EIA+ L  L++ F L VT+  E  A +   +L  F     
Sbjct: 251 VALQLSLCIHVHCFYVELFNEIADRLQCLTLPFYLVVTVCNESDAKVVENLLVDFNQRQN 310

Query: 168 ARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDL 227
             I ++EN GRD+ PFLI          D V  +H KKS         GD WRR+LF   
Sbjct: 311 THILVVENRGRDIAPFLIDASP-IWRKSDLVLHLHTKKSP----HITWGDNWRRYLFDQT 365

Query: 228 LGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQ 287
           +G   ++  II  F    D+GM+    +     + +      KN++ I  +A ++ +   
Sbjct: 366 IGYEPLLKGIIDQFQDRDDMGMMYPENFCMIKHFTE----EEKNKDAIRYIAQKLRLECS 421

Query: 288 DQKLD-FFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKAN 346
            + L  + AG+M + R +AL  +                LDG   H +ER     V+   
Sbjct: 422 FEALGAYAAGSMAFYRVKALASVLEYDALENLFGPEQGQLDGTAAHVLERLLPEMVRLNG 481

Query: 347 FRISD 351
           F    
Sbjct: 482 FETQP 486


>gi|116071634|ref|ZP_01468902.1| hypothetical protein BL107_05779 [Synechococcus sp. BL107]
 gi|116065257|gb|EAU71015.1| hypothetical protein BL107_05779 [Synechococcus sp. BL107]
          Length = 934

 Score =  206 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 59/247 (23%), Positives = 104/247 (42%), Gaps = 13/247 (5%)

Query: 109 VMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT-ESASIKSEILKI--- 164
              I  + ++AI +H+YY +   E    L+ L     L +T  T E   +  EIL+    
Sbjct: 37  KTSIFQECQVAIYLHIYYPESLHEFLEYLTVLPSQIRLVITTTTSEKKELIIEILERALL 96

Query: 165 FPAARIHIM--ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRW 222
                +  +  EN GRD+  F+ + +      YD VCK+H KKS   G     G  W R+
Sbjct: 97  INRLDLCHVYHENKGRDIGAFINIYDELI--KYDVVCKLHAKKSPHLGE---FGKSWFRY 151

Query: 223 LFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRM 282
           L    +G    +  I+      +DIG++   +++  N   D+  +   ++  I       
Sbjct: 152 LIRSTIGNQSAIENIVNILYHSKDIGILAPTSFQGTNN-HDWASNFDISQS-ISDHIFNS 209

Query: 283 GITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSV 342
            +    +KL + + T+FW + EAL+  +   +   F P+    +DG   H++ER      
Sbjct: 210 ELDINKEKLRYPSATVFWFKPEALNQQQFRSIQPDFFPEEPIPIDGTTAHSLERLIPYIS 269

Query: 343 KKANFRI 349
                + 
Sbjct: 270 ILNGLKT 276


>gi|302337197|ref|YP_003802403.1| glycosyl transferase family 2 [Spirochaeta smaragdinae DSM 11293]
 gi|301634382|gb|ADK79809.1| glycosyl transferase family 2 [Spirochaeta smaragdinae DSM 11293]
          Length = 1100

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 74/306 (24%), Positives = 119/306 (38%), Gaps = 40/306 (13%)

Query: 56  DENYVVAYGSRSGKKF--------FAQSNLYMMERELHFDGQRIHHFPQLL-HGWESPAM 106
              + + YG   GK          + +S   + E+ +      + H+ ++       P  
Sbjct: 109 PVIHYIMYGVEEGKNPHPEFDTLFYLRSYPDVAEKGV----NPLGHYIKIGWRKGNRPNP 164

Query: 107 GKVM-----------QIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV-TES 154
             V            Q      I +V H+Y+ DL       +S++   FDL VT    E+
Sbjct: 165 FMVERDCTFLPAFPLQDHSALSIVVVFHIYHEDLVGSCLQYISHIPYPFDLIVTTPLEEN 224

Query: 155 ASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWW 214
                ++  ++P A I   +N GRD+ PFL + +      YD  CK+H KK      +  
Sbjct: 225 NDAILQVKSLYPDAEIVRSKNAGRDIGPFLQVWDRVL--QYDLCCKVHTKK-----GNSA 277

Query: 215 EGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREM 274
             ++WR      +L     V  I+R F+    + + G+        Y  Y   LGKN+++
Sbjct: 278 YSEIWRDLSLRGILETVDTVHGILRMFEQEDSLALAGAE-----LLYGSYQFLLGKNKDL 332

Query: 275 ICTLAGRMGITFQDQ-KLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHA 333
             +L     I         FF GTMFW+R +    I    L +   P      DG+ EHA
Sbjct: 333 SNSLIKDYNIPVNSYSNNGFFMGTMFWMRVK--KFIFLSNLKQLQFPIEDGKNDGKYEHA 390

Query: 334 VERCFS 339
           +ER   
Sbjct: 391 LERLLG 396


>gi|88808074|ref|ZP_01123585.1| Glycosyl transferase, group 1 [Synechococcus sp. WH 7805]
 gi|88788113|gb|EAR19269.1| Glycosyl transferase, group 1 [Synechococcus sp. WH 7805]
          Length = 512

 Score =  197 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 65/265 (24%), Positives = 105/265 (39%), Gaps = 14/265 (5%)

Query: 109 VMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT-ESASIKSEILKI--- 164
              +    KI +V+H YY +    I   L ++   FDL VT+ +     +  E L+    
Sbjct: 42  PESLGHPLKILVVIHAYYPESLATIFPSLRHMPCHFDLVVTVCSCGDKEVVKEYLEKVDL 101

Query: 165 -FPAARIHIMENHGRDVLPFLILLETEQLSN--YDYVCKIHGKKSKRKGYSWWEGDLWRR 221
                 I ++ N GRD+LPF+ +++  +L N  YD+V K+H K+S         G  W  
Sbjct: 102 PIDVLDIKVLTNLGRDLLPFVQVIKGLKLQNKAYDFVLKLHTKRSVASSKGKEFGGKWLE 161

Query: 222 WLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGR 281
               +LLG+P  V  I+       +  ++         ++C        N   I  L  R
Sbjct: 162 GSLSNLLGSPENVKYILLELLQTTNCALVSPLISLDVFRFCK----WKNNLAPISHLLDR 217

Query: 282 MGI-TFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSL 340
            G+    +  + F AG+MFWV  +A   I +        P      +G   HA ER    
Sbjct: 218 FGVRESPEDFICFPAGSMFWVDFKAAVLIASCFEESR-VPPEPLPSNGSYLHAFERLVPY 276

Query: 341 SVKKANFRISDVDCILGYRKSLSQN 365
            ++    R+    C L   +    N
Sbjct: 277 ILESTQKRMQS-HCNLDLDQLSPIN 300


>gi|209524107|ref|ZP_03272658.1| glycosyl transferase family 2 [Arthrospira maxima CS-328]
 gi|209495482|gb|EDZ95786.1| glycosyl transferase family 2 [Arthrospira maxima CS-328]
          Length = 2819

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 70/242 (28%), Positives = 106/242 (43%), Gaps = 13/242 (5%)

Query: 115  KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIK-SEILKIFPAARIHIM 173
              KIA+V+H YY +L  E+ + L NLS  +DL VT+         S + K     ++ I+
Sbjct: 1736 NPKIAVVLHAYYPELLPELFSKLDNLS-DYDLFVTIPENVVDSVTSALDKYTKNYQVSIV 1794

Query: 174  ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
            +N G D+LPFL ++       Y YVCKIH K+          G LWR  L   +LG   +
Sbjct: 1795 KNIGYDILPFLEVISELDTLGYKYVCKIHTKR-----DHPDFGSLWRECLLDAVLGDKNI 1849

Query: 234  VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDF 293
              +II  FD +  + ++G     Y +          K ++MI      + +    +   F
Sbjct: 1850 TEQIITAFDNNPSLQIVGPA-LLYMSMLGTIYDGHEKMKKMIHDFMEPLNLI---EDWGF 1905

Query: 294  FAGTMFWVRTEALDPIKNLRLSRYFEPKVHK--ALDGEIEHAVERCFSLSVKKANFRISD 351
            F G+MFW R   L  I +  L +  + +  K     G   H VER   L       ++  
Sbjct: 1906 FGGSMFWSRITPLKYIADQILLKPIDWQASKSWLTTGFYYHIVERLLGLVSYINEGQVGL 1965

Query: 352  VD 353
            VD
Sbjct: 1966 VD 1967


>gi|221634514|ref|YP_002523202.1| hypothetical protein RSKD131_4489 [Rhodobacter sphaeroides KD131]
 gi|221163387|gb|ACM04349.1| Hypothetical Protein RSKD131_4489 [Rhodobacter sphaeroides KD131]
          Length = 1042

 Score =  190 bits (483), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 61/234 (26%), Positives = 99/234 (42%), Gaps = 17/234 (7%)

Query: 119 AIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSE-ILKIFPAARIHIMENHG 177
           A ++H++++D+  ++   L +L  S D  VTL +     + + +   FP A I  +EN G
Sbjct: 8   AAIIHVWHLDVLDDLTEALEHLHGSADQFVTLPSSFRQEQRDRVTAAFPKATIVEVENRG 67

Query: 178 RDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKI 237
           +D+     L++   L  YD++CKIH KK           + WRR L   +LG+   V  I
Sbjct: 68  QDIGALFQLMQKVNLGRYDFICKIHTKKGPNMP------EEWRRALLDGVLGSKRQVTHI 121

Query: 238 IRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMI-CTLAGRMG-ITFQDQKLDFFA 295
           + +F     + + G+R              L  N + +    A  +G    + +   F A
Sbjct: 122 VESFRADPKVMLAGARQLFVYGPAY-----LEPNADKVAEDYASLIGDFDVRSEDWGFIA 176

Query: 296 GTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRI 349
           GT FW+RT  L  +    +            DG   HA ER F L V      +
Sbjct: 177 GTCFWIRTSILQEMAACAV---DFLPADYVTDGAPAHAAERMFGLCVALRGGTV 227


>gi|78184217|ref|YP_376652.1| lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9902]
 gi|78168511|gb|ABB25608.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9902]
          Length = 519

 Score =  190 bits (482), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 65/245 (26%), Positives = 103/245 (42%), Gaps = 17/245 (6%)

Query: 118 IAIVVHLYYIDLWIEIANLLSNL-----SISFDLHVTLVTESASIKSEILKI--FPAARI 170
           +A+++H +Y D+  +I   L +          DL+V+   +      + L+   F   R+
Sbjct: 268 LALMIHGFYPDVLDDILLKLPSFCAGMVGTQLDLYVSTSMDQIDQVEKKLRDLDFACVRL 327

Query: 171 HIMENHGRDVLPFL-ILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLG 229
             +EN GRDV PFL  LL     + + +  K+H KKS + G      D W R L   LL 
Sbjct: 328 FGVENRGRDVAPFLLHLLPAVAAAGHHFFVKLHTKKSLQFGIDGL--DKWSRHLIESLL- 384

Query: 230 APGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQ-D 288
           +   +  I   F    D+G +       P        +L KN+  +  L     I  +  
Sbjct: 385 SAAGLEAIRYQFLDDEDLGCLCPSGTLLP-----LAIALFKNKTHLHHLLSHSEINGRWA 439

Query: 289 QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
               F AG+MF  R EA   + +   S           DG   HA+ER  SL VK++ ++
Sbjct: 440 LMQTFVAGSMFAGRVEAFRSLLDQGFSLDDFELEGGQFDGTFAHALERLISLEVKRSGWQ 499

Query: 349 ISDVD 353
           I ++ 
Sbjct: 500 IKEMS 504


>gi|148556902|ref|YP_001264484.1| glycosyl transferase family protein [Sphingomonas wittichii RW1]
 gi|148502092|gb|ABQ70346.1| glycosyl transferase, family 2 [Sphingomonas wittichii RW1]
          Length = 1301

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 106/240 (44%), Gaps = 16/240 (6%)

Query: 117 KIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFP-AARIHIMEN 175
           K A+V+HL+Y ++ +E+ + ++ +  S D+ VT            L   P  A +  + N
Sbjct: 2   KAALVLHLFYPEVAVELIDRVAAIGASVDIFVTHSVALDETVLAALDRLPRKAEVVTVAN 61

Query: 176 HGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVF 235
            G D+ P   LL       YD + K+H KK             WRR  +  ++G+P +V 
Sbjct: 62  RGWDIGPLFELLPLLAERGYDLIGKLHSKK-----GGSGYAPEWRRLAYDGMIGSPALVA 116

Query: 236 KIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGIT-FQDQKLDFF 294
            I+  FD H D+ ++G++       Y      L +N E++  LA R+    +      FF
Sbjct: 117 DIVAAFDAHPDLSLLGAKP-----LYKSVASHLFRNAELLSDLAPRLTAPAYPPADWGFF 171

Query: 295 AGTMFWVRTEALDPIKNLRLSRYFEPKVHKA-LDGEIEHAVERCFSLSVKKANFRISDVD 353
           AGT FW R   L+ +  L     F         DG + HAVER F L+      +I  V+
Sbjct: 172 AGTFFWARRTLLEKVAAL---ADFRDAAPNQDRDGALGHAVERLFGLAPIGLGGKIGLVE 228


>gi|158422520|ref|YP_001523812.1| putative lipopolysaccharide biosynthesis protein [Azorhizobium
           caulinodans ORS 571]
 gi|158329409|dbj|BAF86894.1| putative lipopolysaccharide biosynthesis protein [Azorhizobium
           caulinodans ORS 571]
          Length = 661

 Score =  186 bits (473), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 102/255 (40%), Gaps = 14/255 (5%)

Query: 100 GWESPAMGKVMQIAIKA-KIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIK 158
           G   PA   V    ++   +A VVH YY DL   +   L        L VT   E A   
Sbjct: 381 GARRPAAAPVTPRPVRTGSLASVVHGYYEDLLPGLIAGLD----PAHLFVTTPPEKAEAV 436

Query: 159 SEILKIFPAARIHI-MENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGD 217
             +L     A     +EN GRDV PFL LL   +   YD V K+H K+S  +G    EG 
Sbjct: 437 RAVLARAAPAARLRVVENRGRDVRPFLSLLPELEAEGYDLVLKVHTKRSPHQGK---EGS 493

Query: 218 LWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICT 277
            W + L   LL       ++   F+ H  +G++G+  +        Y  S G N   +  
Sbjct: 494 DWLQRLSGPLLKLARS-ERLAPVFEAHPQMGLLGAAGHVLDGA--LYAGSAG-NAAWMRR 549

Query: 278 LAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERC 337
           LA  +G T       + AGTMF  R     P++                DG + HA ER 
Sbjct: 550 LAAELG-TGAPLTSPYVAGTMFVARLGIFAPLRGASELLDLFDTDMGLKDGTLAHAFERF 608

Query: 338 FSLSVKKANFRISDV 352
           F +   +A   + +V
Sbjct: 609 FGVLAAEAGLSVGEV 623


>gi|332561589|ref|ZP_08415902.1| glycosyltransferase [Rhodobacter sphaeroides WS8N]
 gi|332274091|gb|EGJ19409.1| glycosyltransferase [Rhodobacter sphaeroides WS8N]
          Length = 821

 Score =  176 bits (446), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 59/285 (20%), Positives = 109/285 (38%), Gaps = 15/285 (5%)

Query: 67  SGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYY 126
             ++   +     M R+L    +R+      +H     A     +     + ++ VH +Y
Sbjct: 537 LEREKMMRYGRRRMWRDLAEVEERLADADNWVHRKLRIAPYGTAEATELPRFSLHVHAFY 596

Query: 127 IDLWIEIANLLSNLSISFDLHVTLVTESA--SIKSEILKIFPAARIHIMENHGRDVLPFL 184
            D   +     +    +  + VT  ++     I++ +  +  A  + +  N GRD+LPFL
Sbjct: 597 TDDLAQDVRRHAAYRCASRIVVTTDSDRKADEIRTLMAAVGLAPEVLVRPNRGRDILPFL 656

Query: 185 ILLETEQLSNYDYV-CKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDT 243
            L      +  D + C +H KKS     S   GD+WR +L   LLG    +         
Sbjct: 657 QLFLPGGAAGEDEIWCHLHQKKSLATTDS---GDMWRAFLLRILLGDEASLSDAATHL-R 712

Query: 244 HRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRT 303
           +  +G++          +  Y      +R ++  +A R+     D  L F  G MF+VR+
Sbjct: 713 NPGVGLVAP--------FDPYFIPWDASRALLPRVAPRLPGPLPDNPLLFPVGNMFFVRS 764

Query: 304 EALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
             +  + +L  + Y  P      DG   H +ER +     +    
Sbjct: 765 AVVRAMNDLFGAGYPWPNEPIPNDGTEFHLIERLWPALAAQCGLT 809


>gi|221218294|ref|YP_002524321.1| glycosyltransferase [Rhodobacter sphaeroides KD131]
 gi|221163321|gb|ACM04287.1| glycosyltransferase [Rhodobacter sphaeroides KD131]
          Length = 821

 Score =  175 bits (445), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 59/285 (20%), Positives = 109/285 (38%), Gaps = 15/285 (5%)

Query: 67  SGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYY 126
             ++   +     M R+L    +R+      +H     A     +     + ++ VH +Y
Sbjct: 537 LEREKMMRYGRRRMWRDLAEVEERLADADNWVHRKLRIAPYGTAEATELPRFSLHVHAFY 596

Query: 127 IDLWIEIANLLSNLSISFDLHVTLVTESA--SIKSEILKIFPAARIHIMENHGRDVLPFL 184
            D   +     +    +  + VT  ++     I++ +  +  A  + +  N GRD+LPFL
Sbjct: 597 TDDLAQDVRRHAAYRCASRIVVTTDSDRKADEIRTLMAAVGLAPEVLVRPNRGRDILPFL 656

Query: 185 ILLETEQLSNYDYV-CKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDT 243
            L      +  D + C +H KKS     S   GD+WR +L   LLG    +         
Sbjct: 657 QLFLPGGAAGEDEIWCHLHQKKSLATTDS---GDIWRAFLLRILLGDEASLSDAATHL-R 712

