RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780924|ref|YP_003065337.1| potassium-efflux system protein [Candidatus Liberibacter asiaticus str. psy62] (609 letters) >gnl|CDD|34270 COG4651, RosB, Kef-type K+ transport system, predicted NAD-binding component [Inorganic ion transport and metabolism]. Length = 408 Score = 440 bits (1134), Expect = e-124 Identities = 237/412 (57%), Positives = 309/412 (75%), Gaps = 15/412 (3%) Query: 1 MTTIIWGFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVPALAEIGIIL 60 +TTI+ G VLAF+ GA+ANR RL L+GYL+AG+L GP TPGFVA Q+L P LAE+G+IL Sbjct: 8 ITTIVGGLVLAFLLGALANRLRLSPLVGYLLAGVLAGPFTPGFVADQTLAPELAELGVIL 67 Query: 61 LMFGVGLHFSVKDLISVRGIALPGALIQIILGTALGALMGMVMGWSLGGSVVFGLALSIA 120 LMFGVGLHFS+KDL++V+ IA+PGAL QI L T LG + ++GWS G +VFGLALS+A Sbjct: 68 LMFGVGLHFSLKDLLAVKAIAIPGALAQIALATLLGMGLSSLLGWSFGTGIVFGLALSVA 127 Query: 121 STVVLLKALQENRILETDRGKIAVGWLIVEDLIIVLALVLIPAAATNYSAEPSSMTHPWT 180 STVVLL+AL+E ++++T RG+IA+GWLIVEDL +VLALVL+PA A Sbjct: 128 STVVLLRALEERQLIDTQRGRIAIGWLIVEDLAMVLALVLLPALA--------------- 172 Query: 181 SFITQQMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWILHMIFYTGSRELFRLGVL 240 + Q + + ITL KV AFI +ML+ GRR+IPWIL + TGSRELF L VL Sbjct: 173 GVLGQGDVGFATLLVDLGITLGKVAAFIAIMLVVGRRLIPWILERVAATGSRELFTLAVL 232 Query: 241 AIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQESLPLRDAFSVLFFISVGMM 300 AIALG A+G+++LFGVS +LGAFFAGM+LAESELS AA++SLPLRDAF+VLFF+SVGM+ Sbjct: 233 AIALGVAFGAAELFGVSFALGAFFAGMVLAESELSHRAAEDSLPLRDAFAVLFFVSVGML 292 Query: 301 FNPDILISNPILLMMAVIIVIIGKALIAFIVVIAFGRSVATALTIAASLSQIGEFSFILA 360 F+P ILI P+ ++ ++I++ GK++ AF +V AFG V TALTI+ASL+QIGEFSFILA Sbjct: 293 FDPMILIQQPLAVLATLLIILFGKSVAAFFIVRAFGHPVRTALTISASLAQIGEFSFILA 352 Query: 361 NLGVELGILPDQARDLILASSIISIILNPLVFVLAEFLQSFLVLRFARVTSS 412 LG++L +LP+ RDL+LA +I+SI+LNPL+F L + Q + S Sbjct: 353 GLGIKLNLLPEAGRDLVLAGAILSILLNPLLFALLDRYQRSAEWLKEQAAES 404 >gnl|CDD|144551 pfam00999, Na_H_Exchanger, Sodium/hydrogen exchanger family. Na/H antiporters are key transporters in maintaining the pH of actively metabolising cells. The molecular mechanisms of antiport are unclear. These antiporters contain 10-12 transmembrane regions (M) at the amino-terminus and a large cytoplasmic region at the carboxyl terminus. The transmembrane regions M3-M12 share identity with other members of the family. The M6 and M7 regions are highly conserved. Thus, this is thought to be the region that is involved in the transport of sodium and hydrogen ions. The cytoplasmic region has little similarity throughout the family. Length = 371 Score = 187 bits (477), Expect = 7e-48 Identities = 111/396 (28%), Positives = 193/396 (48%), Gaps = 33/396 (8%) Query: 4 IIWGFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVP-ALAEIGIILLM 62 + +LA + G +A R LP ++G ++AGIL+GP G V L LAE+G+ L+ Sbjct: 1 AVLLILLALLAGLLARRLGLPPVVGLILAGILLGPSGLGLVEPDELDLEVLAELGLPFLL 60 Query: 63 FGVGLHFSVKDLISVRGIALPGALIQIILGTALGAL---MGMVMGWSLGGSVVFGLALSI 119 F GL +++L L AL+ ++L L L + +G L +++FG ALS Sbjct: 61 FLAGLELDLRELRKNGKSILLLALLGVLLPFLLIGLLLALLGGLGIPLLEALLFGAALSA 120 Query: 120 ASTVVLLKALQENRILETDRGKIAVGWLIVEDLIIVLALVLIPAAATNYSAEPSSMTHPW 179 S VV+L L+E L T G + +G ++ D + V+ L ++ A A Sbjct: 121 TSPVVVLAILKERGRLNTRLGTLILGESVLNDAVAVVLLAVLLALAGVGG---------- 170 Query: 180 TSFITQQMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWI--LHMIFYTGSRELFRL 237 + LL + + + + V W+ L F +G REL L Sbjct: 171 ---------------LSDLGLLLLIFLVVALGGLLLGLVFGWLLRLITRFTSGDRELEVL 215 Query: 238 GVLAIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQESLPLRDAFS-VLFFIS 296 VLA+AL A ++L G+S LGAF AG++L+ + +++ P LFF+ Sbjct: 216 LVLALALL-AALLAELLGLSGILGAFLAGLVLSNYAFANELSEKLEPFGYGLFLPLFFVL 274 Query: 297 VGMMFNPDILISNPILLMMAVIIVIIGKALIAFIVVIAFGRSVATALTIAASLSQIGEFS 356 VG+ + +L+S +L+++ ++ +++GK L F++ G S+ AL + Q G S Sbjct: 275 VGLSLDLSLLLSLLLLVLLLLVAILLGKLLGVFLLARLLGLSLREALIVGFGGLQRGAVS 334 Query: 357 FILANLGVELGILPDQARDLILASSIISIILNPLVF 392 LA +G++LG++ + L++A +++ +L PL+ Sbjct: 335 LALAAIGLQLGLIDRELYTLLVAVVLLTTLLKPLLK 370 >gnl|CDD|30823 COG0475, KefB, Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism]. Length = 397 Score = 157 bits (398), Expect = 8e-39 Identities = 134/399 (33%), Positives = 219/399 (54%), Gaps = 32/399 (8%) Query: 9 VLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFV-ASQSLVPALAEIGIILLMFGVGL 67 ++A I G + R LP ++GYL+AGI++GP + S ++ LAE+G++ L+F +GL Sbjct: 16 LVAVILGPLFKRLGLPPVLGYLLAGIILGPWGLLLIIESSEIIELLAELGVVFLLFLIGL 75 Query: 68 HFSVKDLISVRG-IALPGALIQIILGTALGALMG-MVMGWSLGGSVVFGLALSIASTVVL 125 F ++ L V + L A + + LG L+ ++G SL ++ G AL+++ST ++ Sbjct: 76 EFDLERLKKVGRSVGLGVAQVGLTAPFLLGLLLLLGILGLSLIAALFLGAALALSSTAIV 135 Query: 126 LKALQENRILETDRGKIAVGWLIVEDLIIVLALVLIPAAATNYSAEPSSMTHPWTSFITQ 185 LK L E +L+T G++ +G L+ +D+ +L L ++PA A S Sbjct: 136 LKILMELGLLKTREGQLILGALVFDDIAAILLLAIVPALAGGGS---------------- 179 Query: 186 QMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWILHMIFYTGSRELFRLGVLAIALG 245 G G I+ LL ++AF+ ++L+ GR ++P + + T S ELF L VL + LG Sbjct: 180 ------GSVGFILGLLLAILAFLALLLLLGRYLLPPLFRRVAKTESSELFILFVLLLVLG 233 Query: 246 FAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQESL-PLRDAFSV-LFFISVGMMFNP 303 AY + L G+S+ LGAF AG++L+ESE + +E + P D + LFFISVGM + Sbjct: 234 AAYLAE-LLGLSMILGAFLAGLLLSESEYRKHELEEKIEPFGDGLFIPLFFISVGMSLDL 292 Query: 304 DILISNPILLMMAVIIVIIGKALIAFIVVIAFGRSVATALTIAASLSQIGEFSFILANLG 363 +L+ N +L+++ V + I+GK L A++ G S AL I L Q GEF+F+LA + Sbjct: 293 GVLLENLLLILLLVALAILGKILGAYLAARLLGFSKRLALGIGLLLRQGGEFAFVLAGIA 352 Query: 364 VELGILPDQARDLILASSIISIILNPLVFVLAEFLQSFL 402 + I L+ A I+S+I P++ +L L L Sbjct: 353 LGSAISE----ALLTAVVILSMITTPILPLLTPILLKRL 387 >gnl|CDD|145418 pfam02254, TrkA_N, TrkA-N domain. This domain is found in a wide variety of proteins. These protein include potassium channels, phosphoesterases, and various other transporters. This domain binds to NAD. Length = 115 Score = 96.5 bits (241), Expect = 2e-20 Identities = 41/115 (35%), Positives = 66/115 (57%), Gaps = 1/115 (0%) Query: 451 VILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATITKILLMANI 510 +I++GYGR+G+ + + L+ G ++VI+ +++EELR G+ V+ G+AT ++L A I Sbjct: 1 IIIIGYGRVGRSLAEELREGGP-VVVIDKDPERVEELREEGVPVVVGDATDEEVLEEAGI 59 Query: 511 EKARSLVVSISTAFEAAYITQEARNSNPSILIIALADSDSEVEHLTRYGADTVVM 565 E A ++V + I AR NP+ IIA A+ E L R GAD V+ Sbjct: 60 EDADAVVAATGDDEANILIVLLARELNPAKKIIARANDPEHAELLRRLGADEVIS 114 >gnl|CDD|36863 KOG1650, KOG1650, KOG1650, Predicted K+/H+-antiporter [Inorganic ion transport and metabolism]. Length = 769 Score = 70.0 bits (171), Expect = 2e-12 Identities = 84/428 (19%), Positives = 158/428 (36%), Gaps = 50/428 (11%) Query: 4 IIWGFVLAFIFGAIANRCRLPTLIGYLVAGILVGP----------RTPGFVASQSLVPAL 53 II VL+ + + P +I ++AGI++GP T +S ++ L Sbjct: 28 IILIIVLSRLLHILLKPLGQPRVISEILAGIILGPSLLGRIPSYMNTIFPKSSMIVLELL 87 Query: 54 AEIGIILLMFGVGL---------HFSVKDLISVRGIALPGALIQIILGTALGALMGMVMG 