RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780923|ref|YP_003065336.1| hypothetical protein CLIBASIA_04110 [Candidatus Liberibacter asiaticus str. psy62] (365 letters) >gnl|CDD|33549 COG3754, RgpF, Lipopolysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane]. Length = 595 Score = 136 bits (345), Expect = 7e-33 Identities = 71/226 (31%), Positives = 101/226 (44%), Gaps = 8/226 (3%) Query: 115 KAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVT-ESASIKSEILKIFPA-ARIHI 172 KIA+ +H+YY DL E L N +DL +T T + + L P A + + Sbjct: 292 IQKIAVHLHVYYTDLLDEFLALAENTPFPYDLILTTDTPDKVAEIQRALARKPKNAFVRV 351 Query: 173 MENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPG 232 +EN GRD+ P L LL + YD VC++H KKS + +W G+LWR +LL + G Sbjct: 352 VENRGRDIGPLLHLLRDLKGDRYDLVCRLHTKKSGQ--ADFWAGELWRHHTIDNLLASRG 409 Query: 233 VVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGI--TFQDQK 290 V + F + +G +R Y + +NR + L MG+ Sbjct: 410 YVTNALEIFADNPSVGADIPPFFRLN--YPTEGIAWFENRAAVADLLRLMGMNVKTDRNT 467 Query: 291 LDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVER 336 GTMFW R AL P+ L L P DG + HA+ER Sbjct: 468 FVAAYGTMFWFRPRALRPLFELELGWNDFPAEPLPQDGHLAHAIER 513 >gnl|CDD|113802 pfam05045, RgpF, Rhamnan synthesis protein F. This family consists of a group of proteins which are related to the Streptococcus rhamnose-glucose polysaccharide assembly protein (RgpF). Rhamnan backbones are found in several O polysaccharides of phytopathogenic bacteria and are regarded as pathogenic factors. Length = 498 Score = 117 bits (294), Expect = 6e-27 Identities = 74/230 (32%), Positives = 112/230 (48%), Gaps = 18/230 (7%) Query: 117 KIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTE--SASIKSEILKIFPA--ARIHI 172 KIA+ H+YY+D+ EI N+ S+DL +T T+ A I+ + K A A + + Sbjct: 266 KIAVHAHVYYVDMLDEILTAFKNIPFSYDLIITTDTDDKKAEIEEILAKRKGAKNAIVRV 325 Query: 173 MENHGRDVLPFLILLETEQLSN-YDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAP 231 ++N GRD+ P LI L+ E + + YD VC+ H KKS + +W G+ ++ L +LL Sbjct: 326 VQNRGRDMSPLLISLKDELVDDRYDLVCRFHTKKSPQA--DFWAGESFKEELIDNLLKPR 383 Query: 232 GVVFKIIRTFDTHRDIGMIGSRA--YRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQ 289 G I+ F+ + IG++ RYP + +N + LA RMGI + Sbjct: 384 GYADNILAMFEQNPSIGLVIPDIVHIRYPT----IGNAWNENAPEMNKLARRMGIKKKFD 439 Query: 290 KLDFFA--GTMFWVRTEALDPIKNLRLS-RYFEPKVHKALDGEIEHAVER 336 A GTMFW R EAL + L F + D + HA+ER Sbjct: 440 DNTPVASYGTMFWFRPEALKKLFELEWKWEDFPNEPLP--DNSLLHAIER 487 >gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 211 Score = 27.0 bits (60), Expect = 8.3 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 6/67 (8%) Query: 278 LAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRY-FEPKVHKALD--GEIEHAV 334 L ++G+ FQ+ FF T V E ++NL L E +V +AL+ G Sbjct: 73 LRRKVGLVFQNPDDQFFGPT---VEEEVAFGLENLGLPEEEIEERVEEALELVGLEGLRD 129 Query: 335 ERCFSLS 341 F+LS Sbjct: 130 RSPFTLS 136 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.327 0.141 0.458 Gapped Lambda K H 0.267 0.0658 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,806,313 Number of extensions: 265173 Number of successful extensions: 694 Number of sequences better than 10.0: 1 Number of HSP's gapped: 687 Number of HSP's successfully gapped: 11 Length of query: 365 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 270 Effective length of database: 4,210,882 Effective search space: 1136938140 Effective search space used: 1136938140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 58 (26.3 bits)