Query: 244 HRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRT 303
           +  +G++          +  Y      +R ++  +A R+     D  L F  G MF+VR+
Sbjct: 713 NPGVGLVAP--------FDPYFIPWDASRALLPRVAPRLPGPLPDNPLLFPVGNMFFVRS 764

Query: 304 EALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
             +  + +L  + Y  P      DG   H +ER +     +    
Sbjct: 765 RVVRAMNDLFGAGYPWPNEPIPNDGTEFHLIERLWPAMAAQCGLT 809


>gi|146279467|ref|YP_001169625.1| hypothetical protein Rsph17025_3443 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557708|gb|ABP72320.1| hypothetical protein Rsph17025_3443 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 823

 Score =  173 bits (439), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 54/235 (22%), Positives = 87/235 (37%), Gaps = 15/235 (6%)

Query: 116 AKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAA--RIHIM 173
              A+ VH +Y D             ++  + +T   E  + +             + ++
Sbjct: 588 PPFALHVHAFYTDDLAADVRSHRAFRLARRIVITTDNERKASEIRTRMGAEGLYPEVILV 647

Query: 174 ENHGRDVLPFLILLETEQLSNYDYV-CKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPG 232
            N GRD+LPF+ L      +  D + C +H KKS     S   GD+WR +L   LLG   
Sbjct: 648 PNRGRDILPFMQLFLPGGPAGKDEIWCHLHQKKSLATSDS---GDVWRAFLLRILLGDDA 704

Query: 233 VVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLD 292
            +   +        +G++          +  Y      +R ++   A R+     D  L 
Sbjct: 705 GLSDAVGHL-RDPAVGLVAP--------FDPYHVPWDASRALLPRFAPRLPGPLPDNPLL 755

Query: 293 FFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANF 347
           F  G MFWVR   +  + +L    Y  P    A DG   H VER +     +   
Sbjct: 756 FPVGNMFWVRAGVVRAMNDLFGPSYPWPNEPIANDGTEFHLVERLWPTMAARCGL 810


>gi|50982351|gb|AAT91804.1| hypothetical protein [Yersinia enterocolitica]
          Length = 358

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 56/248 (22%), Positives = 92/248 (37%), Gaps = 17/248 (6%)

Query: 108 KVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPA 167
           K+       K+ I+VH +Y     EI N L   +  +D+ +T    +   K++ +     
Sbjct: 120 KIKPNTDNKKL-IIVHAFYQREAEEIFNRLVAFT-DYDIVITSPYNNIICKAKEILGQER 177

Query: 168 ARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDL 227
               IM N+GRD+LPFLI L+   +  Y+Y  K+H K+S+       +   W       L
Sbjct: 178 VIGFIMPNYGRDILPFLICLQLIVIEKYEYFVKVHTKRSQ----HLNDNGAWFNNNLDYL 233

Query: 228 LGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQ 287
           +G       +                   Y          +  N   I  L   +     
Sbjct: 234 VGNKNATDGLFSIMSDD--------EPQIYGEYILPIQDHIANN---IHWLTYLLEKEPA 282

Query: 288 DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANF 347
             +  F  GTMF      L  I++L+L  +   K +  LDG   HA+ER F         
Sbjct: 283 SVEASFIPGTMFIGNRAFLVLIRDLQLHLFQIEKENGQLDGCCVHAIERYFGYIASVNGG 342

Query: 348 RISDVDCI 355
           +   ++ +
Sbjct: 343 KCCSIETL 350


>gi|291520449|emb|CBK75670.1| Lipopolysaccharide biosynthesis protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 486

 Score =  162 bits (409), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 38/174 (21%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 117 KIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESAS---IKSEILKIFPAARIHIM 173
           K+A+V HLYY++++    + L+ +    D+ +T  ++      I+    K      + + 
Sbjct: 291 KVAVVAHLYYVEMFELCMDYLAKVPYGIDIIITTNSDDKKQNIIEVASEKGVKLTEVIVA 350

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGV 233
           EN GR++   L+      L  Y Y C +H KKS         G  +R  L+   L + G 
Sbjct: 351 ENRGRELAALLVGCGKFLL-KYKYFCFVHDKKSS-AKEHLSVGLAFRDILWDSSLYSEGY 408

Query: 234 VFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQ 287
           +  II  F+ +  +G+         + +  +      N E    L+  + I   
Sbjct: 409 IRNIIDMFEQNECMGLAVPPTVYCGSYFYPFPDYWVGNYEKTIELSKILNINVD 462


>gi|297182567|gb|ADI18727.1| lipopolysaccharide biosynthesis protein [uncultured Rhizobiales
           bacterium HF4000_32B18]
          Length = 887

 Score =  155 bits (393), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 57/237 (24%), Positives = 96/237 (40%), Gaps = 21/237 (8%)

Query: 120 IVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARI--HIMENHG 177
           + VH +Y D + E     +    +  +  T  TE+ + +           I   ++ N G
Sbjct: 648 VHVHAHYTDGFAEDLAGFAAWRHAARVVATTDTEAKAAEIAAAGRNGGVAIETRVVANRG 707

Query: 178 RDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKI 237
           RDVLPFL L +  +  N  + C +H KKS   G +   G +WR +L   LLG P  +   
Sbjct: 708 RDVLPFLELFDGSEDDNALW-CHVHLKKSVGLGPT-SPGAVWRAFLMRILLGGPERLSTA 765

Query: 238 IRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMG--------ITFQDQ 289
           +       + G++G+        +  Y      +R ++  L  R+             D 
Sbjct: 766 LALIRA-PEAGLVGA--------FDPYVMGWTGSRRLLAPLQARLDGWEADGGRRPLPDH 816

Query: 290 KLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKAN 346
            L F  G MFWV+   ++ ++ L  + Y  P      DG + H +ER +  +   A 
Sbjct: 817 PLLFPVGDMFWVKAGVVNAMRRLFGADYPWPGEPLPGDGTVYHLIERLWPTAAALAG 873


>gi|77404644|ref|YP_345218.1| glycosyltransferase [Rhodobacter sphaeroides 2.4.1]
 gi|77390294|gb|ABA81477.1| possible glycosyltransferase [Rhodobacter sphaeroides 2.4.1]
          Length = 793

 Score =  145 bits (367), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 55/265 (20%), Positives = 102/265 (38%), Gaps = 15/265 (5%)

Query: 67  SGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYY 126
             ++   +     M R+L    +R+      +H     A     +     + ++ VH +Y
Sbjct: 537 LEREKMMRYGRRRMWRDLAEVEERLADADNWVHRKLRIAPYGTAEATELPRFSLHVHAFY 596

Query: 127 IDLWIEIANLLSNLSISFDLHVTLVTESA--SIKSEILKIFPAARIHIMENHGRDVLPFL 184
            D   +     +    +  + VT  ++     I++ +  +  A  + +  N GRD+LPFL
Sbjct: 597 TDDLAQDVRRHAAYRCASRIVVTTDSDRKADEIRTLMAAVGLAPEVLVRPNRGRDILPFL 656

Query: 185 ILLETEQLSNYDYV-CKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDT 243
            L      +  D + C +H KKS     S   GD+WR +L   LLG    +         
Sbjct: 657 QLFLPGGAAGEDEIWCHLHQKKSLATTDS---GDIWRAFLLRILLGDEASLSDAATNL-R 712

Query: 244 HRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRT 303
           +  +G++          +  Y      +R ++  +A R+     D  L F  G MF+VR+
Sbjct: 713 NPGVGLVAP--------FDPYFIPWDASRALLPRVAPRLPGPLPDNPLLFPVGNMFFVRS 764

Query: 304 EALDPIKNLRLSRYFEPKVHKALDG 328
             +  + +L  + Y  P       G
Sbjct: 765 AVVRAMNDLFGAGYPGPTNPFPTTG 789


>gi|301632931|ref|XP_002945533.1| PREDICTED: o-antigen export system ATP-binding protein rfbB-like,
           partial [Xenopus (Silurana) tropicalis]
          Length = 367

 Score =  141 bits (355), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/169 (27%), Positives = 69/169 (40%), Gaps = 10/169 (5%)

Query: 192 LSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIG 251
           +  Y  + ++H K+S         G+ WR  L+  L G+   V  I+ TF+TH  +GM+ 
Sbjct: 201 IPRYALILRLHSKRSLHIP--GQVGEEWRALLYTSLAGSRQRVNAIVDTFNTHPKLGMLC 258

Query: 252 SRAYRYPNKYCDYTCSLGKNREMICTLAGRMGIT-FQDQKLDFFAGTMFWVRTEALDPIK 310
                +      +    G N + +C L    GIT   DQ +DF  G+MFW R +AL    
Sbjct: 259 PAVIDHYADCLHF----GGNYKRMCALLQPHGITLPPDQPIDFPMGSMFWCRPQALSVWL 314

Query: 311 NLRLSRYFE-PKVHKAL--DGEIEHAVERCFSLSVKKANFRISDVDCIL 356
               +     P        DG + HA+ER F             V  +L
Sbjct: 315 EPGFTFDDFTPTNDLDTDRDGTLAHALERLFFFGCGLKGLGWGRVPELL 363


>gi|14090418|gb|AAK53494.1| putative methyltransferase [Xanthomonas campestris pv. campestris]
          Length = 212

 Score =  140 bits (352), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 46/187 (24%), Positives = 76/187 (40%), Gaps = 17/187 (9%)

Query: 96  QLLHGW---ESPAMGKVMQIAI---KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVT 149
           +L + W      A+ +   +A         +V+H +Y+D+  E+ + +        + +T
Sbjct: 21  RLGYAWLDATRQALTRAPDVATEICSPSACVVLHAWYLDVLDEMLDAIVECGTPLRIIIT 80

Query: 150 LV-TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKR 208
              T+   +   I +    A +   EN GRD+LPFL +       N   V K+H KKS  
Sbjct: 81  TDLTKVIEVTKCIQRRGIQAEVEGFENRGRDILPFLHVANRLLDENVQLVLKLHTKKST- 139

Query: 209 KGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSL 268
                 +G+ WR  +   LLG P  V  I+  F T   +G+     +  P      T  +
Sbjct: 140 ---HRDDGNAWRGEMLTALLG-PQRVDAIVNAFSTDPLVGLAAPEDHLLP-----VTEFI 190

Query: 269 GKNREMI 275
           G N E  
Sbjct: 191 GGNAERT 197


>gi|291520444|emb|CBK75665.1| Lipopolysaccharide biosynthesis protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 424

 Score =  126 bits (318), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 55/143 (38%), Gaps = 2/143 (1%)

Query: 214 WEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNRE 273
             G  +   ++  LLG+  +V +++  F   + +G++      +   +     S     +
Sbjct: 5   SVGRDFNNRIWQSLLGSKELVEEVLSAFSDEKYLGLLMPSMVTHGEYFHTAIDSWTICYD 64

Query: 274 MICTLAGRMGITFQ--DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
               LA ++G+       +     GT FW RT+AL+ +     S    P     +DG I 
Sbjct: 65  GTVELAKKIGLNVPIYGDRNPLSLGTAFWARTKALEKLFEYNFSYDMFPGEPFPVDGSIS 124

Query: 332 HAVERCFSLSVKKANFRISDVDC 354
           H +ER F      A +    V  
Sbjct: 125 HYIERIFPYVALDAGYYTGIVYT 147


>gi|148238469|ref|YP_001223856.1| sulfotransferase [Synechococcus sp. WH 7803]
 gi|147847008|emb|CAK22559.1| Possible sulfotransferase [Synechococcus sp. WH 7803]
          Length = 476

 Score =  120 bits (300), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 38/161 (23%), Positives = 65/161 (40%), Gaps = 8/161 (4%)

Query: 189 TEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIG 248
            ++L  +D V   H K++         G+ WR+ L       P    +  +T     + G
Sbjct: 4   RDRLKEFDLVVHCHTKRTPHAPD--GFGESWRQSLLQCTFPNPDRCQE-FQTLLHKPEAG 60

Query: 249 MIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLD-FFAGTMFWVRTEALD 307
           +I      +P+++  +  + G N      L   MG T +   L  F AG+ FW R ++L 
Sbjct: 61  LIMP----WPHRFVAHNVNWGSNFTQTRALMNLMGHTIRRDTLLAFPAGSFFWARVDSLL 116

Query: 308 PIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFR 348
            + +L L            DG + H++ERC  L     + R
Sbjct: 117 ALLDLTLRWEDFAAEPLPGDGRLAHSLERCLGLLPMLNDRR 157


>gi|308813905|ref|XP_003084258.1| conserved domain protein (ISS) [Ostreococcus tauri]
 gi|116056142|emb|CAL58323.1| conserved domain protein (ISS) [Ostreococcus tauri]
          Length = 684

 Score = 90.0 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 44/225 (19%), Positives = 72/225 (32%), Gaps = 45/225 (20%)

Query: 159 SEILKIFPAARIHIMENHGRDVLPFLILLETE--QLSNYDYVCKIHGKKSKRKGYSWWEG 216
              L+     R+  +++ G D+  FL  L     +L  + Y+ K+H K            
Sbjct: 126 ERFLRNEKNIRVVHVKDEGYDIGAFLKQLHRFRHELQVHQYILKVHSKSDP--------- 176

Query: 217 DLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAY-----------------RYPN 259
            +W       L G+   V  I++ F+T   + ++                      +Y N
Sbjct: 177 -IWLERAVESLCGSEHQVKSILKAFETQSTLDIVSPMGSTFSATTSKDAVFPHLKRKYFN 235

Query: 260 KYCDYTCSLGKNREMICTLAGRMGITFQDQKLDF----FAGTMFWVR-----TEALDPIK 310
           K    T    K    +  L  ++G+        +     AGTMFW R     TE L  + 
Sbjct: 236 KVDLATAFDDKTMHTMERLCAQLGLEACPYFEKYLASITAGTMFWARNSRLYTEHLPRLF 295

Query: 311 N--LRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVD 353
                                IEHA+ER      +     I D+ 
Sbjct: 296 ESIRNELSQDYSNN-----NRIEHALERLIPTLSRLNGRMIGDIQ 335


>gi|329944274|ref|ZP_08292533.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 170 str.
           F0386]
 gi|328531004|gb|EGF57860.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 170 str.
           F0386]
          Length = 699

 Score = 88.4 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 53/381 (13%), Positives = 103/381 (27%), Gaps = 93/381 (24%)

Query: 9   GYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYV-------- 60
            +  +       + Y D     +    G F           + ++ +  +          
Sbjct: 179 AFRAYWEQMPPVSSYRDSIQWHESRFTGHF------ADLGHTYEVAFPVDRYRSDNPAIE 232

Query: 61  VAYGSRSGKKFFAQSNLYMMERELHFDGQRI-----------------HHFPQLLHG--- 100
            A    +      +   +  +  LH D Q +                      ++H    
Sbjct: 233 EAPALLADGCPLLKRRAFFHD-PLHQDRQGVVGGELLASAAQAGYCEDLILSDVVHTAAA 291

Query: 101 --------------WESPAMGKVMQIAIKAKIAIVVHLYYID--------LWIEIANLLS 138
                           +P               +VVH+               ++A  L+
Sbjct: 292 RDLIVNAGLTEIIPETAPTPTGAQPQVPAPSGCVVVHV--PAGREGIERAEADDLAERLA 349

Query: 139 NLSISFDLHVTLVTE--SASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQL---- 192
           +L   + + VT  +E  +A ++    +     ++  ++  G   + FL   +        
Sbjct: 350 SLPEHWRVVVTSPSELNAADLERVTGRRTTFRKVRDLDPRG--TIAFLTECDDLWDPAHA 407

Query: 193 --------------------SNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPG 232
                                  D V  I        G S    D+ RR +   LL +PG
Sbjct: 408 GDVGASDGGDGTDTTDTAEVDRVDLVLTI--SAGPLSGSSERADDVARRQVLDCLLASPG 465

Query: 233 VVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGIT--FQDQK 290
            V  ++  F  H  +G++   A      Y                L+ R+G+T    +  
Sbjct: 466 YVAGLLDLFGRHPSLGVVMPAACHIGQPYV--GPQWDGLVGAADALSRRLGLTAALDEIA 523

Query: 291 LDFFAGTMFWVRTEALDPIKN 311
                G+MF  R EAL  +  
Sbjct: 524 PVAPVGSMFLARPEALRTLSE 544


>gi|320531345|ref|ZP_08032317.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 171 str.
           F0337]
 gi|320136436|gb|EFW28412.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 171 str.
           F0337]
          Length = 678

 Score = 86.5 bits (213), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 56/376 (14%), Positives = 100/376 (26%), Gaps = 83/376 (22%)

Query: 9   GYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCYDENYVVAYG 64
            +  +       + Y D     +      F      W       R +          A  
Sbjct: 157 AFREYWERMPPVSSYRDSIQWHESRFTDHFAELGHTWEVAFPVDRYRSDNPAIEEAPALL 216

Query: 65  SRSGKKFFAQSNLYM-----MERELHFDGQRIHHFPQLLHGWE----------------- 102
           +        +           +R+    G+ +    +  +  +                 
Sbjct: 217 A--DGCPLLKRRALFHDPLHQDRQAVVGGELLEDAARAGYSEDLILSDVVHNAPARDLIV 274

Query: 103 -----------SPAM----GKVMQIAIKAKIAIVVHLYYID--------LWIEIANLLSN 139
                      +PA      +    A      +VVH+                +A  L++
Sbjct: 275 NAGLTEVVVEAAPAPDEPDPEAGSTAPTPSGCVVVHV--PAGGEGVERAEADGLAQRLAS 332

Query: 140 LSISFDLHVTLVTE-SASIKSEILKIFPAAR-------------IHIMENHGRDVLPFLI 185
           L   + + VT  T   A+    +    PA               +  ++  G   +PFL 
Sbjct: 333 LPAHWRVVVTSPTHLDAADLERLTGRRPADEAAAPGGAAVAFRAVRDLDPRG--TIPFLT 390

Query: 186 LLETEQLSNY--------DYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKI 237
                             D V +I    S     S  + D+ RR +   LL +PG    +
Sbjct: 391 ECGDLWDPGRATGSDGGGDLVLRI-TVGSPSGPESKAD-DVARRQVLDCLLASPGYTAGL 448

