RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780923|ref|YP_003065336.1| hypothetical protein CLIBASIA_04110 [Candidatus Liberibacter asiaticus str. psy62] (365 letters) >gnl|CDD|184645 PRK14359, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional. Length = 430 Score = 35.0 bits (81), Expect = 0.036 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 15/65 (23%) Query: 115 KAKIAIVVH-------LYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPA 167 K+ + V+H L+YI ++ A +IS D+HV L + IK +L+ FP Sbjct: 17 KSSLPKVLHTICGKPMLFYI---LKEA-----FAISDDVHVVLHHQKERIKEAVLEYFPG 68 Query: 168 ARIHI 172 H Sbjct: 69 VIFHT 73 >gnl|CDD|183011 PRK11171, PRK11171, hypothetical protein; Provisional. Length = 266 Score = 28.7 bits (65), Expect = 2.1 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 11/42 (26%) Query: 142 ISFDLHVTLVT--ESASIKSEILKIFPAARIHIMENHGRDVL 181 + FD+HV +VT ASI P H+ME HG VL Sbjct: 180 LRFDMHVNIVTFEPGASI--------PFVETHVME-HGLYVL 212 >gnl|CDD|118101 pfam09565, RE_NgoFVII, NgoFVII restriction endonuclease. This family includes the NgoFVII (recognizes GCSGC but cleavage site unknown) restriction endonuclease. Length = 296 Score = 28.2 bits (63), Expect = 4.0 Identities = 21/95 (22%), Positives = 44/95 (46%), Gaps = 5/95 (5%) Query: 128 DLWIEIANLLSNLSISFD--LHVTLVTESASIKSEILKIF--PAARIHIMENHGRDVLPF 183 DL+ + + + L ++ + + +V E S + I + + I ++ N G D F Sbjct: 128 DLYEFLLSNIVCLHVNIEDSIEPQIVIEYNSPLTTIAGVTGIADSTIQLLMNKGFDYS-F 186 Query: 184 LILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDL 218 I L+ + SN ++ + K +RK +W+E + Sbjct: 187 DIPLKVPESSNLNWSYGLARKNGQRKARNWYEAYI 221 >gnl|CDD|115385 pfam06723, MreB_Mbl, MreB/Mbl protein. This family consists of bacterial MreB and Mbl proteins as well as two related archaeal sequences. MreB is known to be a rod shape-determining protein in bacteria and goes to make up the bacterial cytoskeleton. Genes coding for MreB/Mbl are only found in elongated bacteria, not in coccoid forms. It has been speculated that constituents of the eukaryotic cytoskeleton (tubulin, actin) may have evolved from prokaryotic precursor proteins closely related to today's bacterial proteins FtsZ and MreB/Mbl. Length = 327 Score = 27.9 bits (63), Expect = 4.1 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Query: 157 IKSEILKIFPAARIHIMENHGRDV---LPFLILLETEQLSN 194 IK EI +P ME GRD+ LP I + +E++ Sbjct: 204 IKIEIGSAYPTEEEEKMEIRGRDLVTGLPKTIEISSEEVRE 244 >gnl|CDD|163612 pfam11885, DUF3405, Protein of unknown function (DUF3405). This family of proteins are functionally uncharacterized. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 636 to 810 amino acids in length. Length = 488 Score = 27.0 bits (60), Expect = 7.9 Identities = 11/40 (27%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Query: 203 GKKSKRKGYSWW-----EGDLWRRWLFYDLLGAPGVVFKI 237 ++ +G SW+ +L+RRWL Y + G G +++ Sbjct: 431 DREHNFRGTSWYYRAGFARNLYRRWLGYKVDGDGGREWEL 470 >gnl|CDD|165335 PHA03042, PHA03042, CD47-like protein; Provisional. Length = 286 Score = 26.6 bits (59), Expect = 9.7 Identities = 10/40 (25%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 107 GKVMQIAIK-AKIAIVVHLYYIDLWIEIANLLSNLSISFD 145 G ++ + K K+ +++LY I +WI + L+ I + Sbjct: 130 GTIITLTFKINKLKKIIYLYAISIWITLIMLVGQYMIGLN 169 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.327 0.141 0.458 Gapped Lambda K H 0.267 0.0721 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 6,098,032 Number of extensions: 390323 Number of successful extensions: 862 Number of sequences better than 10.0: 1 Number of HSP's gapped: 862 Number of HSP's successfully gapped: 14 Length of query: 365 Length of database: 5,994,473 Length adjustment: 95 Effective length of query: 270 Effective length of database: 3,941,713 Effective search space: 1064262510 Effective search space used: 1064262510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 58 (26.1 bits)