BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780926|ref|YP_003065339.1| hypothetical protein CLIBASIA_04125 [Candidatus Liberibacter asiaticus str. psy62] (49 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254780926|ref|YP_003065339.1| hypothetical protein CLIBASIA_04125 [Candidatus Liberibacter asiaticus str. psy62] gi|254040603|gb|ACT57399.1| hypothetical protein CLIBASIA_04125 [Candidatus Liberibacter asiaticus str. psy62] Length = 49 Score = 65.9 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 49/49 (100%), Positives = 49/49 (100%) Query: 1 MKIGSNQDDNDDFACGRKKIDAQEERKIRLASMLRKNLHRRKGQARLKN 49 MKIGSNQDDNDDFACGRKKIDAQEERKIRLASMLRKNLHRRKGQARLKN Sbjct: 1 MKIGSNQDDNDDFACGRKKIDAQEERKIRLASMLRKNLHRRKGQARLKN 49 >gi|170062331|ref|XP_001866622.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167880264|gb|EDS43647.1| conserved hypothetical protein [Culex quinquefasciatus] Length = 353 Score = 35.1 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 4/44 (9%) Query: 5 SNQDDNDDFACGRKKIDAQE----ERKIRLASMLRKNLHRRKGQ 44 + +DD+DD GRK+ID +E ERK+ ++R+N ++GQ Sbjct: 260 AEEDDSDDEPIGRKEIDGEEDFQAERKLNNLDVIRENDEPKEGQ 303 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.318 0.133 0.370 Lambda K H 0.267 0.0408 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 396,001,610 Number of Sequences: 14124377 Number of extensions: 9882983 Number of successful extensions: 22553 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 22546 Number of HSP's gapped (non-prelim): 7 length of query: 49 length of database: 4,842,793,630 effective HSP length: 22 effective length of query: 27 effective length of database: 4,532,057,336 effective search space: 122365548072 effective search space used: 122365548072 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 76 (33.9 bits)