Query: 238 IRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITF--QDQKLDFFA 295
           I  F+ H  +G+    A      +     +         TL+ R+G+T            
Sbjct: 449 IDLFERHPGLGVAMPAASHIGQAHG--GPTWDGLAGAAKTLSRRLGLTVELDPVAPVVPV 506

Query: 296 GTMFWVRTEALDPIKN 311
           G MF  R EAL  +  
Sbjct: 507 GAMFMARPEALRTLSE 522


>gi|291520445|emb|CBK75666.1| Lipopolysaccharide biosynthesis protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 109

 Score = 83.4 bits (205), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 6/104 (5%)

Query: 105 AMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHV-TLVTESASIKSEILK 163
            + +  Q+  + + A+  +L++ DL+ E     SNL    D++V T   E   + +  + 
Sbjct: 4   NVTENSQLH-QNRYAVFAYLFFDDLFEESLRYFSNLPNYVDIYVATNTEEKVDVINGYIP 62

Query: 164 IF---PAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGK 204
                   ++ +  N GRDV   L+LL+    SNYD +C +H K
Sbjct: 63  KMLFRHNVKVLLHNNKGRDVSALLVLLKR-YYSNYDVICFVHDK 105


>gi|324991549|gb|EGC23482.1| rhamnosyltransferase [Streptococcus sanguinis SK353]
          Length = 556

 Score = 79.2 bits (194), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 51/385 (13%), Positives = 115/385 (29%), Gaps = 59/385 (15%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSK--KLCYDE-NYV 60
           K +  F S  + +    D  +  +      F    F +   L  ++ +  +L + + +Y 
Sbjct: 150 KAFREFWSQVEDFTDVQDVIDHYETKFTKRFVEAGFRYQALLDTRQEEAGELVHPDFSYY 209

Query: 61  VAYGSRSGKKFFAQS-----NLYMM---------ERELHFDGQRIHHFPQLLHGWESP-- 104
                   K  F +      N ++                   R H F     G + P  
Sbjct: 210 KPLRILEAKVPFLKVKALTGNPFLARYLLEDLETNSSYPTSLIREHLFYHF--GPDLPCL 267

Query: 105 -AMGKVMQIAIKAKIA--IVVHLYYID--LWIEIANLLSNLSISFDLHVTL--VTESASI 157
                + Q     + A  +++H++  D  ++ +  + L +LS  +   VT         +
Sbjct: 268 LEDKYLSQATSNYRAALPVLLHIHVTDFPIFQQYQDKLFSLSSQYQYLVTTDQPEVLKQL 327

Query: 158 KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRK--GYSWWE 215
           ++ +  +    +I + +   R  L  L   + E L +Y Y+  +    S  +  G     
Sbjct: 328 QTALGHLGNKVQIVLSQ-KSRAWLAMLE--QKEILQDYAYIGHL----STHRLVGNQAVF 380

Query: 216 GDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMI 275
               R  L   ++         I   +    +G++     R        +      R  +
Sbjct: 381 DQAMRSDLINMMV---DYADASIEALEKESAVGLVIPDLPRLVRDGLFESEPP---RPRL 434

Query: 276 CTLAGRMGITFQDQKLDFF-----AGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEI 330
             +    G+      +         G+  W +  AL  +  ++          +  D   
Sbjct: 435 AAVWQEAGLHKSFDFIITPSLTRVYGSFVWFKYSALASLFQMKSLESLPSFEQELSD--- 491

Query: 331 EHAVERCFSLSV--KKANFRISDVD 353
              +E            +F+I  + 
Sbjct: 492 --VLEHLLVYLAWDSHYDFKIMPLS 514


>gi|291520448|emb|CBK75669.1| Lipopolysaccharide biosynthesis protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 625

 Score = 77.7 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 24/56 (42%)

Query: 297 TMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDV 352
           + FW RTEAL  +     S  F PK     +    HA+ER F      A +  S +
Sbjct: 4   SCFWCRTEALKKLLEYDFSYNFFPKEPMDANLTTSHAIERIFPYVACDAGYYTSTI 59



 Score = 45.3 bits (106), Expect = 0.013,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 36/99 (36%), Gaps = 5/99 (5%)

Query: 221 RWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAG 280
           ++ F +L+   G +  I   F  ++ +G++G+       +         K  + I     
Sbjct: 421 QYTFDELIKNNGYISAICEVFKENQSVGVVGNIYGEIIFQINSNMNIYSKYEDEILEFEK 480

Query: 281 RMGITFQ---DQKLDFFAGTMFWVRTEALDPIKNLRLSR 316
           R    F       L  + G  FW+R +AL  I +     
Sbjct: 481 RFNFDFNRGGKHSLLNYNG--FWLRRDALQMIADCEDIY 517


>gi|326772087|ref|ZP_08231372.1| hypothetical protein HMPREF0059_00469 [Actinomyces viscosus C505]
 gi|326638220|gb|EGE39121.1| hypothetical protein HMPREF0059_00469 [Actinomyces viscosus C505]
          Length = 681

 Score = 74.2 bits (181), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 51/385 (13%), Positives = 94/385 (24%), Gaps = 94/385 (24%)

Query: 9   GYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCYDENYVVAYG 64
            +  +       + Y D     +    G F      W       R +          A  
Sbjct: 157 AFREYWEQMPPVSSYRDSIQWHESRFTGHFAELGHTWQVAFPVDRYRSENPAIEEAPALL 216

Query: 65  SRSGKKFFAQSNLYM-----MERELHFDGQRIHHFPQLLHGWE----------------- 102
           +        +           +R+    G+ +    +  +  +                 
Sbjct: 217 A--DGCPLLKRRALFHDPLHQDRQAVVGGELLEAAARAGYSEDLILSDVVHTAAARDLIV 274

Query: 103 -----------SPAMG----KVMQIAIKAKIAIVVHLYYI---DLWIE-----IANLLSN 139
                       P       +      +    +VVH+      +         +A  L++
Sbjct: 275 NAGLTEVVTGCVPGAAGAGAETSSPERRPTGCVVVHV--PAGREALERAEADGLAQRLAS 332

Query: 140 LSISFDLHVTLVT--ESASIKSEILKIFPAARIHIMENHG---------RDVLP-----F 183
           L   + + VT     ++A ++    +            HG         RD+ P     F
Sbjct: 333 LPAHWRVVVTSPERLDAADLERVTGRRPSQEDTQEDSAHGEGDVSFRLVRDLDPRGTIAF 392

Query: 184 LILLETEQLSNYD-----------YVCKIHGKKSKRKGYSWWEG----DLWRRWLFYDLL 228
           L   +                    V +I        G     G    D+  R     LL
Sbjct: 393 LTQCDDLWDPGRAAGGDEGGDSGPLVLRI------TVGPPPVPGTRADDVAHRQALDCLL 446

Query: 229 GAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGI--TF 286
            +PG    +I  F  H  +G+    A      +     +          L+ R+G+    
Sbjct: 447 DSPGYTAGLIDLFARHPGLGVAMPAAGHIGQAHG--GPTWDGLAGAAKALSRRLGLSAEL 504

Query: 287 QDQKLDFFAGTMFWVRTEALDPIKN 311
                    G MF  R EAL  +  
Sbjct: 505 DPLAPVAPPGAMFMARPEALRTLSE 529


>gi|332361934|gb|EGJ39736.1| rhamnosyltransferase [Streptococcus sanguinis SK49]
          Length = 556

 Score = 73.0 bits (178), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 48/387 (12%), Positives = 110/387 (28%), Gaps = 63/387 (16%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLF-------------YKRS 50
           K +  F S  + +    D  +  +      F    F +   L              +   
Sbjct: 150 KTFREFWSQVEDFTDVQDVIDHYETQFTKRFVEAGFRYQALLDTRQEEAGELLHPDFSYY 209

Query: 51  KKLCYDENYVVAYGSRSGKKFFAQSNLYMM---------ERELHFDGQRIHHFPQLLHGW 101
           K L   E  V     ++      + N ++                   R H F       
Sbjct: 210 KPLRILEAKVPFLKVKA-----LRGNPFLARYLLEELEINSSYPTFLIREHLFYHFGPDL 264

Query: 102 ESPAMGK-VMQIAIKAKIA--IVVHLYYIDL--WIEIANLLSNLSISFDLHVTL--VTES 154
                 K + Q     + A  +++H++  DL  + +  + L +LS  +   VT+      
Sbjct: 265 PCLLQDKYLSQATSNYRSAQPVLLHIHVTDLPIFQQYQDKLFSLSSQYQYLVTVAQPEML 324

Query: 155 ASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWW 214
             +++ +  +    ++ + +      +  L   + E L NY Y+  +    S  +     
Sbjct: 325 KQLQTALGHLGNKVQLVLSQ-KSYAWIAMLE--QKEILQNYAYIGHL----STHRL--VE 375

Query: 215 EGDLWRRWLFYDLLG-APGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNRE 273
               + + +  DL+          I   +    +G++     R        +      R 
Sbjct: 376 NQAAFDQTMRSDLINLMVDYADASIEALEKEAAVGLVIPDLPRLVRDGLFES---EPARP 432

Query: 274 MICTLAGRMGITFQDQKLDFF-----AGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDG 328
            +  +    G+      +         G   W +  AL  +  ++          +  D 
Sbjct: 433 RLAAIWQEAGLHKSFDFMTAPSLTRVYGGFLWFKYSALASLFPMKSLENSPSSEQELSD- 491

Query: 329 EIEHAVERCFSLSV--KKANFRISDVD 353
                +E+           +F+I  + 
Sbjct: 492 ----VLEQLLVYLAWDNHYDFKIMPLS 514


>gi|325690859|gb|EGD32860.1| rhamnosyltransferase [Streptococcus sanguinis SK115]
          Length = 556

 Score = 70.3 bits (171), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 49/384 (12%), Positives = 107/384 (27%), Gaps = 57/384 (14%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKK---LCYDENYV 60
           K +  F S  + +    D  +  +      F    F +   L  ++ +    L  D +Y 
Sbjct: 150 KAFREFWSQVEDFTDVQDVIDHYETKFTKRFVEAGFRYQALLDTRQEEAGELLHPDFSYY 209

Query: 61  VAYGSRSGKKFFAQS-----NLYMM---------ERELHFDGQRIHHFPQLLHG-----W 101
                   K  F +      N ++                   R H F            
Sbjct: 210 KPLRILEAKLPFLKVKALTGNPFLARYLLEDLETNSSYPTSLIREHLFYHFGPDLPCLLQ 269

Query: 102 ESPAMGKVMQIAIKAKIAIVVHLYYIDL--WIEIANLLSNLSISFDLHVTL--VTESASI 157
           +               + + +H+   DL  + +  N L +LS  +   VT+        +
Sbjct: 270 DKYLSQATSNYRTNQPVLLHIHV--TDLPIFQQYQNKLFSLSSQYQYLVTVTQPEMLKQL 327

Query: 158 KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRK-GYSWWEG 216
           ++ +  +    ++ + +      L  L   + E L +Y Y+  +    S  +   +    
Sbjct: 328 QTTLAHLGDKVQLVLSQ-KSHAWLAMLE--QKEILQDYAYIGHL----STHRIMENQAVF 380

Query: 217 DLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMIC 276
           D   R    +L+         I   +    +G++     R        +  L   R  + 
Sbjct: 381 DQAMRSDLINLM--VDYADASIEALEQESAVGLVIPDLPRLVRDGLFESEPL---RPRLA 435

Query: 277 TLAGRMGITFQDQKLDFF-----AGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
            +    G+      +         G   W +  AL  +  ++          +  D    
Sbjct: 436 AIWQEAGLHKSFDFMTPPSLTRVYGGFVWFKYSALASLFQMKSLESLPSSEQELSD---- 491

Query: 332 HAVERCFSLSV--KKANFRISDVD 353
             +E            +F+I  + 
Sbjct: 492 -VLEHLLVYLAWDSHYDFKIMPLS 514


>gi|325694904|gb|EGD36809.1| rhamnosyltransferase [Streptococcus sanguinis SK150]
          Length = 556

 Score = 69.9 bits (170), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 43/379 (11%), Positives = 104/379 (27%), Gaps = 55/379 (14%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKR--SKKLCYDE-NYV 60
           K +  F S  + +    D  +  +      F    F +   L  ++  +++L + + +Y 
Sbjct: 150 KAFREFWSQVEDFADVQDVIDHYETQFTKRFVEAGFRYQSLLDTRQEVARELLHPDFSYY 209

Query: 61  VAYGSRSGKKFFAQS-----NLYMM---------ERELHFDGQRIHHFPQLLHG-----W 101
                   K  F +      N ++                   R H F            
Sbjct: 210 KPLRILEAKVPFLKVKALTGNPFLARYLLEELETNSSYPTSLIREHLFYHFGPDLPCLLQ 269

Query: 102 ESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTL--VTESASIKS 159
           +               + + +H+    ++ +    L +L+  +   VT         +++
Sbjct: 270 DKYLSQSTSSYRTNQSVLLHIHVTNFPIFQQYQEKLFSLASQYQYLVTTNLPEMLKQLQT 329

Query: 160 EILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRK--GYSWWEGD 217
            +  +    +I + +     +L  L   + E L NY Y+  +    S  +          
Sbjct: 330 ALAHLDDKVQIVLSQ-KSHALLAMLE--QKEILQNYVYIGHL----STHRIMENQAVFDQ 382

Query: 218 LWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICT 277
             R  L   ++         I   +    +G++     R        +     +   +  
Sbjct: 383 AMRSDLINMMV---DYADASIEALEQESAVGLVIPDLPRLVRDGLFESEPPLPS---LTA 436

Query: 278 LAGRMGITFQDQKLDFF-----AGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           +    G+      +         G   W +  AL  +  ++          +  D     
Sbjct: 437 VWQEAGLHKSFDFMTAPSLTRVYGGFLWFKYSALTSLFQMKSLESLPSSEQELSD----- 491

Query: 333 AVERCFSLSV--KKANFRI 349
            +E            +F+I
Sbjct: 492 VLEHLLVYIAWDSHYDFKI 510


>gi|327489888|gb|EGF21677.1| rhamnosyltransferase [Streptococcus sanguinis SK1058]
          Length = 556

 Score = 68.0 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 43/381 (11%), Positives = 106/381 (27%), Gaps = 59/381 (15%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSK--KLCYDE-NYV 60
           K +  F S  + +    D  +  +      F    F +   L  ++ +  +L + + +Y 
Sbjct: 150 KSFREFWSQVEDFTDVQDVIDHYETQFTKRFVEAGFKYQALLDTRQEEAGELVHPDFSYY 209

Query: 61  VAYGSRSGKKFFAQS-----NLYMM---------ERELHFDGQRIHHFPQLLHG-----W 101
                   K  F +      N ++                   R H F            
Sbjct: 210 KPLRILEAKIPFLKVKALTGNPFLARYLLEDLETNSSYPTSLIREHLFYHFGPDLPCLLE 269

Query: 102 ESPAMGKVMQIAIKAKIAIVVHLYYID--LWIEIANLLSNLSISFDLHVTL--VTESASI 157
           +               + + +H+   D  ++ +  + L +LS  ++  +T         +
Sbjct: 270 DKYLSQATSNYRTDQPVLLHIHV--TDFPIFQQYQDKLFSLSSQYEYLLTTNQPEVLKQL 327

Query: 158 KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRK--GYSWWE 215
           ++ +  +    ++ + +   R  L  L   + E L +Y Y+  +    S  +  G     
Sbjct: 328 QTALGHLGNKVQLVLSQ-KSRAWLAMLE--QKEILQDYAYIGHL----STHRLVGNQAVF 380

Query: 216 GDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMI 275
               R  L   ++         I   +    +G++     R        +     +   +
Sbjct: 381 DQAMRSDLINMMV---DYADASIEALEQESAVGLVIPDLPRLVRDGLFESEPPLPS---L 434

Query: 276 CTLAGRMGITFQDQKLDFF-----AGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEI 330
             +     +      +         G   W +  AL  +  ++          +  D   
Sbjct: 435 TAVWQEAVLHKSFDFMTAPSLTRVYGGFLWFKYSALTSLFRMKSLESLPSSEQELSD--- 491

Query: 331 EHAVERCFSLSV--KKANFRI 349
              +E            +F+I
Sbjct: 492 --VLEHLLVYIAWDSHYDFKI 510


>gi|324993910|gb|EGC25829.1| rhamnosyltransferase [Streptococcus sanguinis SK405]
 gi|324994771|gb|EGC26684.1| rhamnosyltransferase [Streptococcus sanguinis SK678]
          Length = 556

 Score = 68.0 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 44/381 (11%), Positives = 107/381 (28%), Gaps = 59/381 (15%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSK--KLCYDE-NYV 60
           K +  F S  + +    D  +  +      F    F +   L  ++ +  +L + + +Y 
Sbjct: 150 KSFREFWSQVEDFTDVQDVIDHYETQFTKRFVEAGFKYQALLDTRQEEAGELVHPDFSYY 209

Query: 61  VAYGSRSGKKFFAQS-----NLYMM---------ERELHFDGQRIHHFPQLLHG-----W 101
                   K  F +      N ++                   R H F            
Sbjct: 210 KPLRILEAKIPFLKVKALTGNPFLARYLLEDLETNSSYPTSLIREHLFYHFGPDLPCLLQ 269

Query: 102 ESPAMGKVMQIAIKAKIAIVVHLYYID--LWIEIANLLSNLSISFDLHVTL--VTESASI 157
           +               + + +H+   D  ++ +  + L +LS  ++  +T         +
Sbjct: 270 DKYLSQATSNYRTDQPVLLHIHV--TDFPIFQQYQDKLFSLSSQYEYLLTTNQPEVLKQL 327

Query: 158 KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRK--GYSWWE 215
           ++ +  +    ++ + +   R  L  L   + E L +Y Y+  +    S  +  G     
Sbjct: 328 QTALGHLGNKVQLVLSQ-KSRAWLAMLE--QKEILQDYAYIGHL----STHRLVGNQAVF 380

Query: 216 GDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMI 275
               R  L   ++         I   +    +G++     R        +     +   +
Sbjct: 381 DQAMRSDLINMMV---DYADASIEALEQESAVGLVIPDLPRLVRDGLFESEPPLPS---L 434

