>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IPR005758 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment. The peptidoglycan layer gives the cell wall its strength, and helps maintain the overall shape of the cell. The basic peptidoglycan structure of both Gram-positive and Gram-negative bacteria is comprised of a sheet of glycan chains connected by short cross-linking polypeptides. Biosynthesis of peptidoglycan is a multi-step (11-12 steps) process comprising three main stages: (1) formation of UDP-N-acetylmuramic acid (UDPMurNAc) from N-acetylglucosamine (GlcNAc). (2) addition of a short polypeptide chain to the UDPMurNAc. (3) addition of a second GlcNAc to the disaccharide-pentapeptide building block and transport of this unit through the cytoplasmic membrane and incorporation into the growing peptidoglycan layer. Stage two involves four key Mur ligase enzymes: MurC (6.3.2.8 from EC) , MurD (6.3.2.9 from EC) , MurE (6.3.2.13 from EC) and MurF (6.3.2.10 from EC) . These four Mur ligases are responsible for the successive additions of L-alanine, D-glutamate, meso-diaminopimelate or L-lysine, and D-alanyl-D-alanine to UDP-N-acetylmuramic acid. All four Mur ligases are topologically similar to one another, even though they display low sequence identity. They are each composed of three domains: an N-terminal Rossmann-fold domain responsible for binding the UDPMurNAc substrate; a central domain (similar to ATP-binding domains of several ATPases and GTPases); and a C-terminal domain (similar to dihydrofolate reductase fold) that appears to be associated with binding the incoming amino acid. The conserved sequence motifs found in the four Mur enzymes also map to other members of the Mur ligase family, including folylpolyglutamate synthetase, cyanophycin synthetase and the capB enzyme from Bacillales . This entry represents UDP-N-acetylmuramate-alanine ligase (MurC). MurC is an essential, cytoplasmic peptidoglycan biosynthetic enzyme, catalyzes the ATP-dependent ligation of L-alanine (Ala) and UDP-N-acetylmuramic acid (UNAM) to form UDP-N-acetylmuramyl-L-alanine (UNAM-Ala). The enzyme is a nonribosomal peptide ligase which utilises ATP to form an amide bond between L-alanine and UNAM.1 Mechanistic studies on the Escherichia coli MurC enzyme using oxygen isotope analyses demonstrated that the enzyme-catalyzed reaction proceeds through an acyl phosphate UNAM intermediate prior to L-alanine addition.; GO: 0005524 ATP binding, 0008763 UDP-N-acetylmuramate-L-alanine ligase activity, 0008360 regulation of cell shape, 0009252 peptidoglycan biosynthetic process, 0009273 peptidoglycan-based cell wall biogenesis, 0051301 cell division, 0005737 cytoplasm.

Probab=94.80  E-value=0.14  Score=27.81  Aligned_cols=90  Identities=27%  Similarity=0.302  Sum_probs=54.2

Q ss_pred             EECCCHHH-HHHHHHHHHCCCCEEEECCCHH--HHHHHHHCCCCEEECCCCCHHHHHHCCHHHCCEEEEE-CCCHHHHHH
Q ss_conf             97377489-9999999847990899719989--9999997699299978999899984893146799993-599689999
Q gi|254780924|r  453 LVGYGRIG-KVIVQNLKAAGIALLVIEDSEK--KIEELRSLGIDVIYGNATITKILLMANIEKARSLVVS-ISTAFEAAY  528 (609)
Q Consensus       453 i~G~g~~g-~~~~~~L~~~~~~v~vid~~~~--~~~~~~~~g~~~~~gd~~~~~~l~~~~i~~a~~vi~~-~~~~~~n~~  528 (609)
T Consensus         4 FvGIGG~GMSglA~~L~~~G~~VsGSD~~~~~y~t~~L~~~Gi~I~~g-~h~~~n~~~~p~g~~~vVv~S~~Ai~~~NpE   82 (491)
T TIGR01082         4 FVGIGGIGMSGLAEILLNRGYKVSGSDIAENAYTTKRLEALGIKIYIG-EHSAENLDDLPTGAADVVVVSAAAIKEDNPE   82 (491)
T ss_pred             EEECCHHCHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHCCCEECCC-CCCHHHHCCCCCCCCCEEEEEEECCCCCCHH
T ss_conf             896062034489999985789087720335631589998678766279-9677982036789743799864033788888


Q ss_pred             HHHHHHHHCCCCEEEEEE
Q ss_conf             999999958988089994
Q gi|254780924|r  529 ITQEARNSNPSILIIALA  546 (609)
Q Consensus       529 ~~~~~~~~~~~~~iia~~  546 (609)
T Consensus        83 i~-~A~~~--~IPv~~R~   97 (491)
T TIGR01082        83 IV-EAKER--GIPVIRRA   97 (491)
T ss_pred             HH-HHHHC--CCCEECHH
T ss_conf             99-99964--88813378