104 A +G + +F +GL +I++ + LP L + G Sbjct: 88 ANLGFLFFLFLMGLEIDLRVIRRTGKKAIVIAIASVVLPFGLGFGLAFLLSDTKADKEDG 147 Query: 105 --WSLGGSVVFGLALSIASTVVLLKALQENRILETDRGKIAVGWLIVEDLIIVLALVLIP 162 + + A SI S VL + L E ++L ++ G++A+ +V D+ + L L Sbjct: 148 ALFLPFEILFILSAQSITSFPVLARILAELKLLNSELGRLALSAAVVNDVAGWILLALAL 207 Query: 163 AAATNYSAEPSSMTHPWTSFITQQMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWI 222 A ++ P + L+ V+ F+ + R ++ WI Sbjct: 208 AFSSE----------------------LKLSPLRSVWDLVLVIGFVLFLFFVVRPLMKWI 245 Query: 223 LHMIFYTGSRELFRLGV-LAIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQE 281 + + V L L A+ + + G+ GAF G+ + SA E Sbjct: 246 IKRTPEGKPVSDAYICVTLLGVLASAFLTDLIGGIHSIFGAFILGLAIPHGPPLGSALIE 305 Query: 282 SL--PLRDAFSVLFFISVGMMFNPDILISNPILLMMAVI-IVIIGKALIAFIVVIAFGRS 338 L + L+F G+ DI N ++ I I K L + Sbjct: 306 KLEDLVSGLLLPLYFAISGLKT--DISRINKWGALIRTILIFGAVKLLSTLGTSLYCKLP 363 Query: 339 VATALTIAASLSQIGEFSFILANLGVELGILPDQA-RDLILASSIISIILNPLVFVLAEF 397 + +L + +S G I+ N G++ IL D+ ++L + + + I PL+ L + Sbjct: 364 LRDSLALGLLMSTKGLVELIVLNTGLDRKILSDEGFTVMVLMALVSTFITPPLLMFLYDP 423 Query: 398 LQSFLVLR 405 + + + Sbjct: 424 TRKYHGYK 431 >gnl|CDD|31419 COG1226, Kch, Kef-type K+ transport systems, predicted NAD-binding component [Inorganic ion transport and metabolism]. Length = 212 Score = 68.6 bits (166), Expect = 4e-12 Identities = 54/134 (40%), Positives = 82/134 (61%), Gaps = 1/134 (0%) Query: 446 DLCDHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATITKIL 505 L HVI+VG+GR+G+++ + L A+GI ++VI+ E ++E LR LG+ V+ G+AT ++L Sbjct: 19 RLKRHVIIVGFGRVGQIVARALLASGIPVVVIDSDEDRVELLRELGLLVVLGDATREEVL 78 Query: 506 LMANIEKARSLVVSISTAFEAAYITQEARNSNPSILIIALADS-DSEVEHLTRYGADTVV 564 A IE+AR+++V++S +I AR NP + I+A A D VE LT GAD VV Sbjct: 79 EAAGIERARAVIVTLSDDATNVFIVLLARAINPELEILARARDLDEAVETLTTVGADEVV 138 Query: 565 MSAREIALGMLDRL 578 E AL + Sbjct: 139 PPTFESALLLARAA 152 >gnl|CDD|30915 COG0569, TrkA, K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]. Length = 225 Score = 62.2 bits (151), Expect = 5e-10 Identities = 30/132 (22%), Positives = 64/132 (48%), Gaps = 2/132 (1%) Query: 451 VILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGID--VIYGNATITKILLMA 508 +I++G GR+G+ + + L G +++I+ E+++EE + +D V+ G+AT +L A Sbjct: 3 IIIIGAGRVGRSVARELSEEGHNVVLIDRDEERVEEFLADELDTHVVIGDATDEDVLEEA 62 Query: 509 NIEKARSLVVSISTAFEAAYITQEARNSNPSILIIALADSDSEVEHLTRYGADTVVMSAR 568 I+ A ++V + + + A +IA A + + L + GAD ++ + Sbjct: 63 GIDDADAVVAATGNDEVNSVLALLALKEFGVPRVIARARNPEHEKVLEKLGADVIISPEK 122 Query: 569 EIALGMLDRLNQ 580 A + + Sbjct: 123 LAAKRLARLIVT 134 >gnl|CDD|37228 KOG2017, KOG2017, KOG2017, Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism]. Length = 427 Score = 38.4 bits (89), Expect = 0.006 Identities = 41/166 (24%), Positives = 70/166 (42%), Gaps = 18/166 (10%) Query: 434 ILEQQEVTIQKTDLCDHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGID 493 IL + V Q + V++VG G +G Q L AAG+ L I D + EL +L Sbjct: 52 ILPEFGVHGQLSLKNSSVLVVGAGGLGCPAAQYLAAAGVGRLGIVDYDVV--ELSNLHRQ 109 Query: 494 VIYGNATITKILLMANIEKARSLVVSISTAFEAAYITQEARNSNPSILI----IALADSD 549 V++ A + M E A + + +++ E + +SN +I + L +D Sbjct: 110 VLHTEARVG----MHKAESAAAFLRRLNSHVEVQTYNEFLSSSNAFDIIKQYDVVLDCTD 165 Query: 550 SEVEHLTRYG-ADTVVMSAREI----ALGMLDRLNQVHHEKVTCDR 590 + TRY +D V+ + + AL +L ++ C R Sbjct: 166 NV---PTRYLISDVCVLLGKPLVSGSALRWEGQLTVYNYNNGPCYR 208 >gnl|CDD|30375 COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism]. Length = 429 Score = 37.6 bits (87), Expect = 0.010 Identities = 60/334 (17%), Positives = 128/334 (38%), Gaps = 33/334 (9%) Query: 1 MTTIIWGFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLV--PALAEIGI 58 + ++ +L + +A R LP + L+ G+L GP ++ + + + Sbjct: 8 LFLLLLILLLGLLVSVLAGRLLLPEIPLLLLLGLLGGPPGLNLISPDLELDPELFLVLFL 67 Query: 59 ILLMFGVGLHFSVKDLISVRGIALPGALIQIILGTAL--GALMGMVMGWSLGGSVVFGLA 116 +L+F GL +++L V L AL +++ ++ G L + + G Sbjct: 68 AILLFAGGLELDLRELRRVWRSILVLALPLVLITALGIGLLAHWLLPGIPLAAAFLLGAI 127 Query: 117 LSIASTVVLLKALQENRILETDRGKIAVGWLIVEDLIIVLALVLIPAAATNYSAEPSSMT 176 LS V + + R+ + R + L+ + + IVL V + Sbjct: 128 LSPTDPVAVSPIFKRVRVPKRIRTILEGESLLNDGVGIVLFKVAL--------------- 172 Query: 177 HPWTSFITQQMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWILHMIFYTGSRELFR 236 + + F +G L+ + +G++L + + L +T S L Sbjct: 173 ----AALLGTGAFSLGWALLLFLIEALGGILLGLLLGYLLGRLLRRLDRRGWT-SPLLET 227 Query: 237 LGVLAIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQESLPLRDAF------- 289 L L +A AY ++ GVS L AG++L E+ + + +F Sbjct: 228 LLTLLLAFA-AYLLAEALGVSGILAVVVAGLVLGEAVRINLSPASARLRLSSFWEVLDFL 286 Query: 290 -SVLFFISVGMMFNPDILISNPILLMMAVIIVII 322 + L F+ +G +L++ +L ++ ++ ++ Sbjct: 287 LNGLLFVLLGAQLPLSLLLALGLLGLLVALVAVL 320 >gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins. Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes, or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 330 Score = 36.5 bits (85), Expect = 0.022 Identities = 16/46 (34%), Positives = 23/46 (50%) Query: 449 DHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDV 494 + V ++G G +G + VQ +A G + I S K E R LG D Sbjct: 164 ERVAVLGIGGLGHLAVQYARAMGFETVAITRSPDKRELARKLGADE 209 >gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases. This group contains proteins identified as sorbitol dehydrogenases and other sugar dehydrogenases of the medium-chain dehydrogenase/reductase family (MDR), which includes zinc-dependent alcohol dehydrogenase and related proteins. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Related proteins include threonine dehydrogenase, formaldehyde dehydrogenase, and butanediol dehydrogenase. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Horse liver alcohol dehydrogenase is a dimeric enzyme and each subunit has two domains. The NAD binding domain is in a Rossmann fold and the catalytic domain contains a zinc ion to which substrates bind. There is a cleft between the domains that closes upon formation of the ternary complex. Length = 343 Score = 36.4 bits (85), Expect = 0.023 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Query: 449 DHVILVGYGRIGKVIVQNLKAAGIA-LLVIEDSEKKIEELRSLGIDVIY 496 D V+++G G IG + +Q LK G ++ ++ ++K+ R LG D Sbjct: 161 DTVVVIGAGTIGLLAIQWLKILGAKRVIAVDIDDEKLAVARELGADDTI 209 >gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family, including threonine dehydrogenase. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 319 Score = 35.7 bits (83), Expect = 0.035 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 5/62 (8%) Query: 434 ILEQQEVTIQKTDLCDHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGID 493 ILEQ +T D V ++G G++G +I Q L G ++++ +K+ R LG++ Sbjct: 147 ILEQVPITPG-----DKVAVLGDGKLGLLIAQVLALTGPDVVLVGRHSEKLALARRLGVE 201 Query: 494 VI 495 + Sbjct: 202 TV 203 >gnl|CDD|30635 COG0287, TyrA, Prephenate dehydrogenase [Amino acid transport and metabolism]. Length = 279 Score = 34.6 bits (79), Expect = 0.082 