Query: 276 CTLAGRMGITFQDQKLDFF-----AGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEI 330
             +     +      +         G   W +  AL  +  ++          +  D   
Sbjct: 435 TAVWQEAVLHKSFDFMTAPSLTRVYGGFLWFKYSALTSLFRMKSLESLPSSEQELSD--- 491

Query: 331 EHAVERCFSLSV--KKANFRI 349
              +E      V     +F+I
Sbjct: 492 --VLEHLLVYIVWDSHYDFKI 510


>gi|327461067|gb|EGF07400.1| rhamnosyltransferase [Streptococcus sanguinis SK1057]
          Length = 556

 Score = 67.2 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 49/384 (12%), Positives = 107/384 (27%), Gaps = 57/384 (14%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKK---LCYDENYV 60
           K +  F S  + +    D  +  +      F    F +   L  ++ +    L  D +Y 
Sbjct: 150 KAFREFWSQVEDFTDVQDVIDHYETKFTKRFVEAGFRYQALLDTRQEEAGELLHPDFSYY 209

Query: 61  VAYGSRSGKKFFAQS-----NLYMM---------ERELHFDGQRIHHFPQLLHG-----W 101
                   K  F +      N ++                   R H F            
Sbjct: 210 KPLRILEAKLPFLKVKALTGNPFLARYLLEDLETNSSYPTSLIREHLFYHFGPDLPCLLQ 269

Query: 102 ESPAMGKVMQIAIKAKIAIVVHLYYIDL--WIEIANLLSNLSISFDLHVTL--VTESASI 157
           +               + + +H+   DL  + +  N L +LS  +   VT+        +
Sbjct: 270 DKYLSQATSNYRTNQPVLLHIHV--TDLPIFQQYQNKLFSLSSQYQYLVTVTQPEMLKQL 327

Query: 158 KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRK-GYSWWEG 216
           ++ +  +    ++ + +      L  L   + E L +Y Y+  +    S  +   +    
Sbjct: 328 QTTLAHLGDKVQLVLSQ-KSHAWLAMLE--QKEILQDYAYIGHL----STHRIMENQAVF 380

Query: 217 DLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMIC 276
           D   R    +L+         I   +    +G++     R        +  L   R  + 
Sbjct: 381 DQAMRSDLINLM--VDYADASIEALEQESAVGLVIPDLPRLVRDGLFESEPL---RPRLA 435

Query: 277 TLAGRMGITFQDQKLDFF-----AGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
            +    G+      +         G   W +  AL  +  ++          +  D    
Sbjct: 436 AIWQEAGLHKSFDFMTPPSLTRVYGGFVWFKYSALASVFRMKSLESLPSSEQEFSD---- 491

Query: 332 HAVERCFSLSV--KKANFRISDVD 353
             +E            +F+I  + 
Sbjct: 492 -VLEHLLVYLAWDNHYDFKIMPLS 514


>gi|327463172|gb|EGF09493.1| rhamnosyltransferase [Streptococcus sanguinis SK1]
 gi|327474781|gb|EGF20186.1| rhamnosyltransferase [Streptococcus sanguinis SK408]
          Length = 556

 Score = 67.2 bits (163), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 43/381 (11%), Positives = 106/381 (27%), Gaps = 59/381 (15%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSK--KLCYDE-NYV 60
           K +  F S  + +    D  +  +      F    F +   L  ++ +  +L + + +Y 
Sbjct: 150 KSFREFWSQVEDFTDVQDVIDHYETQFTKRFVEAGFKYQALLDTRQEEAGELVHPDFSYY 209

Query: 61  VAYGSRSGKKFFAQS-----NLYMM---------ERELHFDGQRIHHFPQLLHG-----W 101
                   K  F +      N ++                   R H F            
Sbjct: 210 KPLRILEAKIPFLKVKALTGNPFLARYLLEDLETNSSYPTSLIREHLFYHFGPDLPCLLQ 269

Query: 102 ESPAMGKVMQIAIKAKIAIVVHLYYID--LWIEIANLLSNLSISFDLHVTL--VTESASI 157
           +               + + +H+   D  ++ +  + L +LS  ++  +T         +
Sbjct: 270 DKYLSQATSNYRTDQPVLLHIHV--TDFPIFQQYQDKLFSLSSQYEYLLTTNQPEVLKQL 327

Query: 158 KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRK--GYSWWE 215
           ++ +  +    ++ + +   R  L  L   + E L +Y Y+  +    S  +  G     
Sbjct: 328 QTALGHLGNKVQLVLSQ-KSRAWLAMLE--QKEILQDYAYIGHL----STHRLVGNQAVF 380

Query: 216 GDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMI 275
               R  L   ++         I   +    +G++     R        +     +   +
Sbjct: 381 DQAMRSDLINMMV---DYADASIEALEQESAVGLVIPDLPRLVRDGLFESEPPLPS---L 434

Query: 276 CTLAGRMGITFQDQKLDFF-----AGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEI 330
             +     +      +         G   W +  AL  +  ++          +  D   
Sbjct: 435 TAVWQEAVLHKSFDFMTAPSLTRVYGGFLWFKYSALTSLFRMKSLESLPSSEQELSD--- 491

Query: 331 EHAVERCFSLSV--KKANFRI 349
              +E            +F+I
Sbjct: 492 --VLEHLLVYIAWDSHYDFKI 510


>gi|327470704|gb|EGF16160.1| rhamnosyltransferase [Streptococcus sanguinis SK330]
          Length = 556

 Score = 67.2 bits (163), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 44/385 (11%), Positives = 106/385 (27%), Gaps = 59/385 (15%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSK--KLCYDE-NYV 60
           K +  F S  + +    D  +  +      F    F +   L  ++ +  +L + + +Y 
Sbjct: 150 KSFREFWSQVEDFTDVQDVIDHYETQFTKRFVEAGFKYQALLDTRQEEAGELVHPDFSYY 209

Query: 61  VAYGSRSGKKFFAQS-----NLYMM---------ERELHFDGQRIHHFPQLLHG-----W 101
                   K  F +      N ++                   R H F            
Sbjct: 210 KPLRILEAKIPFLKVKALTGNPFLARYLLEDLETNSSYPTSLIREHLFYHFGPDLPCLLQ 269

Query: 102 ESPAMGKVMQIAIKAKIAIVVHLYYID--LWIEIANLLSNLSISFDLHVTL--VTESASI 157
           +               + + +H+   D  ++ +  + L +LS  +   VT+        +
Sbjct: 270 DKYLSQATSNYRTDQPVLLHIHV--TDFPIFQQYQDKLFSLSSQYQYLVTVTQPEMLKQL 327

Query: 158 KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRK--GYSWWE 215
           ++ +  +    ++ + +      L  L   + E L +Y Y+  +    S  +        
Sbjct: 328 QTTLAHLGDKVQLVLSQ-KSHAWLAMLE--QKEILQDYAYIGHL----STHRIMENQAVF 380

Query: 216 GDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMI 275
               R  L   ++         I   +    +G++     R        +      R  +
Sbjct: 381 DQAMRSDLINMMVY---YADTSIEALEQESAVGLVIPDLPRLVRDGLFESEPP---RPRL 434

Query: 276 CTLAGRMGITFQDQKLDFF-----AGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEI 330
             +    G+      +         G   W +  AL  +  ++          +  D   
Sbjct: 435 AAIWQEAGLHKSFDFMTPPSLTRVYGGFVWFKYSALASLFQMKSLESLPSSEQELSD--- 491

Query: 331 EHAVERCFSLSV--KKANFRISDVD 353
              +E            +F+I  + 
Sbjct: 492 --VLEHLLVYLAWDSHYDFKIMPLS 514


>gi|332362506|gb|EGJ40306.1| rhamnosyltransferase [Streptococcus sanguinis SK1056]
          Length = 556

 Score = 67.2 bits (163), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 49/384 (12%), Positives = 107/384 (27%), Gaps = 57/384 (14%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKK---LCYDENYV 60
           K +  F S  + +    D  +  +      F    F +   L  ++ +    L  D +Y 
Sbjct: 150 KAFREFWSQVEDFADVQDVIDHYETKFTKRFLEAGFRYQALLDTRQEEAGELLHPDFSYY 209

Query: 61  VAYGSRSGKKFFAQS-----NLYMM---------ERELHFDGQRIHHFPQLLHG-----W 101
                   K  F +      N ++                   R H F            
Sbjct: 210 KPLRILEAKLPFLKVKALTGNPFLARYLLEDLETNSSYPTSLIREHLFYHFGPDLPCLLQ 269

Query: 102 ESPAMGKVMQIAIKAKIAIVVHLYYIDL--WIEIANLLSNLSISFDLHVTL--VTESASI 157
           +               + + +H+   DL  + +  N L +LS  +   VT+        +
Sbjct: 270 DKYLSQATSNYRTNQPVLLHIHV--TDLPIFQQYQNKLFSLSSQYQYLVTVTQPEMLKQL 327

Query: 158 KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRK-GYSWWEG 216
           ++ +  +    ++ + +      L  L   + E L +Y Y+  +    S  +   +    
Sbjct: 328 QTTLAHLGDKVQLVLSQ-KSHAWLAMLE--QKEILQDYAYIGHL----STHRIMENQAVF 380

Query: 217 DLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMIC 276
           D   R    +L+         I   +    +G++     R        +  L   R  + 
Sbjct: 381 DQAMRSDLINLM--VDYADASIEALEQESAVGLVIPDLPRLVRDGLFESEPL---RPRLA 435

Query: 277 TLAGRMGITFQDQKLDFF-----AGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
            +    G+      +         G   W +  AL  +  ++          +  D    
Sbjct: 436 AIWQEAGLHKSFDFMTPPSLTRVYGGFVWFKYSALASVFRMKSLESLPSSEQEFSD---- 491

Query: 332 HAVERCFSLSV--KKANFRISDVD 353
             +E            +F+I  + 
Sbjct: 492 -VLEHLLVYLAWDNHYDFKIMPLS 514


>gi|332359457|gb|EGJ37277.1| rhamnosyltransferase [Streptococcus sanguinis SK355]
          Length = 556

 Score = 66.9 bits (162), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 45/382 (11%), Positives = 101/382 (26%), Gaps = 61/382 (15%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSK--KLCYDE-NYV 60
           K +  F S  + +    D  N  +      F    F +   L  ++ +  +L + + +Y 
Sbjct: 150 KTFHEFWSQVEDFTDVQDVINHYETRFTKLFVEAGFRYQALLDTRQEEAGELVHPDFSYY 209

Query: 61  VAYGSRSGKKFFAQS-----NLYMM---------ERELHFDGQRIHHFPQLLHG-----W 101
                   K  F +      N ++                   R H F            
Sbjct: 210 KPLRILEAKVPFLKVKALTGNPFLARYLLEDLETNSSYPTSLIREHLFYHFGPDLPCLLE 269

Query: 102 ESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANL---LSNLSISFDLHVTL--VTESAS 156
           +               + + +H+   D +         L +L   +   VT         
Sbjct: 270 DKYLSQSTSNYRTDQPVLLHIHV--TD-FPIFLQYQDKLFSLLSQYQYLVTTDQPEVLKQ 326

Query: 157 IKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRK--GYSWW 214
           +++ ++ +    ++ + +      L  L   + E L NY Y+  +    S  +       
Sbjct: 327 LQTALVHLGNKVQLVLSQ-KSHAWLAMLE--QKEILQNYAYIGHL----STHRLVENQAI 379

Query: 215 EGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREM 274
                R  L   ++         I   +    +G++     R        +      R  
Sbjct: 380 FDQAIRSDLINMMV---DYADASIEALEQESALGLVIPDLPRLVRDGLFESEPP---RSW 433

Query: 275 ICTLAGRMGITFQDQKLDFF-----AGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGE 329
           +  +    G+      +         G   W +  AL  +  ++          +  D  
Sbjct: 434 LAAVWQEAGLHKSFDFMIAPSLTRVYGGFLWFKYSALASVFQMKSLESLPSSDQELSD-- 491

Query: 330 IEHAVERCFSLSV--KKANFRI 349
               +E            +F+I
Sbjct: 492 ---VLEHLLVYLAWDSHYDFKI 510


>gi|325696073|gb|EGD37964.1| rhamnosyltransferase [Streptococcus sanguinis SK160]
          Length = 556

 Score = 66.5 bits (161), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 48/384 (12%), Positives = 111/384 (28%), Gaps = 57/384 (14%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLF-------------YKRS 50
           K +  F S  + +    D  +  +      F    F +   L              +   
Sbjct: 150 KSFREFWSQVEDFTDVQDVIDHYETQFTKRFVEAGFRYQSLLDTRQEEAGELLHPDFSYY 209

Query: 51  KKLCYDENYVVAYGSR--SGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESP---A 105
           K L   E  +     +  +G  F A+  L  +E    +    I        G + P    
Sbjct: 210 KPLRILEAKLPFLKVKALTGTPFLARYLLEELETNSSYPTSLIREHLFYHFGPDLPCLLQ 269

Query: 106 MGKVMQIAIKAKIA--IVVHLYYID--LWIEIANLLSNLSISFDLHVTL--VTESASIKS 159
              + Q     + A  +++H++  D  ++    + L +LS  +   VT+        +++
Sbjct: 270 DKYLSQATSNYRAAQPVLLHIHVTDFPIFQHYQDKLFSLSSQYQYLVTVAQPEMLKQLQT 329

Query: 160 EILKIFPAARIHIMENHGRDVLPFLILL-ETEQLSNYDYVCKIHGKKSKRK--GYSWWEG 216
            +  +    ++ + +        +L +L + E L +Y Y+  +    S  +         
Sbjct: 330 ALAHLGDKVQLVLSQAS----HAWLAMLDQKEILQDYAYIGHL----STHRLVENQAVFD 381

Query: 217 DLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMIC 276
              R  L   ++         I   +    +G++     R        +      R  + 
Sbjct: 382 QAMRSDLINMMVY---YADTSIEALEQESAVGLVIPDLPRLVRDGLFESEPP---RPRLA 435

Query: 277 TLAGRMGITFQDQKLDFF-----AGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
            +     +      +         G   W +  AL  +  ++          +  D    
Sbjct: 436 AIWQEADLHKSFDCMTPPSLTRVYGGFVWFKYSALASLFQMKSLESLPSSEQELSD---- 491

Query: 332 HAVERCFSLSV--KKANFRISDVD 353
             +E            +F+I  + 
Sbjct: 492 -VLEHLLVYLAWDSHYDFKIMPLS 514


>gi|323351266|ref|ZP_08086922.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           sanguinis VMC66]
 gi|322122490|gb|EFX94201.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           sanguinis VMC66]
          Length = 556

 Score = 66.5 bits (161), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 48/380 (12%), Positives = 109/380 (28%), Gaps = 57/380 (15%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSK--KLCYDE-NYV 60
           K +  F S  + +    D  +  +      F    F +   L  ++ +  +L + + +Y 
Sbjct: 150 KSFREFWSQVEDFTDVQDVIDHYETQFTKRFVEAGFKYQALLDTRQEEAGELVHPDFSYY 209

Query: 61  VAYGSRSGKKFFAQS-----NLYMM---------ERELHFDGQRIHHFPQLLHG-----W 101
                   K  F +      N ++                   R H F            
Sbjct: 210 KPLRILEAKIPFLKVKALTGNPFLARYLLEDLETNSSYPTSLIREHLFYHFGPDLPCLLQ 269

Query: 102 ESPAMGKVMQIAIKAKIAIVVHLYYID--LWIEIANLLSNLSISFDLHVTL--VTESASI 157
           +               + + +H+   D  ++ +  + L +LS  ++  +T         +
Sbjct: 270 DKYLSQATSNYRTDQPVLLHIHV--TDFPIFQQYQDKLFSLSSQYEYLLTTNQPEVLKQL 327

Query: 158 KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKG-YSWWEG 216
           ++ +  +    +I + +   R  L  L   + E L +Y Y+  +    S  +   +    
Sbjct: 328 QTALGHLGNKVQIVLSQ-KSRAWLAMLE--QKEILQDYAYIGHL----STHRLVENQAVF 380

Query: 217 DLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMIC 276
           D   R    +L+         I   +    +G++     R        T  L   R  + 
Sbjct: 381 DQAMRSDLINLM--VDYADASIEALEQESAVGLVIPDLPRLVRDGLFETEPL---RPSLS 435

Query: 277 TLAGRMGITFQDQKLDF-----FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
            +    G+      +         G   W +  AL  +  ++          +  D    
Sbjct: 436 AVWQEAGLHKSFDFMTASSLTRVYGGFLWFKNSALASLFQMKSLESLPSSDQELSD---- 491

Query: 332 HAVERCFSLSV--KKANFRI 349
             +E            +F+I
Sbjct: 492 -VLEHLLVYLAWDSHYDFKI 510


>gi|332367199|gb|EGJ44935.1| rhamnosyltransferase [Streptococcus sanguinis SK1059]
          Length = 556

 Score = 66.1 bits (160), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 45/391 (11%), Positives = 103/391 (26%), Gaps = 71/391 (18%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKK---LCYDENYV 60
           K +  F S  + +    D  +  +      F    F +   L  ++ +    L  D +Y 
Sbjct: 150 KAFREFWSQVEDFTDIQDVIDHYETQFTKRFVEAGFRYQSLLDTRQEEAGELLHPDFSYY 209

Query: 61  VAYGSRSGKKFFAQS-----NLYMM---------ERELHFDGQRIHHFPQLLHG-----W 101
                   K  F +      N ++                   R H F            
Sbjct: 210 KPLRILEAKLPFLKVKALTGNPFLARYLLEELETNSSYPTSLIREHLFYHFGPDLPCLLQ 269

Query: 102 ESPAMGKVMQIAIKAKIAIVVHL-------YYIDLWIEIANLLSNLSISFDLHVTL--VT 152
           +               + + +H+       +Y D        L +LS  +   VT+    
Sbjct: 270 DKYLSQATSNYRADQPVLLHIHVTDFPIFQHYQD-------KLFSLSSQYQYLVTVAQPE 322

Query: 153 ESASIKSEILKIFPAARIHIMENHGRDVLPFLILL-ETEQLSNYDYVCKIHGKKSKRK-- 209
               +++ +  +    ++ + +        +L +L + E L +Y Y+  +    S  +  
Sbjct: 323 MLKQLQTALAHLGDKVQLVLSQAS----HAWLAMLDQKEILQDYAYIGHL----STHRLV 374

