>TIGR00966 3a0501s07 protein-export membrane protein SecF; InterPro: IPR005665 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component. . From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins. The translocase protein subunits are encoded on the bacterial chromosome. The translocase itself comprises 7 proteins, including a chaperone protein (SecB), an ATPase (SecA), an integral membrane complex (SecCY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) . The chaperone protein SecB is a highly acidic homotetrameric protein that exists as a "dimer of dimers" in the bacterial cytoplasm. SecB maintains preproteins in an unfolded state after translation, and targets these to the peripheral membrane protein ATPase SecA for secretion . Together with SecY and SecG, SecE forms a multimeric channel through which preproteins are translocated, using both proton motive forces and ATP-driven secretion. The latter is mediated by SecA. The structure of the Escherichia coli SecYEG assembly revealed a sandwich of two membranes interacting through the extensive cytoplasmic domains . Each membrane is composed of dimers of SecYEG. The monomeric complex contains 15 transmembrane helices. This family consists of various prokaryotic SecF protein export membrane proteins. The SecD and SecF equivalents of the Gram-positive bacterium Bacillus subtilis are jointly present in one polypeptide, denoted SecDF, that is required to maintain a high capacity for protein secretion. Unlike the SecD subunit of the pre-protein translocase of Escherichia coli, SecDF of B. subtilis was not required for the release of a mature secretory protein from the membrane, indicating that SecDF is involved in earlier translocation steps . Comparison with SecD and SecF proteins from other organisms revealed the presence of 10 conserved regions in SecDF, some of which appear to be important for SecDF function. Interestingly, the SecDF protein of B. subtilis has 12 putative transmembrane domains. Thus, SecDF does not only show sequence similarity but also structural similarity to secondary solute transporters . ; GO: 0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity, 0006886 intracellular protein transport, 0009276 1-2nm peptidoglycan-based cell wall.

Probab=100.00 E-value=0 Score=395.27 Aligned_cols=249 Identities=39% Similarity=0.689 Sum_probs=226.5 Q ss_pred CCCCCCCCCCCEEEEEECC------------CCCCHHHHHHHHHH---------------------HHHCCCCCCCCCC- Q ss_conf 2345555566037999717------------75788999885555---------------------4200233323568- Q gi|254780925|r 568 GLNYGIDFKGGIQLGVLAN------------RPVDLSVVRSNLES---------------------LQIGDISFQNFDG- 613 (833) Q Consensus 568 ~~~~~~~~~~~~~~~~~~~------------~~~~~~~~~~~~~~---------------------~~~~~~~~~~~~~- 613 (833) T Consensus 3 ~f~~GiDF~GG~~~~~~~~p~~flvy~~~~~~~~~~~~~r~~l~~~sgGvlGeryef~Y~~~~~~~~~~~~~~~~~~~s~ 82 (307) T TIGR00966 3 GFNFGIDFTGGTVIELRLEPAAFLVYSNTQKQAADVAEVRDVLEKASGGVLGERYEFLYKELDVLEAGIEGVVIQEFGSP 82 (307) T ss_pred CCCCCEECCCCEEEEEEECCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHCCHHHCCCCCCEEEEECCC T ss_conf 88777030376799997458568998488851757999999985306861102465554003201115787047740475 Q ss_pred ---CCCEEEEEECCCCCCCHHHHHHHHHHHHHCC-----CCCCCCCCCCCCCC---CHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf ---7640244311555420235678877754101-----24443333211121---013578998457999999999999 Q gi|254780925|r 614 ---EKNFLVRLQYQPGDSVAQTRVLEMVKKKITE-----IVPLSTIQNTEIVG---PKISRELIRKGIVGVIISAIAMLI 682 (833) Q Consensus 614 ---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~v~---~~~~~~~~~~~~~a~~~al~~I~i 682 (833) T Consensus 83 ~F~~~~~~~~ir~~~~~~~~~~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~VGF~~p~vg~~L~~~a~~al~~al~~I~~ 162 (307) T TIGR00966 83 TFRGDEHDLMIRIPTLDTEQSEEVREAVEEALKNKKGADVDFDAEIRSIDFVGFVDPSVGGELARKAVLALLAALVLILI 162 (307) T ss_pred CEECCCEEEEEEEEEEECHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHH T ss_conf 41046517999963010313789999999750334577778561167676416768741389999999999999999999 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----CCCCCHHHHHHHHHHHHHHHCCEEEEEEEEHHHHHH--CCCCCC Q ss_conf 99999999989999999999999999999997----571456999999999975335747887210355550--577999 Q gi|254780925|r 683 YIWIRFKWYFALGAITTLILDITKTLGFFALF----GIEFNLTAVAAVLTLIGYSVNDKVVVYDRMRKNMKL--YTTSIS 756 (833) Q Consensus 683 ~i~~rf~~~~~i~aiial~~~v~~~~g~~~~~----g~~~~~~~i~~~l~iiG~svd~~I~~~~RirE~~~~--~~~~~~ 756 (833) T Consensus 163 Y~~~RFew~~A~gai~AL~HDv~~t~G~~~~fGlvG~~E~~l~~vaAlLTiiGYS~NDTVVvFDR~REn~~~~~k~~~~~ 242 (307) T TIGR00966 163 YIGVRFEWRFALGAIVALVHDVIITVGVFSLFGLVGGIEVNLTTVAALLTIIGYSINDTVVVFDRIRENLRGFQKYKRKT 242 (307) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECHHHHHHHHHHHHEEEEEEEEEEECCHHHHHHHHCCCCCC T ss_conf 99998888889999999999999999999998423734443899888888761134337999803055555431467989 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHH-----HHHHHHHHHHHHHHHHHHHHHH Q ss_conf 89999999987779999999999999999997053435-----6638999999999999999999 Q gi|254780925|r 757 FRDLIDKSINETLGRSVYTSMAAFISVLPMAVWGGSVI-----GSFAIPMAFGIVVAASSSIFIA 816 (833) Q Consensus 757 ~~~~v~~~~~~~~~~~i~ts~tt~~~~~~l~~~~~~~~-----~~f~~~~~~gvi~~~~~sifi~ 816 (833) T Consensus 243 ~~~~~n~SinqTL~RTi~Ts~TTll~~l~L~~fGg~~lG~G~L~~FsL~~~vG~~~GTYSSIFiA 307 (307) T TIGR00966 243 LTEVINLSINQTLSRTILTSLTTLLAVLALLVFGGGVLGVGTLKDFSLALLVGVIVGTYSSIFIA 307 (307) T ss_pred HHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCHHEEEHHHHHHEEEEEEEEEEEEEEEEEC T ss_conf 99997466314021124888999999999888631211000021021122244356632457639

HHsearch alignment for GI: 254780925 and conserved domain: TIGR00966