Identities = 23/117 (19%), Positives = 46/117 (39%), Gaps = 4/117 (3%) Query: 448 CDHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATITKILLM 507 V +VG G +G + + LK AG+ + +I +L + VI +T L Sbjct: 3 SMKVGIVGLGLMGGSLARALKEAGLVVRIIGRDRSAATLKAALELGVID---ELTVAGLA 59 Query: 508 ANIEKARSLVVSISTAFEAAYITQEARNSNPSILIIALADSDSEV-EHLTRYGADTV 563 +A ++V++ + + A + ++ + S V E + +Y V Sbjct: 60 EAAAEADLVIVAVPIEATEEVLKELAPHLKKGAIVTDVGSVKSSVVEAMEKYLPGDV 116 >gnl|CDD|35246 KOG0023, KOG0023, KOG0023, Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism]. Length = 360 Score = 34.1 bits (78), Expect = 0.11 Identities = 22/47 (46%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Query: 449 DHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEE-LRSLGIDV 494 V +VG G +G + VQ KA G+ + VI S KK EE ++SLG DV Sbjct: 183 KWVGIVGLGGLGHMAVQYAKAMGMRVTVISTSSKKKEEAIKSLGADV 229 >gnl|CDD|31264 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only]. Length = 339 Score = 33.6 bits (77), Expect = 0.15 Identities = 18/48 (37%), Positives = 27/48 (56%) Query: 449 DHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIY 496 V +VG G +G + VQ KA G ++ I SE+K+E + LG D + Sbjct: 168 KWVAVVGAGGLGHMAVQYAKAMGAEVIAITRSEEKLELAKKLGADHVI 215 >gnl|CDD|73271 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1. Aos1 is part of the heterodimeric activating enzyme (E1), specific for the SUMO family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. The E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by SUMO family of ubiquitin-like proteins (Ublps) is involved in cell division, nuclear transport, the stress response and signal transduction. Aos1 contains part of the adenylation domain.. Length = 197 Score = 30.9 bits (70), Expect = 0.93 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 2/91 (2%) Query: 443 QKTDLCDHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATIT 502 QK ++L+G +G I +NL +GI L I D EE LG + + Sbjct: 16 QKRLRSARILLIGLKGLGAEIAKNLVLSGIGSLTILDDRTVTEE--DLGAQFLIPAEDLG 73 Query: 503 KILLMANIEKARSLVVSISTAFEAAYITQEA 533 + A++E+ R+L + + + I+++ Sbjct: 74 QNRAEASLERLRALNPRVKVSVDTDDISEKP 104 >gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine, via NAD(H)-dependent oxidation. THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Length = 334 Score = 31.0 bits (71), Expect = 0.99 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Query: 449 DHVILVGYGRIGKVIVQNLKAAGIA-LLVIEDSEKKIEELRSLGIDVIY 496 D V++ G G IG ++ Q LK G + + V E +E+K+E + LG Sbjct: 161 DSVLVFGAGPIGLLLAQLLKLNGASRVTVAEPNEEKLELAKKLGATETV 209 >gnl|CDD|34564 COG4956, COG4956, Integral membrane protein (PIN domain superfamily) [General function prediction only]. Length = 356 Score = 31.0 bits (70), Expect = 1.0 Identities = 22/124 (17%), Positives = 52/124 (41%), Gaps = 7/124 (5%) Query: 289 FSVLFFISVGMMFNPDIL----ISNPILLMMAVIIVIIGKALIAFIVVIAFGRSVATALT 344 ++ +G P++L I + L + +IG A+I F++ FG+ V L Sbjct: 9 LFIIIGAVLGFAVIPELLADLGIQDTAFLNNEYVDALIG-AIIFFLISFWFGKYVLNWLK 67 Query: 345 -IAASLSQIGEFSFILANLGVELGILPDQARDLILASSIISIILNPLVFVLAEFLQSFLV 403 + + ++ + + +G+ +G+L L I I + ++ V+ + ++ Sbjct: 68 RLEEQIRKLPVTTILFGTIGLIIGLLIAVLLSSPLFLLPIPFI-STIIPVILTIILAYFG 126 Query: 404 LRFA 407 + A Sbjct: 127 FQLA 130 >gnl|CDD|31366 COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]. Length = 289 Score = 30.2 bits (68), Expect = 1.7 Identities = 14/62 (22%), Positives = 30/62 (48%) Query: 299 MMFNPDILISNPILLMMAVIIVIIGKALIAFIVVIAFGRSVATALTIAASLSQIGEFSFI 358 +M DI ++ P LL+ +++ I+G L+ I+ +A A + + + E ++ Sbjct: 121 LMRITDIFLAFPSLLLAILLVAILGPGLLNLILALALVGWPGYARIVRGQVLSLREREYV 180 Query: 359 LA 360 A Sbjct: 181 EA 182 >gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members. This group contains enzymes of the zinc-dependent alcohol dehydrogenase family, including members (aka MDR) identified as 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase and N-benzyl-3-pyrrolidinol dehydrogenase. 