Query: 210 GYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLG 269
                     R  L   ++         I   +    +G++     R        +    
Sbjct: 375 ENQAVFDQAMRSDLINMMVY---YADTSIEALEQESAVGLVIPDLPRLVRDGLFESEPP- 430

Query: 270 KNREMICTLAGRMGITFQDQKLDFF-----AGTMFWVRTEALDPIKNLRLSRYFEPKVHK 324
             R  +  +     +      +         G   W +  AL  +  ++          +
Sbjct: 431 --RPRLAAIWQEADLHKSFDFMTPPSLTRVYGGFVWFKYSALASLFQMKSLESLPSSEQE 488

Query: 325 ALDGEIEHAVERCFSLSV--KKANFRISDVD 353
             D      +E            +F+I  + 
Sbjct: 489 LSD-----VLEHLLVYLAWDSHYDFKIMPLS 514


>gi|160894490|ref|ZP_02075266.1| hypothetical protein CLOL250_02042 [Clostridium sp. L2-50]
 gi|156863801|gb|EDO57232.1| hypothetical protein CLOL250_02042 [Clostridium sp. L2-50]
          Length = 783

 Score = 65.7 bits (159), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 46/354 (12%), Positives = 90/354 (25%), Gaps = 73/354 (20%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSK-KLCYDENYVV 61
           S  +  +         Y +     +      F    F W      + +     Y      
Sbjct: 159 SVEFETYWKTRPMITCYEEAVAFHEAIFTQHFSNCGFKWKAYCNPEENVIANPYPLFMAP 218

Query: 62  AYGSRSGKKFFAQSNLYM-------MERELHFDGQRIHHFPQLLHGW------------- 101
                     F +  L+        ++   +        F Q +                
Sbjct: 219 IQMVMDYHCPFFKRKLFFYPMKEKIVDSSSYISRV----FYQFIKQETPYDETLILKNLI 274

Query: 102 -ESPAMGKVMQIAIK-----------AKIAIVV-HLYYIDLWIEIANLLSNLSISFDLHV 148
             +P    V  + +             KIA+V+   +Y+    +I +    L    DL+ 
Sbjct: 275 RTAPMQDIVDGLGLNVIPDSECERIAEKIAVVIDEDFYLQHQPDIDD----LETHADLYY 330

Query: 149 TLVTESASIKSEILKIF-------PAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKI 201
               ES   K    ++          A ++        V  F           Y+Y+C +
Sbjct: 331 WGSEESFHQKKNWEEMHLLECTTGNFAEVYYA------VGAF--------AKEYEYICFL 376

Query: 202 -HGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNK 260
            +  +S            W   +   +LG    +  I+   + +  IG++          
Sbjct: 377 VNEDRSYIAENLDNGHTGW--IIENSILGKGVSLGNIVSCLNDNSGIGLVYPPNSSQSLY 434

Query: 261 YCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAG---TMFWVRTEALDPIKN 311
           Y             I  +     I     K+    G     FW R++ L  +  
Sbjct: 435 YSRQYKERELISCEIQQILEDSDIHLNIAKVRGSIGQYTGCFWCRSQVLQNLTE 488


>gi|328946538|gb|EGG40677.1| rhamnosyltransferase [Streptococcus sanguinis SK1087]
          Length = 556

 Score = 64.9 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 47/385 (12%), Positives = 109/385 (28%), Gaps = 59/385 (15%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSK--KLCYDE-NYV 60
           K +  F S  + +    D  +  +      F    F +   L  ++ +  +L + + +Y 
Sbjct: 150 KAFREFWSQIEDFADVQDVIDHYETKFTKRFVEAGFRYQALLDTRQEEAGELVHPDFSYY 209

Query: 61  VAYGSRSGKKFFAQS-----NLYMM---------ERELHFDGQRIHHFPQLLHG-----W 101
                   K  F +      N ++                   R H F            
Sbjct: 210 KPLRILEAKLPFLKVKALTGNPFLARYLLEDLETNSSYPILLIREHLFYHFGPDLPCLLE 269

Query: 102 ESPAMGKVMQIAIKAKIAIVVHLYYID--LWIEIANLLSNLSISFDLHVTL--VTESASI 157
           +            +  + + +H+   D  ++ +  + L +LS  +   VT         +
Sbjct: 270 DKYLSQSTSNYCTEQPVLLHIHV--TDFPIFQQYQDNLFSLSSQYQYLVTTGQPEVLKQL 327

Query: 158 KSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRK--GYSWWE 215
           ++ +  +    +I + +      L  L   + E L NY Y+  +    S  +        
Sbjct: 328 QTSLAHLGNKVQIVLSQ-KSHAWLAMLE--QKEILQNYAYIGHL----STHRLVENQAVF 380

Query: 216 GDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMI 275
               R  L   ++ +       I   + + D+G++     R        +      R  +
Sbjct: 381 DQAMRSDLINMMVDSADAS---IEALEKNSDLGLVIPDLPRLVRDGLFESEPP---RPRL 434

Query: 276 CTLAGRMGITFQDQKLDFF-----AGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEI 330
            ++    G+      +         G   W +  AL     ++          +  D   
Sbjct: 435 TSVWQDAGLHKSFNFMSTPSLTRVYGGFLWFKYSALASWFQMKSLESLPSSDQELSD--- 491

Query: 331 EHAVERCFSLSV--KKANFRISDVD 353
              +E            +F+I  + 
Sbjct: 492 --VLEHLLVYLAWDSHYDFKIMPLS 514


>gi|125718317|ref|YP_001035450.1| lipopolysaccharide biosynthesis protein [Streptococcus sanguinis
           SK36]
 gi|125498234|gb|ABN44900.1| Lipopolysaccharide biosynthesis protein, putative [Streptococcus
           sanguinis SK36]
          Length = 556

 Score = 63.4 bits (153), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 50/379 (13%), Positives = 108/379 (28%), Gaps = 55/379 (14%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTL-------------FYKRS 50
           K +  F S  + +    D  +  +      F    F +   L              +   
Sbjct: 150 KSFREFWSQVEDFTDVQDVIDHYETQFTKRFVEAGFRYQSLLDTRQEEAGELVHPDFSYY 209

Query: 51  KKLCYDENYVVAYGSR--SGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESP---A 105
           K L   E  +     +  +G  F A+  L  +E    +    I        G + P    
Sbjct: 210 KPLRILEAKIPFLKVKALTGNPFLARYLLEDLETNSSYPTSLIRQHLFYYFGPDLPCLLQ 269

Query: 106 MGKVMQIAIKAKIA--IVVHLYYID--LWIEIANLLSNLSISFDLHVTL--VTESASIKS 159
              + Q     +    +++H++  D  ++ +  + L +LS  +   +T         +++
Sbjct: 270 DKYLSQATSNYRTVQPVLLHIHVTDFPIFQQYQDKLFSLSSQYQYLLTTNQPEVLKQLQT 329

Query: 160 EILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRK--GYSWWEGD 217
            +  +    +I + +      L  L   + E L NY Y+  +    S  +          
Sbjct: 330 ALGHLGNKVQIILSQ-KSHAWLAMLE--QKEILQNYAYIGHL----STHRLVENQAVFDQ 382

Query: 218 LWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICT 277
             R  L   ++         I   +     G++     R      D    +   R  +  
Sbjct: 383 AMRSDLINMMV---DYADASIEALEQDSAEGLVIPDLPRLVR---DGLFEIEPPRPSLSA 436

Query: 278 LAGRMGITFQDQKLDF-----FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           +    G+      +         G   W +  AL  +  ++          +  D     
Sbjct: 437 VWQEAGLHKSFDFMTASSLTRVYGGFLWFKNSALASLFQMKSLESLPSSDQELSD----- 491

Query: 333 AVERCFSLSV--KKANFRI 349
            +E            +F+I
Sbjct: 492 VLEHLLVYLAWDSHYDFKI 510


>gi|325687210|gb|EGD29232.1| rhamnosyltransferase [Streptococcus sanguinis SK72]
          Length = 556

 Score = 62.6 bits (151), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 50/379 (13%), Positives = 108/379 (28%), Gaps = 55/379 (14%)

Query: 8   KGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTL-------------FYKRS 50
           K +  F S  + +    D  +  +      F    F +   L              +   
Sbjct: 150 KSFREFWSQVEDFTDVQDVIDHYETQFTKRFVEAGFRYQSLLDTRQEEAGELVHPDFSYY 209

Query: 51  KKLCYDENYVVAYGSR--SGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESP---A 105
           K L   E  +     +  +G  F A+  L  +E    +    I        G + P    
Sbjct: 210 KPLRILEAKIPFLKVKALTGNPFLARYLLEDLETNSSYPTSLIRQHLFYYFGPDLPCLLQ 269

Query: 106 MGKVMQIAIKAKIA--IVVHLYYID--LWIEIANLLSNLSISFDLHVTL--VTESASIKS 159
              + Q     +    +++H++  D  ++ +  + L +LS  +   +T         +++
Sbjct: 270 DKYLSQATSNYRTVQPVLLHIHVTDFPIFQQYQDKLFSLSSQYQYLLTTNQPEVLKQLQT 329

Query: 160 EILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRK--GYSWWEGD 217
            +  +    +I + +      L  L   + E L NY Y+  +    S  +          
Sbjct: 330 ALGHLGNKVQIILSQ-KSHAWLAMLE--QKEILQNYAYIGHL----STHRLVENQAVFDQ 382

Query: 218 LWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICT 277
             R  L   ++         I   +     G++     R      D    +   R  +  
Sbjct: 383 TMRSDLINMMV---DYADASIEALEQDSAEGLVIPDLPRLVR---DGLFEIEPPRPSLSA 436

Query: 278 LAGRMGITFQDQKLDF-----FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEH 332
           +    G+      +         G   W +  AL  +  ++          +  D     
Sbjct: 437 VWQEAGLHKSFDFMTASSLTRVYGGFLWFKNSALASLFQMKSLESLPSSDQELSD----- 491

Query: 333 AVERCFSLSV--KKANFRI 349
            +E            +F+I
Sbjct: 492 VLEHLLVYLAWDSHYDFKI 510


>gi|315221431|ref|ZP_07863352.1| rhamnan synthesis protein F [Streptococcus anginosus F0211]
 gi|315189550|gb|EFU23244.1| rhamnan synthesis protein F [Streptococcus anginosus F0211]
          Length = 555

 Score = 59.9 bits (144), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 54/390 (13%), Positives = 111/390 (28%), Gaps = 65/390 (16%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSK--KLCYDE-NY 59
           S+ +  F S  K +       N  +      F    F +       + +  +L + + +Y
Sbjct: 149 SEVFQKFWSQIKDFTDVQSVINQYETQFTAYFQKKGFNYQAFYDTCKEEVGELLHPDFSY 208

Query: 60  VVAYGSRSGKKFFAQS-----NLYMMER--------ELHFDGQRIHHFPQLLHGWESPAM 106
                    K  F +      N ++             +       H  +      SP  
Sbjct: 209 YKPQTILEKKVPFLKVKAIDGNPFLASSLLEIIKRESSYPISLIKMHMFEYF----SPDA 264

Query: 107 GKVMQ----------IAIKAKIAIVVHLYYIDLWIEIANLLS-NLSISFDLHVTLVTESA 155
             ++Q           +    I + +H+  + ++ +  N +         L  T   +  
Sbjct: 265 PYLLQGKILAQHNEVTSAHKDIVLHIHVTNLSIFEQWMNKIVVQFPQIEYLMTTSDIKIF 324

Query: 156 SIKSEILKIFP-AARIHIMENHGRDVLPFLILL-ETEQLSNYDYVCKIHGKKSKRKGYSW 213
              +  LK      +I + +    +  P L +  + E+L  Y Y+  +    S       
Sbjct: 325 EYLNSYLKDSSIKNQIRLTQ----EQHPLLAMFAQAERLKTYKYIGHL----STHTLIPE 376

Query: 214 WEG-DLW-RRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKN 271
             G D W R  LF  ++     +   I   +   ++G+I             Y   L   
Sbjct: 377 VAGLDQWMRDDLFNMMI---ENMNYSINALEHCSNLGLIIPDLPSVVRNGLFYQKPL--- 430

Query: 272 REMICTLAGRMGITFQDQKLDF-----FAGTMFWVRTEALDPIKNLRLSRYFEPKVHKAL 326
           +E +  L   +      +  D        G   W + EA++ +                 
Sbjct: 431 KEEMEKLWKLLSCRKSFKFTDAVTLTRVYGGWMWFKYEAVESLFKASFKT--FSSYSLQE 488

Query: 327 DGEIEHAVERCFSLSV--KKANFRISDVDC 354
              I   +E         K  +F+I  +  
Sbjct: 489 QSTI---LENLLVYVAWDKNYDFQIILLSQ 515


>gi|254431846|ref|ZP_05045549.1| hypothetical protein CPCC7001_1737 [Cyanobium sp. PCC 7001]
 gi|197626299|gb|EDY38858.1| hypothetical protein CPCC7001_1737 [Cyanobium sp. PCC 7001]
          Length = 205

 Score = 56.8 bits (136), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 58/194 (29%), Gaps = 15/194 (7%)

Query: 156 SIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWE 215
            + S +   +       + N+G D   F  L  +   S+     K+  KKS   G     
Sbjct: 13  DLLSSLYTGYRKHSWERVTNYGEDWSSFHHLFYSGAFSSRGATFKLQTKKSSNLGADG-- 70

Query: 216 GDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMI 275
           G  W       +  +      +I+            +   +            G N +++
Sbjct: 71  GMAWVDEALQPIASSYRATATVIKNLK---------AGTIKLAASKLCKRTGFGANPQLV 121

Query: 276 CTLAGRMGITFQDQK-LDFFAGTMFWVRTEALDPIKNL--RLSRYFEPKVHKALDGEI-E 331
                R+G+  Q  K   F  G+MF    + +    +    +             G    
Sbjct: 122 AEYIHRLGLNEQSAKRQSFCMGSMFAADNDLIQLFYSSLGDVDYRITSDGGSQFCGRYPG 181

Query: 332 HAVERCFSLSVKKA 345
           HA+ER F     +A
Sbjct: 182 HAIERAFFYYSYQA 195


>gi|238916219|ref|YP_002929736.1| polysaccharide biosynthesis protein [Eubacterium eligens ATCC
           27750]
 gi|238871579|gb|ACR71289.1| polysaccharide biosynthesis protein [Eubacterium eligens ATCC
           27750]
          Length = 621

 Score = 56.1 bits (134), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 37/336 (11%), Positives = 100/336 (29%), Gaps = 49/336 (14%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKK----LCYDEN 58
           +K ++ +       N YSD     ++     F    + +   +  + +        Y + 
Sbjct: 150 TKEFYQYWLDMPLINNYSDAIRFHELRFTNYFKQRGYTYSCLMDVEANDNVNPMYNYCQY 209

Query: 59  YVVAYGSRSGKK-FFAQSNLYMMERE---LHFDGQRIHHFPQLLHGWESPAMGKVMQIAI 114
             +       +   F +     +E +      +  ++  +      ++   + +      
Sbjct: 210 AYIQQELVLKRNFPFLKKRPIEIEYKDMQTQENWSKVLDYVDNNTAYDVDMIYEN----- 264

Query: 115 KAKIAIVVHLY-YIDLWIEI-ANLLSNLSISFDL-----HVTLVTESASIKSEILKIFPA 167
                 ++ LY + DL+ ++    +       ++      V +      I +EI +    
Sbjct: 265 ------LIRLYNHADLFEKLNLQYVLQTRGEKEISLKNAIVVICGNVKLISNEIDEYIQR 318

Query: 168 A--RIHIMENHGRDVLPFLILLETEQ------LSNYDYVCKIHGKKSKRKGYSWWEGDLW 219
               I ++         F+   +         +  Y+YVC I+                 
Sbjct: 319 IKDEIKVI---------FITESKEGCEELKNQIREYEYVCLINCDIILENNTFSCVNKSA 369

Query: 220 RRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLA 279
              +  +L+ +   +  ++  F  ++ IG +      + +          + R+ I  + 
Sbjct: 370 LYGVLENLIKSNSYISNVMGIFKRNKKIGALTIPELIHADFLGKAWKRWVQIRQKISYIL 429

Query: 280 --GRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLR 313
              ++   F   K+        WVR E L+      
Sbjct: 430 DSKQIHCIFSMDKMPIVNSDNLWVRRELLEQAIEYN 465


>gi|325067617|ref|ZP_08126290.1| hypothetical protein AoriK_07344 [Actinomyces oris K20]
          Length = 233

 Score = 54.5 bits (130), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 27/83 (32%), Gaps = 4/83 (4%)

Query: 231 PGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITF--QD 288
           PG V  +I  F  H  +G+    A      +     +          L+ R+G+T     
Sbjct: 1   PGYVAGLIDLFARHPGLGVAMPAAGHIGQAHG--GATWDGLAGAATALSRRLGLTVELDP 58

Query: 289 QKLDFFAGTMFWVRTEALDPIKN 311
                  G MF  R  AL  +  
Sbjct: 59  LAPVVPVGAMFLARPAALRTLSE 81


>gi|322510485|gb|ADX05799.1| putative N-acetyl glucosaminyl transferase [Organic Lake
           phycodnavirus 1]
          Length = 690

 Score = 49.1 bits (116), Expect = 0.001,   Method: Composition-based stats.
 Identities = 46/267 (17%), Positives = 89/267 (33%), Gaps = 59/267 (22%)

Query: 108 KVMQIAIKAKIAIVVHLYYIDLWIEIA-NLLSNLSISFDLHVTLVTESASIKSEILKIFP 166
           +  ++  K+  A  +H Y I  +  I  + + +LS  F + VT        K+E + +  
Sbjct: 302 EKSELYSKSLFA-HLHCYDISQFTTIYKDYIYDLSKYFHIIVTYTIGYLDKKNEYITLLK 360

Query: 167 AARIHIMENHGRDVLP--FLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLF 224
                 + N+G D+     ++    ++  +Y Y+  +H K                R ++
Sbjct: 361 ------IPNNGYDIGAKMMMVKYLKDKNIDYKYIYFMHSKSDVNL-----------RHIY 403

