>TIGR01129 secD protein-export membrane protein SecD; InterPro: IPR005791 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component. . From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins. The translocase protein subunits are encoded on the bacterial chromosome. The translocase itself comprises 7 proteins, including a chaperone protein (SecB), an ATPase (SecA), an integral membrane complex (SecCY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) . The chaperone protein SecB is a highly acidic homotetrameric protein that exists as a "dimer of dimers" in the bacterial cytoplasm. SecB maintains preproteins in an unfolded state after translation, and targets these to the peripheral membrane protein ATPase SecA for secretion . Together with SecY and SecG, SecE forms a multimeric channel through which preproteins are translocated, using both proton motive forces and ATP-driven secretion. The latter is mediated by SecA. The structure of the Escherichia coli SecYEG assembly revealed a sandwich of two membranes interacting through the extensive cytoplasmic domains . Each membrane is composed of dimers of SecYEG. The monomeric complex contains 15 transmembrane helices. This entry describes the SecD family of transport proteins. Members of this family are highly variable in length immediately after the well-conserved motif LGLGLXGG at the amino-terminal end of this model. Archaeal homologs are not included in the seed. SecD from Mycobacterium tuberculosis has a long Pro-rich insert. ; GO: 0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity, 0006886 intracellular protein transport, 0009276 1-2nm peptidoglycan-based cell wall.

Probab=100.00 E-value=7.1e-33 Score=212.20 Aligned_cols=173 Identities=20% Similarity=0.476 Sum_probs=160.9 Q ss_pred CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHC-CCCC Q ss_conf 0124443333211121013578998457999999999999999999999899999999999--999999999975-7145 Q gi|254780925|r 643 TEIVPLSTIQNTEIVGPKISRELIRKGIVGVIISAIAMLIYIWIRFKWYFALGAITTLILD--ITKTLGFFALFG-IEFN 719 (833) Q Consensus 643 ~~~~~~~~~~~~~~v~~~~~~~~~~~~~~a~~~al~~I~i~i~~rf~~~~~i~aiial~~~--v~~~~g~~~~~g-~~~~ 719 (833) T Consensus 346 GaLP~~~~~~e~r~iGP~LG~d~i~~G~~A~~~Gl~lV~~FM~~yY~~-~G~~A~~aL~~n~m~~~ila~ls~~~gaTLT 424 (522) T TIGR01129 346 GALPAPLQILEERTIGPSLGADSIEAGIKAGLIGLVLVLVFMIVYYRL-FGLIAAIALVINGMIVLILAVLSAFGGATLT 424 (522) T ss_pred HHCCCCCEEEEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCEEC T ss_conf 512546078510220456438999999999999999999999999767-8899999999999999999999852675034 Q ss_pred HHHHHHHHHHHHHHHCCEEEEEEEEHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHH Q ss_conf 69999999999753357478872103555505779998999999998777999999999999999999705343566389 Q gi|254780925|r 720 LTAVAAVLTLIGYSVNDKVVVYDRMRKNMKLYTTSISFRDLIDKSINETLGRSVYTSMAAFISVLPMAVWGGSVIGSFAI 799 (833) Q Consensus 720 ~~~i~~~l~iiG~svd~~I~~~~RirE~~~~~~~~~~~~~~v~~~~~~~~~~~i~ts~tt~~~~~~l~~~~~~~~~~f~~ 799 (833) T Consensus 425 LPGIAGliLTiG~AVDaNVlIyERIkEElr---~G~s~~~Ai~~Gf~rA~~~I~DaN~Ttliaa~~Ly~~GtG~vKGFA~ 501 (522) T TIGR01129 425 LPGIAGLILTIGMAVDANVLIYERIKEELR---LGKSVQQAIEAGFERAFSTILDANITTLIAALILYVFGTGPVKGFAV 501 (522) T ss_pred HHHHHHHHHHHHHHHHEEEEEEECHHHHHH---CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH T ss_conf 056899998886551001367402388774---78957899988888899999997399999999998860252257889 Q ss_pred HHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999999 Q gi|254780925|r 800 PMAFGIVVAASSSIFIAAPI 819 (833) Q Consensus 800 ~~~~gvi~~~~~sifi~~~~ 819 (833) T Consensus 502 tl~iGi~~S~fta~~~~R~l 521 (522) T TIGR01129 502 TLAIGIIASLFTALVVTRLL 521 (522) T ss_pred HHHHHHHHHHHHHHHHHHHC T ss_conf 89999999999998987540

HHsearch alignment for GI: 254780925 and conserved domain: TIGR01129