RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780926|ref|YP_003065339.1| hypothetical protein
CLIBASIA_04125 [Candidatus Liberibacter asiaticus str. psy62]
         (49 letters)



>gnl|CDD|29639 cd00541, OMPLA, The outer membrane phospholipase A (OMPLA) is an
           integral membrane enzyme that catalyses the hydrolysis
           of acylester bonds in phospholipids using calcium as a
           cofactor. The enzyme has a fold of transmembrane
           beta-barrels and is widespread among Gram-negative
           bacteria, both in pathogens and nonpathogens. In
           pathogenic bacteria such as Campylobacter coli and
           Helicobacter pylori OMPLA is involved in pathogenesis
           and virulence. In nonpathogenic bacteria the
           physiological function of OMPLA is less clear. The
           Escherichia coli enzyme is involved in the secretion of
           bacteriocins, antibacterial peptides that are produced
           in order to survive under starvation conditions. The
           enzyme activity of OMPLA is strictly regulated to
           prevent uncontrolled breakdown of the surrounding
           phospholipids. The activity of OMPLA can be induced by
           membrane perturbation and concurs with dimerization of
           the enzyme..
          Length = 231

 Score = 26.0 bits (57), Expect = 2.1
 Identities = 14/47 (29%), Positives = 20/47 (42%), Gaps = 4/47 (8%)

Query: 5   SNQDDNDDFA----CGRKKIDAQEERKIRLASMLRKNLHRRKGQARL 47
           S+ DDN D A     G  K+       + +  +LR NL   +G   L
Sbjct: 150 SDDDDNPDIADYRGYGDLKLAYGLGDHLFVLLLLRYNLRTNRGSVEL 196


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.318    0.133    0.370 

Gapped
Lambda     K      H
   0.267   0.0609    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 548,773
Number of extensions: 18008
Number of successful extensions: 51
Number of sequences better than 10.0: 1
Number of HSP's gapped: 51
Number of HSP's successfully gapped: 1
Length of query: 49
Length of database: 6,263,737
Length adjustment: 22
Effective length of query: 27
Effective length of database: 5,788,339
Effective search space: 156285153
Effective search space used: 156285153
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (23.7 bits)