Query: 225 YDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCS----LGKNREMICTLAG 280
           +D L     V  I++  + +   G   +  Y+  N+Y     +       N      L  
Sbjct: 404 FDTLY--DHVDDIVKYIEDYD--GYFPNLLYKLYNQYNIKQSNKIKQPDYNYVYTNELKH 459

Query: 281 RMGITFQDQKLDFFAGTMFWVRTEALDPIKN-------LRLSRYFE----------PKVH 323
            + +    Q   F  G ++ +R    + I         L  S   +          P   
Sbjct: 460 YLNVK-DTQFNTFVEGNVYILRRNICETIFGDERLYRLLNESDENDYVHLQNIYRKPLEE 518

Query: 324 KA------------LDGEIEHAVERCF 338
                          DG++EHA ER  
Sbjct: 519 IYHKLKYNYQTKMIHDGQLEHAFERVV 545


>gi|320547030|ref|ZP_08041329.1| polysaccharide biosynthesis protein [Streptococcus equinus ATCC
           9812]
 gi|320448315|gb|EFW89059.1| polysaccharide biosynthesis protein [Streptococcus equinus ATCC
           9812]
          Length = 566

 Score = 48.8 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 51/354 (14%), Positives = 105/354 (29%), Gaps = 65/354 (18%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCYDENYVVA 62
           S+ +  F S+ K +       +I +  L        F +  +L      +L     +   
Sbjct: 153 SQAFIDFWSNVKIYKNVQQVIDIYEAKLTEQLVEAGFHYASSLDLSNKPELGNVSIFRPD 212

Query: 63  YGSRSGKKFFAQSNLY-MMERELHF----DGQRIHHFPQLLHGWESPAMGKVMQIAIKAK 117
              ++G   F +   +   +    +      ++  +   L+    S  +       +  K
Sbjct: 213 LIIQNG-IPFIKIKSFSHADYLAPYVLKVVEEKSEYPSDLIVNHLSNILSPTTSFLLPYK 271

Query: 118 IA-------------IVVHLYY-----IDLWIEIANLLSNLSISFDLHVTLVT-ESASIK 158
                           V+HL++     +++         N+       +TLV+ ES  + 
Sbjct: 272 KLNQSDNNVLKQISKTVLHLHFSTRNGVEILTSFLKSRKNI-------ITLVSAESEKLL 324

Query: 159 SEILKIFPA--------ARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKG 210
            E+ + F          A I  +     D   FL         N      +    S    
Sbjct: 325 EEVKERFQQEDITSYAYAHITSVS----DWQKFLSDSFEVFDGNCIAYIHVSDFFSNHLV 380

Query: 211 YSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGK 270
            S+  G+     L   +  +   + K   TF     IG+       Y          L  
Sbjct: 381 DSYSLGE-----LLEMMFSSEDAIKK---TFLDDEKIGLAIPDMLSYERYK---DSQLPV 429

Query: 271 NREMICTL-AGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLR--LSRYFEPK 321
           N+E++         +     +  + A   +W+R + L  + N +  L+     K
Sbjct: 430 NKEILDKFNLSEAEMKNPMIEKSWAA---YWIRVDELQKLCNGKGTLALSDFEK 480


>gi|282600847|ref|ZP_05979893.2| conserved hypothetical protein [Subdoligranulum variabile DSM
           15176]
 gi|282571128|gb|EFB76663.1| conserved hypothetical protein [Subdoligranulum variabile DSM
           15176]
          Length = 475

 Score = 44.1 bits (103), Expect = 0.034,   Method: Composition-based stats.
 Identities = 16/136 (11%), Positives = 32/136 (23%), Gaps = 18/136 (13%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKK-LCYDENYVV 61
           S  ++ +    K    Y +     +    G F    + W   +     K           
Sbjct: 157 SPDFWEYWQTMKLPRSYEESVIRHETRFTGYFAERGYRWDSYVQTDDLKPVFINPIMACP 216

Query: 62  AYGSRSGKKFFAQSNLYMMERELHF---DGQRIHHFPQLLHGWESPAMGKVMQIAI---- 114
                     F +   +           DG         L   +S     V  +      
Sbjct: 217 KELLEERCCPFFKRRSFFTPYLDELRRTDGNAAAELYAYL---QSKTSYPVEALVRSLLR 273

Query: 115 -KAKIAIV--VHLYYI 127
            +   A+   +H +Y+
Sbjct: 274 TQPLSALCQNLHWHYV 289


>gi|254788145|ref|YP_003075574.1| glycosyltransferase family 2 domain-containing protein
           [Teredinibacter turnerae T7901]
 gi|237685039|gb|ACR12303.1| glycosyltransferase family 2 domain protein [Teredinibacter
           turnerae T7901]
          Length = 307

 Score = 43.8 bits (102), Expect = 0.047,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 46/125 (36%), Gaps = 32/125 (25%)

Query: 134 ANLLSNLSISFDLHVTL----VTESASIKSEILKIFPAARIHIMENHG-RDVLP-----F 183
            + + N ++  DL V +      E+ +I ++  + +P  ++   EN G R V P     F
Sbjct: 20  LDSVCNQTVPPDLWVVVDDGSTDETPAILADYSERYPFIQVITRENRGHRSVGPGVIEAF 79

Query: 184 LILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDT 243
               +   +S +DYVCK              + DL            P     +I   + 
Sbjct: 80  YYGYDKIDVSQFDYVCKF-----------DLDLDL-----------PPRYFEILIDRMEK 117

Query: 244 HRDIG 248
           +  +G
Sbjct: 118 NPRLG 122


>gi|302024024|ref|ZP_07249235.1| polysaccharide biosynthesis protein [Streptococcus suis 05HAS68]
          Length = 587

 Score = 43.0 bits (100), Expect = 0.077,   Method: Composition-based stats.
 Identities = 34/226 (15%), Positives = 77/226 (34%), Gaps = 17/226 (7%)

Query: 106 MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT-ESASIKSEILKI 164
                 +     + + VH+  + ++ E    L  +S    L +TL   + ++  S + + 
Sbjct: 286 SQTTETVRSSTSVLLHVHIESVSIFEEYIEELCKISDRCQLLITLPETDFSNKCSIVERY 345

Query: 165 FPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLF 224
               ++        D L F  ++    + +  Y+  +  K++K   YS  +    R  L 
Sbjct: 346 LSTYKLRAQIAKLTDELHFFEIVNN-YMGDAKYLAHVTVKQTKEIKYSVEDIID-RHQLR 403

Query: 225 YDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMG- 283
                +      +I  F++  ++ ++        N+  D       N E+I  L      
Sbjct: 404 KMFFTS---FDAVISNFESQSNLAVVIPD--LTTNQRYDRQSLREGNPELIRQLNILYES 458

Query: 284 ----ITFQDQKLDFFAG---TMFWVRTEALDPIKNLRLSRYFEPKV 322
                     K+ +  G   + +W++TE    I+  +       K 
Sbjct: 459 LVRTKKVDFYKVPYIIGEEVSWYWIKTEDYKKIEE-KFRNIDFSKE 503


>gi|223933250|ref|ZP_03625240.1| Rhamnan synthesis F [Streptococcus suis 89/1591]
 gi|330832517|ref|YP_004401342.1| Rhamnan synthesis F [Streptococcus suis ST3]
 gi|223898064|gb|EEF64435.1| Rhamnan synthesis F [Streptococcus suis 89/1591]
 gi|329306740|gb|AEB81156.1| Rhamnan synthesis F [Streptococcus suis ST3]
          Length = 574

 Score = 42.6 bits (99), Expect = 0.086,   Method: Composition-based stats.
 Identities = 34/226 (15%), Positives = 77/226 (34%), Gaps = 17/226 (7%)

Query: 106 MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT-ESASIKSEILKI 164
                 +     + + VH+  + ++ E    L  +S    L +TL   + ++  S + + 
Sbjct: 273 SQTTETVRSSTSVLLHVHIESVSIFEEYIEELCKISDRCQLLITLPETDFSNKCSIVERY 332

Query: 165 FPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLF 224
               ++        D L F  ++    + +  Y+  +  K++K   YS  +    R  L 
Sbjct: 333 LSTYKLRAQIAKLTDELHFFEIVNN-YMGDAKYLAHVTVKQTKEIKYSVEDIID-RHQLR 390

Query: 225 YDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMG- 283
                +      +I  F++  ++ ++        N+  D       N E+I  L      
Sbjct: 391 KMFFTS---FDAVISNFESQSNLAVVIPD--LTTNQRYDRQSLREGNPELIRQLNILYES 445

Query: 284 ----ITFQDQKLDFFAG---TMFWVRTEALDPIKNLRLSRYFEPKV 322
                     K+ +  G   + +W++TE    I+  +       K 
Sbjct: 446 LVRTKKVDFYKVPYIIGEEVSWYWIKTEDYKKIEE-KFRNIDFSKE 490


>gi|310831259|ref|YP_003969902.1| hypothetical protein crov270 [Cafeteria roenbergensis virus BV-PW1]
 gi|309386443|gb|ADO67303.1| hypothetical protein crov270 [Cafeteria roenbergensis virus BV-PW1]
          Length = 781

 Score = 41.8 bits (97), Expect = 0.15,   Method: Composition-based stats.
 Identities = 31/181 (17%), Positives = 56/181 (30%), Gaps = 35/181 (19%)

Query: 167 AARIHIMENHGRDVLPFLILLETEQLS-NYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFY 225
              ++ + N G D++P L +        N+ YV KIH K            +     L  
Sbjct: 319 NYILYELNNIGNDLIPSLKIFNDNYSKFNFKYVLKIHTK-----------HNQIFNELTD 367

Query: 226 DLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGIT 285
             L        +I   + +  I  I    Y Y  +   Y      N+++   +       
Sbjct: 368 FFLINYD---NLINVMEDNHQIDFITKHKYCYNIEKDCY------NKKITNKI------- 411

Query: 286 FQDQKLDFFAGTMFWVRTEALDP-------IKNLRLSRYFEPKVHKALDGEIEHAVERCF 338
             ++ L F A + F  + +           +    L   F       ++    H +ER  
Sbjct: 412 IINKNLFFCAISFFIGKKDIFIKNLNKVAFLFKPSLLNCFYYDNIMFINNSPVHTIERVI 471

Query: 339 S 339
           S
Sbjct: 472 S 472


>gi|146318939|ref|YP_001198651.1| polysaccharide biosynthesis protein [Streptococcus suis 05ZYH33]
 gi|145689745|gb|ABP90251.1| polysaccharide biosynthesis protein [Streptococcus suis 05ZYH33]
 gi|319758378|gb|ADV70320.1| polysaccharide biosynthesis protein [Streptococcus suis JS14]
          Length = 587

 Score = 41.8 bits (97), Expect = 0.15,   Method: Composition-based stats.
 Identities = 34/230 (14%), Positives = 77/230 (33%), Gaps = 25/230 (10%)

Query: 106 MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTES-----ASIKSE 160
                 +     + + VH+  + ++ E    L  ++    L +TL         + ++  
Sbjct: 286 SQTTETVRSSTSVLLHVHIESVSIFEEYIEELCKIADRCQLLITLPEADFSNKCSIVERC 345

Query: 161 ILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWR 220
           +      A+I  +     D L F  ++    + +  Y+  +  K++K   YS  +    R
Sbjct: 346 LFTYQLRAQIAKLT----DELHFFEIVNN-YMGDAKYLAHVTVKQTKEIKYSVEDIID-R 399

Query: 221 RWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAG 280
             L      +      +I  F++  ++ ++        N+  D       N E+I  L  
Sbjct: 400 HQLRKMFFTS---FDAVISNFESQSNLAVVIPD--LTTNQRYDRQSLREGNPELIRQLNI 454

Query: 281 RMG-----ITFQDQKLDFFAG---TMFWVRTEALDPIKNLRLSRYFEPKV 322
                         K+ +  G   + +W++TE    I+  +       K 
Sbjct: 455 LYESLVRTKKVDFYKVPYIIGEEVSWYWIKTEHYKKIEE-KFRNIDFSKE 503


>gi|312278781|gb|ADQ63438.1| Rhamnosyltransferase [Streptococcus thermophilus ND03]
          Length = 547

 Score = 41.8 bits (97), Expect = 0.18,   Method: Composition-based stats.
 Identities = 53/336 (15%), Positives = 109/336 (32%), Gaps = 53/336 (15%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWG-----GFFFWFWTLFYKRSKK-LCYDENYV 60
           S+ +  F +  K++    D  +  +  +       GF +             L + +   
Sbjct: 148 SETFQQFWTSIKTFTDVQDVIDNYETKVTSVLTEAGFRYDAVFNTVSEETGDLIHPDFSY 207

Query: 61  VAYGSRSGKK-FFAQSNLY---------MMERELHFDGQRIHHFPQLLHGWESP-AMGKV 109
               S    K  F +   +         +++         +      L+ + SP ++  +
Sbjct: 208 YRPISTLEHKVPFIKLKAFTDNEKKGRLLLDYITKLSAYPLALIKSHLNSYHSPDSLVIL 267

Query: 110 MQIAIKAKI----------AIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT--ESASI 157
            +  I+             AI VH+   DL  E   + S+  +S   + TL +  +   +
Sbjct: 268 DEKIIEPSFHSVSGKGYHSAIHVHI--SDL--ERLKVFSDKKLSAFYYFTLSSHLDKNIV 323

Query: 158 KSEILKIFPAARIHIM----ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSW 213
           ++ +L  F   R  ++    +NH       + L      S YD+V   H    +  G   
Sbjct: 324 ENTLLNSFDKDRFQLVSQKFDNH---YYALVSLASQ--FSEYDFVGHFHT---EDFGNEG 375

Query: 214 WEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNRE 273
              D   R    ++L     V  I   F    ++G++ +   +              N+ 
Sbjct: 376 KFVDEATRLALVNMLLDEERVASIFDHF---PEVGLVFADLSKELYWTDAIGT---LNQN 429

Query: 274 MICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPI 309
               L      T ++    F  G+M W+  + L+ I
Sbjct: 430 QAAKLDNECQKTIKNSLHVF-QGSM-WLSKDFLEKI 463


>gi|253752012|ref|YP_003025153.1| rhamnan synthesis protein F family protein [Streptococcus suis
           SC84]
 gi|253753837|ref|YP_003026978.1| rhamnan synthesis protein F family protein [Streptococcus suis
           P1/7]
 gi|251816301|emb|CAZ51929.1| rhamnan synthesis protein F family protein [Streptococcus suis
           SC84]
 gi|251820083|emb|CAR46353.1| rhamnan synthesis protein F family protein [Streptococcus suis
           P1/7]
          Length = 574

 Score = 41.8 bits (97), Expect = 0.18,   Method: Composition-based stats.
 Identities = 34/230 (14%), Positives = 77/230 (33%), Gaps = 25/230 (10%)

Query: 106 MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTES-----ASIKSE 160
                 +     + + VH+  + ++ E    L  ++    L +TL         + ++  
Sbjct: 273 SQTTETVRSSTSVLLHVHIESVSIFEEYIEELCKIADRCQLLITLPEADFSNKCSIVERC 332

Query: 161 ILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWR 220
           +      A+I  +     D L F  ++    + +  Y+  +  K++K   YS  +    R
Sbjct: 333 LFTYQLRAQIAKLT----DELHFFEIVNN-YMGDAKYLAHVTVKQTKEIKYSVEDIID-R 386

Query: 221 RWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAG 280
             L      +      +I  F++  ++ ++        N+  D       N E+I  L  
Sbjct: 387 HQLRKMFFTS---FDAVISNFESQSNLAVVIPD--LTTNQRYDRQSLREGNPELIRQLNI 441

Query: 281 RMG-----ITFQDQKLDFFAG---TMFWVRTEALDPIKNLRLSRYFEPKV 322
                         K+ +  G   + +W++TE    I+  +       K 
Sbjct: 442 LYESLVRTKKVDFYKVPYIIGEEVSWYWIKTEHYKKIEE-KFRNIDFSKE 490


>gi|307710507|ref|ZP_07646944.1| glycosyl transferase family 2 family protein [Streptococcus mitis
           SK564]
 gi|307618770|gb|EFN97909.1| glycosyl transferase family 2 family protein [Streptococcus mitis
           SK564]
          Length = 300

 Score = 40.7 bits (94), Expect = 0.33,   Method: Composition-based stats.
 Identities = 33/215 (15%), Positives = 64/215 (29%), Gaps = 33/215 (15%)

Query: 117 KIAIVVHLY--YIDLWIEIANLLSN--LSISFDLHVTLVTESASIKSEILKIFPAARIHI 172
           K+ IV+  Y  Y D   E    L +   S  +D+ +           E+ +     +I  
Sbjct: 3   KVCIVILNYNNYEDTI-ECVQSLRSTINSNEYDIVIVDNNSVNDSVKELSRALSPIKIIT 61

Query: 173 -MENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAP 231
            +EN G      +  ++  + + YDY+C                       L  D L   
Sbjct: 62  SLENRGYANGNNI-GIKYAEDNGYDYIC----------------------ILNNDTLIEV 98

Query: 232 GVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLG--KNREM--ICTLAGRMGITFQ 287
             +    R  + +  +  +      Y N     +       NR +  +     +      
Sbjct: 99  DFLESCKRELEDNSSVAFVSPVLVEYKNNNLVQSTGGDIFINRGIVTLKNHGAQRDKLSS 158

Query: 288 DQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKV 322
             + D+  G     +T  L  I  +  S +   + 
Sbjct: 159 KIESDYIGGACLMFKTSILKVIGYIPESYFLFYEE 193


>gi|253755287|ref|YP_003028427.1| rhamnan synthesis protein F family protein [Streptococcus suis
           BM407]
 gi|251817751|emb|CAZ55503.1| rhamnan synthesis protein F family protein [Streptococcus suis
           BM407]
          Length = 574

 Score = 40.7 bits (94), Expect = 0.37,   Method: Composition-based stats.
 Identities = 37/230 (16%), Positives = 78/230 (33%), Gaps = 25/230 (10%)

Query: 106 MGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT----ESASIKSEI 161
                 +     + + +H+  + ++ E    L  +S    L +TL       + SI    
Sbjct: 273 SQTTETVRSSTSVLLHIHIESVSIFEEYIEELCKISDRCQLLITLPETDFSNNFSIVERY 332