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase catalyzes the conversion of 6-Hydroxycyclohex-1-enecarbonyl-CoA and NAD+ to 6-Ketoxycyclohex-1-ene-1-carboxyl-CoA,NADH, and H+. This group displays the characteristic catalytic and structural zinc sites of the zinc-dependent alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 338 Score = 29.5 bits (67), Expect = 2.5 Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 5/77 (6%) Query: 451 VILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATITKILLMANI 510 V+++G G +G VQ KA G A++ ++ E+K+E + LG D + + + A Sbjct: 169 VLVIGLGGLGLNAVQIAKAMGAAVIAVDIKEEKLELAKELGADEVLNSLDDSPKDKKAA- 227 Query: 511 EKARSLVVSISTAFEAA 527 L F+ Sbjct: 228 ----GLGGGFDVIFDFV 240 >gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family. The medium chain reductase/dehydrogenases (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH) , quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Other MDR members have only a catalytic zinc, and some contain no coordinated zinc. Length = 271 Score = 29.6 bits (67), Expect = 2.8 Identities = 17/45 (37%), Positives = 29/45 (64%) Query: 449 DHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGID 493 D V+++G G +G + Q KAAG ++V + S++K+E + LG D Sbjct: 136 DTVLVLGAGGVGLLAAQLAKAAGARVIVTDRSDEKLELAKELGAD 180 >gnl|CDD|107344 cd06349, PBP1_ABC_ligand_binding_like_14, Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally. Length = 340 Score = 29.3 bits (66), Expect = 3.2 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 4/83 (4%) Query: 449 DHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATITKILLMA 508 D +IL+ Y G I + +A G+ + V+ S + LG D + G T T Sbjct: 192 DAIILISYYNDGAPIARQARAVGLDIPVVASSSVYSPKFIELGGDAVEGVYTPTAFFPGD 251 Query: 509 NIEKARSLVVSISTAFEAAYITQ 531 + +S V +A+EA Y Q Sbjct: 252 PRPEVQSFV----SAYEAKYGAQ 270 >gnl|CDD|30949 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]. Length = 326 Score = 29.2 bits (65), Expect = 3.3 Identities = 13/45 (28%), Positives = 24/45 (53%) Query: 451 VILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVI 495 ++ G +G +Q KA G ++ + S +K+E L+ LG D + Sbjct: 147 LVHGAAGGVGSAAIQLAKALGATVVAVVSSSEKLELLKELGADHV 191 >gnl|CDD|35574 KOG0353, KOG0353, KOG0353, ATP-dependent DNA helicase [General function prediction only]. Length = 695 Score = 29.0 bits (64), Expect = 3.5 Identities = 32/144 (22%), Positives = 54/144 (37%), Gaps = 12/144 (8%) Query: 426 KQEVPVESILEQQEVTIQKTDLCDHVILVGYGRIGKVIVQNLKAA---GIALLV---IED 479 K++ +E Q I T + L+ GK + L A G AL++ I Sbjct: 87 KEQFHLEKFRPLQLAAINATMAGEDAFLILPTGGGKSLCYQLPALCADGFALVICPLISL 146 Query: 480 SEKKIEELRSLGIDVIYGNATITKILLMANIEKARSLVVSISTAFEAAYITQEARNSNPS 539 E +I +L+ LGID NA +K ++ + + + + F+ Y+T E S Sbjct: 147 MEDQILQLKQLGIDASMLNANSSK----EEAKRVEAAITNKDSEFKLIYVTPEKIAK--S 200 Query: 540 ILIIALADSDSEVEHLTRYGADTV 563 + + E D V Sbjct: 201 KKFMNKLEKALEAGFFKLIAIDEV 224 >gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Length = 351 Score = 28.7 bits (65), Expect = 5.3 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Query: 449 DHVILVGYGRIGKVIVQNLKAAGIA-LLVIEDSEKKIEELRSLGIDVIY 496 D +++G G IG + + LKAAG + ++V E SE + E LG ++ Sbjct: 174 DTALVLGAGPIGLLTILALKAAGASKIIVSEPSEARRELAEELGATIVL 222 >gnl|CDD|31311 COG1114, BrnQ, Branched-chain amino acid permeases [Amino acid transport and metabolism]. Length = 431 Score = 28.6 bits (64), Expect = 5.6 Identities = 45/188 (23%), Positives = 75/188 (39%), Gaps = 17/188 (9%) Query: 3 TIIWGFVL-AFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVPALAEIGIILL 61 I GF+L A FGA P ++G AG V P GF+ + +P L GII + Sbjct: 7 IIALGFMLFALFFGA--GNLIFPPMLGLH-AGEHVWPAILGFLLTGVGLPLL---GIIAV 60 Query: 62 MFGVGLHFSVKDLISVR-GIALPGALIQII---LGTALGALMGMVMGWSLGGSVVFGLAL 117 G S+ I G+ A+ I + +G S +L Sbjct: 61 ALYGGGVESLATRIGPWFGVLFAIAIYLSIGPFFAIPRTGAVSFEVGISPLLGDSSLPSL 120 Query: 118 SIAST----VVLLKALQENRILETDRGKIAVGWLIVEDLIIVLALVLIPAAATNYSAEPS 173 I S + L +L +++++ GK L+V L+I++ +IP A +A + Sbjct: 121 FIFSVIFFAIAYLFSLNPSKLIDR-VGKFLTPILLVL-LLILVIAAIIPPAGPISAASGA 178 Query: 174 SMTHPWTS 181 + P++ Sbjct: 179 YQSQPFSK 186 >gnl|CDD|30111 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1). . Length = 228 Score = 28.5 bits (64), Expect = 5.6 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Query: 450 HVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATI 501 V++VG G +G + L AAG+ L + D + + EL +L +++ A + Sbjct: 23 RVLVVGAGGLGSPAAEYLAAAGVGKLGLVDDD--VVELSNLQRQILHTEADV 72 >gnl|CDD|31226 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]. Length = 300 Score = 28.3 bits (63), Expect = 5.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Query: 453 LVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGI 492 ++G GR+G +V+ L G ++ + ++ +EEL+ G Sbjct: 5 MIGLGRMGANLVRRLLDGGHDVVGYDVNQTAVEELKDEGA 44 >gnl|CDD|144461 pfam00875, DNA_photolyase, DNA photolyase. This domain binds a light harvesting cofactor. Length = 164 Score = 28.3 bits (64), Expect = 5.8 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Query: 465 QNLKAAGIALLVIE-DSEKKIEEL-RSLGIDVIYGN 498 ++L GI L+V D + + EL + LG +Y N Sbjct: 60 ESLAKLGIPLIVRRGDPAEVLPELAKELGASAVYWN 95 >gnl|CDD|35292 KOG0069, KOG0069, KOG0069, Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion]. Length = 336 Score = 28.4 bits (63), Expect = 6.1 Identities = 14/44 (31%), Positives = 21/44 (47%) Query: 451 VILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDV 494 V ++G GRIGK I + LK G +L ++ EE + Sbjct: 165 VGILGLGRIGKAIAKRLKPFGCVILYHSRTQLPPEEAYEYYAEF 208 >gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group contains proteins that share the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenase family. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine (His-51), the ribose of NAD, a serine (Ser-48), then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 332 Score = 28.4 bits (64), Expect = 6.6 Identities = 12/45 (26%), Positives = 24/45 (53%) Query: 451 VILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVI 495 ++ G +G +Q KA G ++ + S +K++ L+ LG D + Sbjct: 167 LVTGAGGGVGIHAIQLAKALGARVIAVTRSPEKLKILKELGADYV 211 >gnl|CDD|144913 pfam01496, V_ATPase_I, V-type ATPase 116kDa subunit family. This family consists of the 116kDa V-type ATPase (vacuolar (H+)-ATPases) subunits, as well as V-type ATP synthase subunit i. The V-type ATPases family are proton pumps that acidify intracellular compartments in eukaryotic cells for example