RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780923|ref|YP_003065336.1| hypothetical protein CLIBASIA_04110 [Candidatus Liberibacter asiaticus str. psy62] (365 letters) >d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Length = 357 Score = 28.2 bits (62), Expect = 1.2 Identities = 21/151 (13%), Positives = 46/151 (30%), Gaps = 28/151 (18%) Query: 2 PVSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVV 61 P G S L +++ + F + + +F E+Y+ Sbjct: 203 PDQGLSIARMLGMLTYRTDLQLAKAFGRATKSDGSFWGDYFQV------------ESYLS 250 Query: 62 AYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIV 121 G + ++F A S L+++ +D + + + IKA+ +V Sbjct: 251 YQGKKFLERFDANSYLHLLRALDMYD-----------PSLGYENVKEALS-RIKARYTLV 298 Query: 122 V----HLYYIDLWIEIANLLSNLSISFDLHV 148 L+ + LL + + Sbjct: 299 SVTTDQLFKPIDLYKSKQLLEQSGVDLHFYE 329 >d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Length = 244 Score = 26.2 bits (56), Expect = 4.1 Identities = 14/140 (10%), Positives = 33/140 (23%), Gaps = 3/140 (2%) Query: 11 FLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVAYGSRSGKK 70 + + + E + + + T+ + + S Sbjct: 99 GFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTVHPVTCFAMRITAGNDIVVYSADSSY 158 Query: 71 FFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLW 130 + H G + + K ++ HL + Sbjct: 159 IPEFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPH---T 215 Query: 131 IEIANLLSNLSISFDLHVTL 150 A+L++ F H+TL Sbjct: 216 GNPADLVTEAKQIFSGHITL 235 >d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Score = 25.9 bits (56), Expect = 4.9 Identities = 8/41 (19%), Positives = 12/41 (29%), Gaps = 1/41 (2%) Query: 249 MIGSRAYRYP-NKYCDYTCSLGKNREMICTLAGRMGITFQD 288 I + + Y C+LG + L G I Sbjct: 14 FISTNRENFHYGSVVTYRCNLGSRGRKVFELVGEPSIYCTS 54 >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 Score = 26.1 bits (57), Expect = 4.9 Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 5/54 (9%) Query: 142 ISFDLHVTLVTESASIKSEILK-----IFPAARIHIMENHGRDVLPFLILLETE 190 IS +T+ ++ + P A H +EN G + L FL + + + Sbjct: 278 ISGKARMTVFASDGHARTFNYQAGDVGYVPFAMGHYVENIGDEPLVFLEIFKDD 331 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.327 0.141 0.458 Gapped Lambda K H 0.267 0.0630 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,521,418 Number of extensions: 74575 Number of successful extensions: 216 Number of sequences better than 10.0: 1 Number of HSP's gapped: 216 Number of HSP's successfully gapped: 15 Length of query: 365 Length of database: 2,407,596 Length adjustment: 87 Effective length of query: 278 Effective length of database: 1,213,086 Effective search space: 337237908 Effective search space used: 337237908 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (24.4 bits)