Query: 162 LKIFP-AARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWR 220
           L  +   A+I  +     D L F  ++    + +  Y+  I  K++ +  YS  +    R
Sbjct: 333 LSTYKLRAQIVKLT----DELHFFEIVNN-YMGDAKYLAHITVKQTNKTKYSVEDIID-R 386

Query: 221 RWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAG 280
             L      +      +I  F++  ++ ++        N+  D       N E+I  L  
Sbjct: 387 YQLRKMFFTS---FDAVISNFESQSNLAVVIPD--LTTNQRYDRKSLREGNPELIRQLNI 441

Query: 281 RMG-----ITFQDQKLDFFAG---TMFWVRTEALDPIKNLRLSRYFEPKV 322
                         K+ +  G   + +W++TE    I+  +       K 
Sbjct: 442 LYESLVRTKKVDFYKVPYIIGEEVSWYWIKTEHYKKIEE-KFRNIDFSKE 490


>gi|159186241|ref|NP_356054.2| hypothetical protein Atu4606 [Agrobacterium tumefaciens str. C58]
 gi|159141375|gb|AAK88839.2| hypothetical protein Atu4606 [Agrobacterium tumefaciens str. C58]
          Length = 536

 Score = 40.3 bits (93), Expect = 0.54,   Method: Composition-based stats.
 Identities = 14/123 (11%), Positives = 38/123 (30%), Gaps = 14/123 (11%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCYDENYVVA 62
           +K +  + +       Y+D  N+ +++    F    + +      ++   +    N+++ 
Sbjct: 149 TKDFENYWNQLPKIETYADSVNLHELSQTPYFAARGYTFASWASTEKYANVS-PANFIIT 207

Query: 63  YGSRS---GKKFFAQSNLYMMERELHFDG---QRIHHFPQLLH---GWESPAMGKVMQIA 113
              R        F +             G   Q+I H    +     ++   + + M   
Sbjct: 208 CADRLLVEDGCPFIKRRALFFSNGRFEPGSGIQKIEHITNFIKSRTDYDVSMILENMSRT 267

Query: 114 IKA 116
            K 
Sbjct: 268 QKP 270


>gi|228477260|ref|ZP_04061898.1| rhamnosyltransferase [Streptococcus salivarius SK126]
 gi|228251279|gb|EEK10450.1| rhamnosyltransferase [Streptococcus salivarius SK126]
          Length = 547

 Score = 39.9 bits (92), Expect = 0.58,   Method: Composition-based stats.
 Identities = 43/280 (15%), Positives = 94/280 (33%), Gaps = 48/280 (17%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWG-------GFFFWFWTLFYKRSKKLCYDENY 59
           S+ +  F +  K++    D  +  +  +          +   F T+  +    +  D +Y
Sbjct: 148 SESFQKFWTSIKTFTDVQDVIDNYETRVTSVLTEAGYRYGAVFNTIDAEAGDLIHPDFSY 207

Query: 60  VVAYGSRSGKKFFAQSNLY---------MMERELHFDGQRIHHFPQLLHGWESPAMGKVM 110
                +   K  F +   +         +++   +     +      L+ + SP    + 
Sbjct: 208 YRPISTLEHKVPFIKLKAFTDNEKKGRLLLDYLANLSTYPVALIKSHLNRYHSPDSLVIS 267

Query: 111 QIAI-----------KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT--ESASI 157
              I           + ++ I VH+   DL  E   +  +  +S   + TL +  +   +
Sbjct: 268 DEKIIGPSFITLSKHEYRMVIHVHI--SDL--ERLKVFFDSKLSAFYYFTLSSHLDKNKV 323

Query: 158 KSEILKIFPAARIHIM----ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSW 213
           ++ +L  F   R  ++    ENH   +     +     LS YD+V   H    +  G   
Sbjct: 324 ENTLLNSFDKDRFQLVSKTFENHYHAL-----VFLASHLSEYDFVGHFHT---EAFGNEG 375

Query: 214 WEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSR 253
              D   R    ++L     V  I   F    ++G++ + 
Sbjct: 376 KLVDEDTRHALVNMLSDEEKVVSIFDHF---PEVGLVFAD 412


>gi|310831260|ref|YP_003969903.1| hypothetical protein crov271 [Cafeteria roenbergensis virus BV-PW1]
 gi|309386444|gb|ADO67304.1| hypothetical protein crov271 [Cafeteria roenbergensis virus BV-PW1]
          Length = 821

 Score = 39.9 bits (92), Expect = 0.59,   Method: Composition-based stats.
 Identities = 28/195 (14%), Positives = 57/195 (29%), Gaps = 38/195 (19%)

Query: 166 PAARIHIMENHGRDVLPFLILLE-TEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLF 224
               +     +G D++P +I         N++Y+ K+  K              WR  L 
Sbjct: 213 NKYFVIETNEYGNDIIPTIIGFNFANTFLNFNYILKLQTK----------SDIKWRNPLI 262

Query: 225 YDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGI 284
              L                  I ++ ++ +    K+     S   N+  +  L      
Sbjct: 263 NFFLNK-----------SKTDLINLLDNQEFICHPKFISKITSTLINKLFLQNL------ 305

Query: 285 TFQDQKLDFFAGTMFWVRTEALDPIKN-LRLSR-------YFEPKVHKALDGEIEHAVER 336
                   F AG++++ +    D +   +  S              +        H +ER
Sbjct: 306 --NWNDKSFPAGSIYFCKKHKFDNMIKFINYSSPHKYFIQTMYDTHYVLRGNSSVHFLER 363

Query: 337 CFSLSVKKANFRISD 351
              +++ K  F  S 
Sbjct: 364 LVGINLDKHIFTTSS 378


>gi|270293364|ref|ZP_06199573.1| conserved hypothetical protein [Streptococcus sp. M143]
 gi|270278213|gb|EFA24061.1| conserved hypothetical protein [Streptococcus sp. M143]
          Length = 300

 Score = 39.9 bits (92), Expect = 0.64,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 67/216 (31%), Gaps = 35/216 (16%)

Query: 117 KIAIVVHLY--YIDLWIEIANLLSNL--SISFDLHVTLVTESASIKSEILKIFPAARIHI 172
           K+ IV+  Y  Y D   E    L +   S  +D+ +           E+ +     +I  
Sbjct: 3   KVCIVILNYNNYEDTI-ECVQSLRSTIKSNEYDIVIVDNNSVNDSVKELSRALSPIKIIT 61

Query: 173 -MENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAP 231
            +EN G      +  ++  + + YDY+C                       L  D L   
Sbjct: 62  SLENRGYANGNNI-GIKYAEDNGYDYIC----------------------ILNNDTLIEV 98

Query: 232 GVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLG--KNREMI---CTLAGRMGITF 286
             +    R  + +  +  +      Y N     +       NR ++      A R  +  
Sbjct: 99  DFLESCKRELEDNSSVAFVSPVLVEYKNNNLVQSTGGDIFINRGIVTLKNHGAQRDKLPS 158

Query: 287 QDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKV 322
           + +  D+  G     +T  L  I  +  S +   + 
Sbjct: 159 KIES-DYIGGACLMFKTSILKIIGYIPESYFLFYEE 193


>gi|257125628|ref|YP_003163742.1| 1-deoxy-D-xylulose-5-phosphate synthase [Leptotrichia buccalis
           C-1013-b]
 gi|257049567|gb|ACV38751.1| 1-deoxy-D-xylulose-5-phosphate synthase [Leptotrichia buccalis
           C-1013-b]
          Length = 582

 Score = 39.5 bits (91), Expect = 0.75,   Method: Composition-based stats.
 Identities = 15/115 (13%), Positives = 39/115 (33%), Gaps = 13/115 (11%)

Query: 152 TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGY 211
             +   ++   K      +++  + G D+   + + E  +  N+  V  +H +K K   Y
Sbjct: 193 ESNGQAQNNYFKSLGLDYVYV--DKGNDLDALIEVFEKVKDINHPIVVHVHTQKGKGLPY 250

Query: 212 SWWEGDLWRRWL-FYDLLG----------APGVVFKIIRTFDTHRDIGMIGSRAY 255
           +  + + W   + F    G          +      ++   +    I ++ S   
Sbjct: 251 AEKDKETWHYGMPFDPKTGESKVNYSGGLSNDTAEFLMDKMEKDPTIAVVTSGTP 305


>gi|297569722|ref|YP_003691066.1| glycosyl transferase family 2 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925637|gb|ADH86447.1| glycosyl transferase family 2 [Desulfurivibrio alkaliphilus AHT2]
          Length = 318

 Score = 39.1 bits (90), Expect = 0.99,   Method: Composition-based stats.
 Identities = 27/166 (16%), Positives = 50/166 (30%), Gaps = 34/166 (20%)

Query: 128 DLWIEIANLLSNLSISFDLHVTLVTESAS----IKSEILKIFPAARIHIMENHG-RDVLP 182
           D      + +   ++  DL V +   S      I +E    +   +I    N G R V P
Sbjct: 17  DYMRHTLDSMVAQTVRPDLWVIVDDGSTDQTPQILAEYAAKYDFIKIVPKANRGHRSVGP 76

Query: 183 -----FLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKI 237
                F       +  +++Y+CK                      L  DL   P     +
Sbjct: 77  GVIEAFYAGYRAVRPDDFEYICK----------------------LDLDLELPPRYFEIL 114

Query: 238 IRTFDTHRDIGMIGSRAYRYPNKYCDYTC--SLGKNREMICTLAGR 281
           ++  + +  IG    + Y   N+           +N   +  L  +
Sbjct: 115 LKRLEENPRIGTCSGKPYFLDNESGKLISEKCGDENSVGMTKLFRK 160


>gi|153811516|ref|ZP_01964184.1| hypothetical protein RUMOBE_01908 [Ruminococcus obeum ATCC 29174]
 gi|149832257|gb|EDM87342.1| hypothetical protein RUMOBE_01908 [Ruminococcus obeum ATCC 29174]
          Length = 589

 Score = 39.1 bits (90), Expect = 1.0,   Method: Composition-based stats.
 Identities = 11/46 (23%), Positives = 21/46 (45%), Gaps = 1/46 (2%)

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLW 219
           EN G D+   + L    + +++  V  IH +K K    +  + + W
Sbjct: 219 EN-GNDIASLISLFRKVKDTDHPIVVHIHTQKGKGYEIAEKDKEGW 263


>gi|153814764|ref|ZP_01967432.1| hypothetical protein RUMTOR_00979 [Ruminococcus torques ATCC 27756]
 gi|145847795|gb|EDK24713.1| hypothetical protein RUMTOR_00979 [Ruminococcus torques ATCC 27756]
          Length = 589

 Score = 39.1 bits (90), Expect = 1.0,   Method: Composition-based stats.
 Identities = 11/46 (23%), Positives = 21/46 (45%), Gaps = 1/46 (2%)

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLW 219
           EN G D+   + L    + +++  V  IH +K K    +  + + W
Sbjct: 219 EN-GNDIASLISLFRKVKDTDHPIVVHIHTQKGKGYEIAEKDKEGW 263


>gi|328948788|ref|YP_004366125.1| 1-deoxy-D-xylulose-5-phosphate synthase [Treponema succinifaciens
           DSM 2489]
 gi|328449112|gb|AEB14828.1| 1-deoxy-D-xylulose-5-phosphate synthase [Treponema succinifaciens
           DSM 2489]
          Length = 589

 Score = 38.7 bits (89), Expect = 1.3,   Method: Composition-based stats.
 Identities = 12/46 (26%), Positives = 19/46 (41%), Gaps = 1/46 (2%)

Query: 174 ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLW 219
           EN G D+   + L E  +  ++  V  IH  K K    +    + W
Sbjct: 215 EN-GNDIGAMIALFEKVKDIDHPVVLHIHTLKGKGYAPAEKNKEAW 259


>gi|310779125|ref|YP_003967458.1| DNA polymerase III, alpha subunit [Ilyobacter polytropus DSM 2926]
 gi|309748448|gb|ADO83110.1| DNA polymerase III, alpha subunit [Ilyobacter polytropus DSM 2926]
          Length = 1442

 Score = 38.7 bits (89), Expect = 1.3,   Method: Composition-based stats.
 Identities = 27/183 (14%), Positives = 59/183 (32%), Gaps = 39/183 (21%)

Query: 20   WNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVAYGSRSGKKFFAQSNLYM 79
            W  YS       V          W +   R  K  + + + VAY + + +  + + +  +
Sbjct: 1244 WKDYSKLMKEHNVP--------DWYIESCRRIKYMFPKGHAVAYVTMAMRIAYFKVHHPL 1295

Query: 80   MERELH-------FDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIE 132
                 +       FD + +     +    +  +    + +  K+++A+           E
Sbjct: 1296 AFYAAYLSRKADDFDSEFMLSLNSVKEKIDELSKEMKLDVRQKSQLAV----------SE 1345

Query: 133  IANLLSNLSISF---DLH------VTLVTESASIKSEILKIFPAARIHIMEN--HGRDVL 181
            I   +      F   D++       T+  +   I    L     A   ++EN    R++ 
Sbjct: 1346 IILEMHARGFEFLGIDIYKSDGFKFTIEDDKIRIPLVALNGLGGA---VVENVIKEREIG 1402

Query: 182  PFL 184
             FL
Sbjct: 1403 KFL 1405


>gi|329923247|ref|ZP_08278732.1| MazG nucleotide pyrophosphohydrolase domain protein [Paenibacillus
           sp. HGF5]
 gi|328941482|gb|EGG37773.1| MazG nucleotide pyrophosphohydrolase domain protein [Paenibacillus
           sp. HGF5]
          Length = 107

 Score = 38.7 bits (89), Expect = 1.6,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 44/111 (39%), Gaps = 19/111 (17%)

Query: 62  AYGSR--SGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIA 119
            YG R  +G   F +    M E     +  R     ++    + P      +  +K    
Sbjct: 13  FYGERGWAGYGPFIRVGFLMEEAG---ETARAVRAYEIGR--DRPDEEVQSRERLKQ--- 64

Query: 120 IVVHLYYIDLWIEIANLLSNLSISFDLH-VTLVTESASIKSEILKIFPAAR 169
                   DL  EI ++L N+S+  DL+ ++L     + + ++LK F + R
Sbjct: 65  --------DLVEEIGDVLGNISLLADLYDISLEEAFTAHQQKLLKRFGSYR 107


>gi|312863645|ref|ZP_07723883.1| conserved hypothetical protein [Streptococcus vestibularis F0396]
 gi|311101181|gb|EFQ59386.1| conserved hypothetical protein [Streptococcus vestibularis F0396]
          Length = 262

 Score = 38.4 bits (88), Expect = 1.6,   Method: Composition-based stats.
 Identities = 39/197 (19%), Positives = 69/197 (35%), Gaps = 26/197 (13%)

Query: 119 AIVVHLYYIDLWIEIANLLSNLSISFDLHVTLV--TESASIKSEILKIFPAARIHIM--- 173
           AI VH+   DL  E   +  +  +S   + TL    +   +++ +L  F   R  I+   
Sbjct: 2   AIHVHI--SDL--ERLKVFFDSKLSAFYYFTLSGHLDKNQVENNLLNSFDKDRFQIVSQK 57

Query: 174 -ENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPG 232
            +NH       + L     LS YD++   H   +          +  R  L   LL    
Sbjct: 58  FDNH---YHALVSLASQ--LSEYDFIGHFHT--ADFGNEGKLVDEATRLALIDMLL-DEK 109

Query: 233 VVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLD 292
            V  I   F    ++G++ +   +              N+     L      T ++    
Sbjct: 110 KVSSIFADF---PEVGLVFADLSKELYWTDAIGT---LNQNQAAKLDNECQKTIKNSLHV 163

Query: 293 FFAGTMFWVRTEALDPI 309
           F  G+M W+  + L+ I
Sbjct: 164 F-QGSM-WLSKDFLEKI 178


>gi|303238571|ref|ZP_07325105.1| DNA polymerase III, alpha subunit [Acetivibrio cellulolyticus CD2]
 gi|302593969|gb|EFL63683.1| DNA polymerase III, alpha subunit [Acetivibrio cellulolyticus CD2]
          Length = 1446

 Score = 38.4 bits (88), Expect = 1.8,   Method: Composition-based stats.
 Identities = 8/69 (11%), Positives = 22/69 (31%), Gaps = 8/69 (11%)

Query: 18   KSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVAYGSRSGKKFFAQSNL 77
              W  Y       +V          W +   +  K  + + +  AY   + +  + + ++
Sbjct: 1240 PKWPDYEALMRKHEVP--------EWYIDSCKKIKYMFPKAHACAYIMMAFRIAWFKVHI 1291

Query: 78   YMMERELHF 86
             +     +F
Sbjct: 1292 PLAYYAAYF 1300


>gi|229112680|ref|ZP_04242216.1| Glycosytransferase [Bacillus cereus Rock1-15]
 gi|228670812|gb|EEL26120.1| Glycosytransferase [Bacillus cereus Rock1-15]
          Length = 355

 Score = 38.4 bits (88), Expect = 1.9,   Method: Composition-based stats.
 Identities = 11/66 (16%), Positives = 26/66 (39%), Gaps = 8/66 (12%)

Query: 115 KAKIAIVVH-----LYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAAR 169
           K K+ + +H     ++Y +   +I N +  +    D+ +TL  +       I        
Sbjct: 99  KKKVVLHIHGAEFMVFYQESSEDIRNQIREILNQVDVIITLSQKWKEDIESIT---NNRN 155

Query: 170 IHIMEN 175
           + ++ N
Sbjct: 156 VKVIYN 161


>gi|315644585|ref|ZP_07897717.1| MazG nucleotide pyrophosphohydrolase [Paenibacillus vortex V453]
 gi|315280092|gb|EFU43389.1| MazG nucleotide pyrophosphohydrolase [Paenibacillus vortex V453]
          Length = 105

 Score = 38.0 bits (87), Expect = 2.2,   Method: Composition-based stats.
 Identities = 25/107 (23%), Positives = 42/107 (39%), Gaps = 19/107 (17%)