yeast central vacuoles, clathrin-coated and synaptic vesicles. They have important roles in membrane trafficking processes. The 116kDa subunit (subunit a) in the V-type ATPase is part of the V0 functional domain responsible for proton transport. The a subunit is a transmembrane glycoprotein with multiple putative transmembrane helices it has a hydrophilic amino terminal and a hydrophobic carboxy terminal. It has roles in proton transport and assembly of the V-type ATPase complex. This subunit is encoded by two homologous gene in yeast VPH1 and STV1. Length = 707 Score = 28.1 bits (63), Expect = 7.2 Identities = 35/177 (19%), Positives = 67/177 (37%), Gaps = 19/177 (10%) Query: 234 LFRLGVLAIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQESLPL-RDAFSVL 292 L +GV +I GF Y FG SL++ F +G + S + F + Sbjct: 404 LLLMGVFSIYTGFIYND--CFGKSLNI--FGSGWLWPVMIKSGETLTLAPHEGPYPFGID 459 Query: 293 FFISVGMMFNPDILISNPILLMMAVIIVIIGKA---LIAFIVVIAFGRSVATALTIAASL 349 + +L N + +++I+ +I + F + F + A + Sbjct: 460 PEWNGV---ENKLLFLNSYKMKLSIILGVIHMTFGLFLGFFNHVKFKSKID---IKDAFI 513 Query: 350 SQIGEFSFILANLG-VELGILPDQARDLILASSIISIILNPLVFV-LAEFLQSFLVL 404 Q+ S+++ G + + I+ D S +L L+ + L +Q FLV+ Sbjct: 514 PQL---SWLIIIFGYLVILIIYKWLVDWAKTSKPAPSLLIGLINMFLFPGVQVFLVV 567 >gnl|CDD|32044 COG1859, KptA, RNA:NAD 2'-phosphotransferase [Translation, ribosomal structure and biogenesis]. Length = 211 Score = 27.9 bits (62), Expect = 7.4 Identities = 22/117 (18%), Positives = 37/117 (31%), Gaps = 27/117 (23%) Query: 455 GYGRIGKVIVQNLKA---AGIALL--VIEDSEKKIEELRSLGIDVIYG----------NA 499 G+ I +++ KA LL V+ +K EL+ I YG A Sbjct: 58 GWADIDELLEGLRKAGRWLTRELLLAVVATDDKGRFELKEGKIRARYGHSIPVDLRLPEA 117 Query: 500 TITKILLMANIEKARSLV------------VSISTAFEAAYITQEARNSNPSILIIA 544 +L + + V +S +E A + +P +L I Sbjct: 118 EPPAVLYHGTSPEFLPSILEEGLKPMKRRHVHLSADYETAKQVGLRHSGSPVVLEID 174 >gnl|CDD|30845 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism]. Length = 420 Score = 27.9 bits (62), Expect = 7.9 Identities = 13/44 (29%), Positives = 21/44 (47%) Query: 451 VILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDV 494 V++ GYG +G+ I L+ G ++V E + E G V Sbjct: 212 VVVAGYGWVGRGIAMRLRGMGARVIVTEVDPIRALEAAMDGFRV 255 >gnl|CDD|36584 KOG1370, KOG1370, KOG1370, S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism]. Length = 434 Score = 28.0 bits (62), Expect = 8.6 Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 451 VILVGYGRIGKVIVQNLKAAGIALLVIE 478 ++ GYG +GK Q LK G ++V E Sbjct: 217 AVVCGYGDVGKGCAQALKGFGARVIVTE 244 >gnl|CDD|32775 COG2954, COG2954, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 156 Score = 27.6 bits (61), Expect = 9.8 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 252 KLFGVSLSLGAFFAGMILAESELSQSAAQESLP 284 L+ V + LG AG+++AE EL A LP Sbjct: 97 FLWEVDVFLGDN-AGLVVAEVELPDENADFDLP 128 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.140 0.392 Gapped Lambda K H 0.267 0.0779 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 7,001,269 Number of extensions: 405656 Number of successful extensions: 2627 Number of sequences better than 10.0: 1 Number of HSP's gapped: 2497 Number of HSP's successfully gapped: 395 Length of query: 609 Length of database: 6,263,737 Length adjustment: 99 Effective length of query: 510 Effective length of database: 4,124,446 Effective search space: 2103467460 Effective search space used: 2103467460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 60 (26.8 bits)