Query: 62  AYGSR--SGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIA 119
            YG R  SG   F +    M E     +  R     ++    + P      +  +K    
Sbjct: 13  FYGERGWSGYGPFIRVGFLMEETG---ETARAVRAYEIGR--DRPDEEAQSRERLKQ--- 64

Query: 120 IVVHLYYIDLWIEIANLLSNLSISFDLH-VTLVTESASIKSEILKIF 165
                   DL  EI ++L N+S+  DL+ +TL     + + ++LK F
Sbjct: 65  --------DLVEEIGDVLGNISLLADLYDITLEEAFTAHQHKLLKRF 103


>gi|261364085|ref|ZP_05976968.1| pantetheine-phosphate adenylyltransferase [Neisseria mucosa ATCC
           25996]
 gi|288568133|gb|EFC89693.1| pantetheine-phosphate adenylyltransferase [Neisseria mucosa ATCC
           25996]
          Length = 168

 Score = 38.0 bits (87), Expect = 2.7,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 29/74 (39%), Gaps = 7/74 (9%)

Query: 129 LWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENH-----GRDVLPF 183
           L+ E+   +       + +   + E   +   I + FP  RI + EN       R++   
Sbjct: 32  LFDELVVAIGINPEKHNTY--TIDERRDMLEAITEGFPNVRISVFENRFLVRYAREIGAG 89

Query: 184 LILLETEQLSNYDY 197
            I+      ++Y+Y
Sbjct: 90  FIVRGIRSAADYEY 103


>gi|322502575|emb|CBZ37658.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 803

 Score = 37.6 bits (86), Expect = 2.9,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 24/65 (36%), Gaps = 14/65 (21%)

Query: 125 YYIDLWIEIANLLSNLSISFDLHVT--------LVTESASIKSEILKIFPAARI------ 170
           YYIDL   I   L +  +  DL  T        L  E   ++ + LK      +      
Sbjct: 381 YYIDLLQFIGRPLQSAPVPGDLLFTPDNGCYGRLPEEDIQLELDFLKRLHENDVEVRSMA 440

Query: 171 HIMEN 175
            ++EN
Sbjct: 441 RVVEN 445


>gi|146099084|ref|XP_001468551.1| ATP-dependent RNA helicase [Leishmania infantum]
 gi|134072919|emb|CAM71636.1| putative ATP-dependent RNA helicase [Leishmania infantum JPCM5]
          Length = 803

 Score = 37.6 bits (86), Expect = 2.9,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 24/65 (36%), Gaps = 14/65 (21%)

Query: 125 YYIDLWIEIANLLSNLSISFDLHVT--------LVTESASIKSEILKIFPAARI------ 170
           YYIDL   I   L +  +  DL  T        L  E   ++ + LK      +      
Sbjct: 381 YYIDLLQFIGRPLQSAPVPGDLLFTPDNGCYGRLPEEDIQLELDFLKRLHENDVEVRSMA 440

Query: 171 HIMEN 175
            ++EN
Sbjct: 441 RVVEN 445


>gi|261868360|ref|YP_003256282.1| hypothetical protein D11S_1700 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413692|gb|ACX83063.1| hypothetical protein D11S_1700 [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 318

 Score = 37.6 bits (86), Expect = 3.5,   Method: Composition-based stats.
 Identities = 12/107 (11%), Positives = 28/107 (26%), Gaps = 14/107 (13%)

Query: 225 YDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGI 284
             +L +P  +  ++  F    ++  +  +   + N       +   N      L  +  I
Sbjct: 92  DAILASPDSLANLLAPFA-DPEVATVYGKQLPHANSTPVAAHARYFNYPAQSKLKSKEDI 150

Query: 285 TFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
                K  F + +    R                  ++    D  I 
Sbjct: 151 PSLGIKTAFMSNSFAAYRRSV-------------FEELGGFPDNTIL 184


>gi|94310676|ref|YP_583886.1| glycosyl transferase family protein [Cupriavidus metallidurans
           CH34]
 gi|93354528|gb|ABF08617.1| Cellulose synthase (UDP-forming), putative glycosyl transferase
           [Cupriavidus metallidurans CH34]
          Length = 658

 Score = 37.6 bits (86), Expect = 3.5,   Method: Composition-based stats.
 Identities = 32/182 (17%), Positives = 58/182 (31%), Gaps = 22/182 (12%)

Query: 143 SFDLHVTLVTE-----SASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNY-- 195
             D+ +    E       +I + +   +P  R+ ++++  RD   +L     +  + Y  
Sbjct: 117 PVDIFIATYNEGLDVLEKTIVAALDIDYPNFRVWVLDDTRRD---WLREFCDQVGARYVT 173

Query: 196 --DYVCKIHGKKSKRKGYSWWE-----GDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIG 248
             D     H K                G  +   L  D      ++ +I+  F     +G
Sbjct: 174 RPDNA---HAKAGNLNNGLRHSAELDGGAPFIMVLDADFAPNRNILLRIVGLF-DDPQVG 229

Query: 249 MI-GSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALD 307
           ++   + Y   +       S     +        M  +       F  GT F VR EALD
Sbjct: 230 VVQTPQFYYNADPIQYNLRSTECWVDEQRAFFDVMQPSKDAWGTAFCIGTSFVVRREALD 289

Query: 308 PI 309
            I
Sbjct: 290 RI 291


>gi|260889525|ref|ZP_05900788.1| 1-deoxy-D-xylulose 5-phosphate synthase [Leptotrichia hofstadii
           F0254]
 gi|260860936|gb|EEX75436.1| 1-deoxy-D-xylulose 5-phosphate synthase [Leptotrichia hofstadii
           F0254]
          Length = 592

 Score = 37.2 bits (85), Expect = 3.9,   Method: Composition-based stats.
 Identities = 12/68 (17%), Positives = 28/68 (41%), Gaps = 2/68 (2%)

Query: 152 TESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGY 211
             +   ++   K      I++  + G D+   + + E  +  N+  V  +H +K K   Y
Sbjct: 203 ESNGQAQNNYFKSLGLDYIYV--DKGNDLEALIEVFEKVKDINHPIVVHVHTQKGKGLPY 260

Query: 212 SWWEGDLW 219
           +  + + W
Sbjct: 261 AEKDKETW 268


>gi|163786650|ref|ZP_02181098.1| 5,10-methylenetetrahydrofolate reductase [Flavobacteriales
           bacterium ALC-1]
 gi|159878510|gb|EDP72566.1| 5,10-methylenetetrahydrofolate reductase [Flavobacteriales
           bacterium ALC-1]
          Length = 318

 Score = 37.2 bits (85), Expect = 4.1,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 37/86 (43%), Gaps = 5/86 (5%)

Query: 54  CYDENYVVAYGSRSGKKFF---AQSNLYMMERELHFDGQRIHHFPQLLH--GWESPAMGK 108
            Y E ++ A    S   F     +S    +  ++ FD Q+  +F       G   P +  
Sbjct: 179 AYPEKHMEAPSLESDIHFLKKKIKSGATYIVTQMFFDNQKYFNFVDKCRKEGITVPIIPG 238

Query: 109 VMQIAIKAKIAIVVHLYYIDLWIEIA 134
           +  I+ K ++ ++ H +++DL  E+ 
Sbjct: 239 LKPISTKKQLNLIPHRFHVDLPEELI 264


>gi|3132264|dbj|BAA28141.1| glycosyltransferase [Actinobacillus actinomycetemcomitans]
          Length = 318

 Score = 37.2 bits (85), Expect = 4.5,   Method: Composition-based stats.
 Identities = 12/107 (11%), Positives = 28/107 (26%), Gaps = 14/107 (13%)

Query: 225 YDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGI 284
             +L +P  +  ++  F    ++  +  +   + N       +   N      L  +  I
Sbjct: 92  DAILRSPDSLANLLAPFA-DPEVATVYGKQLPHANSTPVAAHARYFNYPAQSKLKSKEDI 150

Query: 285 TFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
                K  F + +    R                  ++    D  I 
Sbjct: 151 PSLGIKTAFMSNSFAAYRRSV-------------FEELGGFPDNTIL 184


>gi|1944173|dbj|BAA19647.1| rhamnosyltransferase [Aggregatibacter actinomycetemcomitans]
          Length = 318

 Score = 37.2 bits (85), Expect = 4.5,   Method: Composition-based stats.
 Identities = 12/107 (11%), Positives = 28/107 (26%), Gaps = 14/107 (13%)

Query: 225 YDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGI 284
             +L +P  +  ++  F    ++  +  +   + N       +   N      L  +  I
Sbjct: 92  DAILASPDSLANLLAPFA-DPEVTTVYGKQLPHANSTPVAAHARYFNYPAQSKLKSKADI 150

Query: 285 TFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
                K  F + +    R                  ++    D  I 
Sbjct: 151 PSLGIKTAFMSNSFAAYRRSV-------------FEELGGFPDNTIL 184


>gi|291518896|emb|CBK74117.1| Domain of unknown function (DUF1975) [Butyrivibrio fibrisolvens
           16/4]
          Length = 320

 Score = 36.8 bits (84), Expect = 4.7,   Method: Composition-based stats.
 Identities = 9/70 (12%), Positives = 27/70 (38%), Gaps = 13/70 (18%)

Query: 115 KAKIAIVVHL-YYID--------LWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIF 165
            A++ +V+H  ++ +        LW        ++    D ++T   +  ++  E  + +
Sbjct: 232 DARVGVVIHADHFSEGATDDDNILWNNFYEYTFSMHRHIDFYITATDDQRNLLIEQFEKY 291

Query: 166 PAARIHIMEN 175
               + +  N
Sbjct: 292 ----VGVTPN 297


>gi|154483860|ref|ZP_02026308.1| hypothetical protein EUBVEN_01564 [Eubacterium ventriosum ATCC
           27560]
 gi|149735351|gb|EDM51237.1| hypothetical protein EUBVEN_01564 [Eubacterium ventriosum ATCC
           27560]
          Length = 459

 Score = 36.8 bits (84), Expect = 5.0,   Method: Composition-based stats.
 Identities = 12/93 (12%), Positives = 36/93 (38%), Gaps = 11/93 (11%)

Query: 235 FKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFF 294
             +   F+ H+DI ++ S  Y +  +  ++  +       +      + I        ++
Sbjct: 106 ETVWNFFENHKDIQLVTSEIYHFGARNDEHKSNWRFEEREV------VNIKEDFNYPQYY 159

Query: 295 AGTMFWVRTEALDPI-KNLRLSRYFEPKVHKAL 326
            G +F ++ +AL  +  ++ +      +   A+
Sbjct: 160 IGGVF-LKDKALRSLKFDVNM---DFWEDAMAI 188


>gi|313905641|ref|ZP_07839002.1| 1-deoxy-D-xylulose-5-phosphate synthase [Eubacterium cellulosolvens
           6]
 gi|313469465|gb|EFR64806.1| 1-deoxy-D-xylulose-5-phosphate synthase [Eubacterium cellulosolvens
           6]
          Length = 588

 Score = 36.8 bits (84), Expect = 5.2,   Method: Composition-based stats.
 Identities = 19/134 (14%), Positives = 42/134 (31%), Gaps = 17/134 (12%)

Query: 177 GRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLW----------RRWLFYD 226
           G D+   +  L   +  ++  V  +H +K K    +  + + W           + L+  
Sbjct: 219 GNDIPMLIHALREVKDVDHPIVLHVHTQKGKGYKPAEEDRESWHYAPPFDRESGKPLYSR 278

Query: 227 LLGAPG--VVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNR---EMICTLAGR 281
              +        +I      + I ++ +          +   ++G+N     +    A  
Sbjct: 279 TGESYASLFADHMIERIRRDKSIVVVTAAVPGAVGLIPEKRNAMGENYVDVGIAEEHATA 338

Query: 282 M--GITFQDQKLDF 293
           M  GI     K  F
Sbjct: 339 MCSGIAKNGGKPLF 352


>gi|168216438|ref|ZP_02642063.1| putative glycosyl transferase [Clostridium perfringens NCTC 8239]
 gi|182381532|gb|EDT79011.1| putative glycosyl transferase [Clostridium perfringens NCTC 8239]
          Length = 289

 Score = 36.4 bits (83), Expect = 6.5,   Method: Composition-based stats.
 Identities = 21/138 (15%), Positives = 45/138 (32%), Gaps = 27/138 (19%)

Query: 226 DLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKY--------CDYTCSLGKNREMICT 277
           D+L     +  +I   + +   GMI         +           Y   +  +  ++  
Sbjct: 92  DVLIEEKCIINLINELNKNSTFGMITGTMLNSNKEISKGLAWKLPKYKDDIITSFIVLNK 151

Query: 278 LAGRMGITFQD------QKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIE 331
           +   +    +        ++D   G+ F  + EAL  ++       F  +          
Sbjct: 152 IFKPLEYNNKKLLNNTLNEVDVIPGSFFIAKAEALKKVR-------FFDED------TFL 198

Query: 332 HAVERCFSLSVKKANFRI 349
           +  ER  S  +KK N++I
Sbjct: 199 YCEERILSYKMKKMNYKI 216


>gi|84488872|ref|YP_447104.1| glycosyltransferase [Methanosphaera stadtmanae DSM 3091]
 gi|84372191|gb|ABC56461.1| predicted glycosyltransferase [Methanosphaera stadtmanae DSM 3091]
          Length = 292

 Score = 36.4 bits (83), Expect = 6.8,   Method: Composition-based stats.
 Identities = 28/203 (13%), Positives = 66/203 (32%), Gaps = 24/203 (11%)

Query: 132 EIANLLSNLSIS-FDLHVTLVTESASIKSEILKIFPA----ARIHIMENHGRDVLPFLIL 186
           E    L +++   +D+++            IL         +   +++N          L
Sbjct: 2   ECLESLKHVNYDFYDIYLVDNDSKKESVDYILNYLENDSYYSHSLVLKN---------QL 52

Query: 187 LETEQLSNYDYVCKIHGKKSKRKGYSWWEGD--------LWRRWLFYDLLGAPGVVFKII 238
               +  + D +  I+ + S   G +    +         +   L  D + +P  +  +I
Sbjct: 53  YNYVKSDDVDILFIINDENSGFAGGNNVALNYILKTKLTDYVLLLNNDTIVSPDFIDGLI 112

Query: 239 RTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTM 298
             F+   D G +G + Y Y  +        G   +++   A  +         DF  G+ 
Sbjct: 113 SKFNESDDTGFVGIKHYYYHER-NKLQTVGGGIVDLVHGEAMAV-FDDTRDSFDFITGSC 170

Query: 299 FWVRTEALDPIKNLRLSRYFEPK 321
            +   + LD +  +    +   +
Sbjct: 171 IFTSVDVLDEVGTMNEDFFMYWE 193


>gi|320589952|gb|EFX02408.1| nacht and ankyrin domain containing protein [Grosmannia clavigera
           kw1407]
          Length = 939

 Score = 36.4 bits (83), Expect = 7.4,   Method: Composition-based stats.
 Identities = 8/56 (14%), Positives = 17/56 (30%)

Query: 128 DLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPF 183
           DL     +    L+  +   ++L          + +         + NHG D+   
Sbjct: 42  DLAKSFYDSFLVLTNDWQALISLSITKDEGYQALFQAMYGIVFFGVPNHGMDISSL 97


>gi|301067040|ref|YP_003789063.1| glycosyl transferase, family 2 [Lactobacillus casei str. Zhang]
 gi|300439447|gb|ADK19213.1| Glycosyl transferase, family 2 [Lactobacillus casei str. Zhang]
          Length = 313

 Score = 36.0 bits (82), Expect = 8.3,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 37/91 (40%), Gaps = 10/91 (10%)

Query: 117 KIAIVVHLY----YIDLWIEIANLLSNLSISFDLHV---TLVTESASIKSEILKIFPAAR 169
           KIAI++ ++    Y  L  ++ ++L    +  DL +        S  +   I    P   
Sbjct: 2   KIAILLSVFNGELY--LGKQVKSILEQKDVKLDLFIRDDGSTDGSRELVESIAATDPRVH 59

Query: 170 IHIMENHGRDVLPFLILLETEQLSNYDYVCK 200
           + I  N G     FL L+    +S+YDY   
Sbjct: 60  LIIGHNVGYK-RSFLELVNEPSMSDYDYFAF 89


>gi|239834235|ref|ZP_04682563.1| Chloramphenicol acetyltransferase [Ochrobactrum intermedium LMG
           3301]
 gi|239822298|gb|EEQ93867.1| Chloramphenicol acetyltransferase [Ochrobactrum intermedium LMG
           3301]
          Length = 585

 Score = 36.0 bits (82), Expect = 8.6,   Method: Composition-based stats.
 Identities = 15/145 (10%), Positives = 43/145 (29%), Gaps = 29/145 (20%)

Query: 7   SKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGF----FFWFWTLFYKRSKKLCYDENYVVA 62
           ++ +  +  +    + Y    N+ ++     F    + +      ++   +    N+V++
Sbjct: 180 TQDFRNYWQNLPEIDSYVASVNLHELAQTPYFSARGYKFAAFSPSEKYANIS-PYNFVIS 238

Query: 63  YGSR---SGKKFFAQSNLY---------------------MMERELHFDGQRIHHFPQLL 98
              R     +  F +                          ++    +D   I    +  
Sbjct: 239 CADRVLIEDRCPFIKRRALYFANGHFEQGSSIEKIEHITNFIKSRTRYDINLILENIERT 298

Query: 99  HGWESPAMGKVMQIAIKAKIAIVVH 123
              + P   K  Q+ ++A I+   H
Sbjct: 299 QKSDPPEPIKAPQLPVQAPISRYRH 323


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.314    0.148    0.463 

Lambda     K      H
   0.267   0.0454    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,661,851,666
Number of Sequences: 14124377
Number of extensions: 155402014
Number of successful extensions: 603034
Number of sequences better than 10.0: 270
Number of HSP's better than 10.0 without gapping: 195
Number of HSP's successfully gapped in prelim test: 75
Number of HSP's that attempted gapping in prelim test: 601781
Number of HSP's gapped (non-prelim): 368
length of query: 365
length of database: 4,842,793,630
effective HSP length: 140
effective length of query: 225
effective length of database: 2,865,380,850
effective search space: 644710691250
effective search space used: 644710691250
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (20.9 bits)
S2: 82 (36.0 bits)